F455218

General Info

Members Datasets Scaffolds Average Seq Length
498 244 996 197

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0143950|Ga0373924_0143950_30_725
Length 231
Sequence MKKRVAILISGRGSNMTALIEAAKAKDYPAEIALVVSNRPDAAGLDRARSCGIPTAVIDHTTFGGDRETFEQALDRQLREQRIDLVCLAGFMRLLTPWFVNRWSGRMLNIHPSLLPSYPGLDTHARALADGVRVHGCTVHFVTADVDHGPIVMQGAVAVHDADDEQSLAARVLAIEHRLLPAAVRAFCERRLVIAGRRVRVKDEVAPAAAFVVPSPVAPADARGDDSSHSA

Samples

Sample ID Description Type Environment
1 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.21
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373924_0143950 3300035410 Bacteria 1041
2 JGI24748J21848_1000001 3300002074 Bacteria 444271
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 JGI25406J46586_10004972 3300003203 Bacteria 6176
5 rootL2_10270263 3300003322 Bacteria 1575
6 Ga0065704_10226521 3300005289 Bacteria 1057
7 Ga0065712_10007428 3300005290 Bacteria 2776
8 Ga0065712_10097629 3300005290 Bacteria 2145
9 Ga0065712_10230829 3300005290 Unclassified 990
10 Ga0065712_10261260 3300005290 Unclassified 936
11 Ga0065715_10006849 3300005293 Bacteria 3230
12 Ga0065715_10089819 3300005293 Bacteria 8424
13 Ga0065715_10096528 3300005293 Unclassified 3863
14 Ga0065715_10234882 3300005293 Bacteria 1220
15 Ga0065715_10288674 3300005293 Bacteria 1068
16 Ga0065715_10452523 3300005293 Unclassified 824
17 Ga0065707_10092664 3300005295 Bacteria 3706
18 Ga0070676_10117649 3300005328 Bacteria 1664
19 Ga0070676_10189056 3300005328 Bacteria 1343
20 Ga0070683_100129090 3300005329 Bacteria 2391
21 Ga0070690_100071973 3300005330 Bacteria 2247
22 Ga0070690_100110116 3300005330 Bacteria 1836
23 Ga0070690_100181611 3300005330 Bacteria 1454
24 Ga0070690_100550259 3300005330 Bacteria 870
25 Ga0070670_100001205 3300005331 Bacteria 20532
26 Ga0070670_100098707 3300005331 Unclassified 2513
27 Ga0068869_100063965 3300005334 Bacteria 2705
28 Ga0068869_100152273 3300005334 Bacteria 1794
29 Ga0070666_10210886 3300005335 Bacteria 1368
30 Ga0070680_100025267 3300005336 Bacteria 4746
31 Ga0070682_100117422 3300005337 Unclassified 1781
32 Ga0068868_100086036 3300005338 Unclassified 2527
33 Ga0068868_100486995 3300005338 Bacteria 1078
34 Ga0070660_100015860 3300005339 Bacteria 5454
35 Ga0070660_100111992 3300005339 Bacteria 2172
36 Ga0070660_100378574 3300005339 Bacteria 1168
37 Ga0070689_100073043 3300005340 Bacteria 2682
38 Ga0070689_100125021 3300005340 Bacteria 2057
39 Ga0070689_100367016 3300005340 Unclassified 1211
40 Ga0070687_100032970 3300005343 Bacteria 2552
41 Ga0070687_100136644 3300005343 Unclassified 1422
42 Ga0070661_100024590 3300005344 Bacteria 4321
43 Ga0070661_100046710 3300005344 Bacteria 3168
44 Ga0070661_100171093 3300005344 Bacteria 1650
45 Ga0070661_100435726 3300005344 Bacteria 1041
46 Ga0070692_10212327 3300005345 Unclassified 1139
47 Ga0070669_100072967 3300005353 Bacteria 2542
48 Ga0070669_100100644 3300005353 Bacteria 2179
49 Ga0070669_100316382 3300005353 Bacteria 1259
50 Ga0070669_100473890 3300005353 Bacteria 1035
51 Ga0070675_100170986 3300005354 Unclassified 1874
52 Ga0070675_100264740 3300005354 Bacteria 1507
53 Ga0070671_100008298 3300005355 Bacteria 8312
54 Ga0070671_100035876 3300005355 Bacteria 4110
55 Ga0070671_100041069 3300005355 Bacteria 3843
56 Ga0070671_100311708 3300005355 Unclassified 1340
57 Ga0070671_100409967 3300005355 Bacteria 1160
58 Ga0070673_100000212 3300005364 Bacteria 28926
59 Ga0070673_100791978 3300005364 Unclassified 875
60 Ga0070688_100158442 3300005365 Bacteria 1554
61 Ga0070659_100000997 3300005366 Bacteria 20800
62 Ga0070659_100001017 3300005366 Bacteria 20562
63 Ga0070659_100173016 3300005366 Bacteria 1770
64 Ga0070667_100159222 3300005367 Unclassified 1987
65 Ga0070667_100828340 3300005367 Unclassified 860
66 Ga0070703_10000049 3300005406 Bacteria 58073
67 Ga0070710_10185525 3300005437 Bacteria 1305
68 Ga0070701_10013106 3300005438 Bacteria 3761
69 Ga0070701_10024328 3300005438 Bacteria 2929
70 Ga0070701_10031103 3300005438 Bacteria 2647
71 Ga0070700_100001704 3300005441 Bacteria 11035
72 Ga0070694_100220977 3300005444 Bacteria 1421
73 Ga0070708_100000191 3300005445 Bacteria 44404
74 Ga0070708_100000712 3300005445 Bacteria 25260
75 Ga0070708_100115867 3300005445 Bacteria 2467
76 Ga0070708_100401702 3300005445 Archaea 1292
77 Ga0070663_100021070 3300005455 Bacteria 4328
78 Ga0070663_100142005 3300005455 Bacteria 1834
79 Ga0070678_100669402 3300005456 Unclassified 932
80 Ga0070662_100004111 3300005457 Bacteria 9145
81 Ga0070662_100096935 3300005457 Bacteria 2225
82 Ga0070681_10002824 3300005458 Bacteria 16037
83 Ga0070681_10090269 3300005458 Bacteria 3014
84 Ga0070681_10279524 3300005458 Bacteria 1580
85 Ga0068867_100157560 3300005459 Bacteria 1788
86 Ga0068867_100200518 3300005459 Bacteria 1597
87 Ga0070685_10176710 3300005466 Bacteria 1371
88 Ga0070706_100014813 3300005467 Bacteria 7207
89 Ga0070706_100015375 3300005467 Bacteria 7068
90 Ga0070706_100130596 3300005467 Unclassified 2344
91 Ga0070706_100178958 3300005467 Bacteria 1980
92 Ga0070707_100073837 3300005468 Bacteria 3289
93 Ga0070707_100085947 3300005468 Bacteria 3041
94 Ga0070707_100120193 3300005468 Bacteria 2550
95 Ga0070707_100157293 3300005468 Archaea 2214
96 Ga0070698_100015126 3300005471 Bacteria 8159
97 Ga0070698_100588645 3300005471 Archaea 1053
98 Ga0070698_100751163 3300005471 Bacteria 918
99 Ga0070699_100032163 3300005518 Bacteria 4530
100 Ga0070699_100154971 3300005518 Bacteria 2027
101 Ga0070679_100002739 3300005530 Bacteria 16044
102 Ga0070679_100020243 3300005530 Bacteria 6484
103 Ga0070697_100047176 3300005536 Bacteria 3494
104 Ga0070697_100066533 3300005536 Bacteria 2946
105 Ga0070697_100177249 3300005536 Bacteria 1806
106 Ga0070697_100254496 3300005536 Bacteria 1502
107 Ga0070697_100255843 3300005536 Bacteria 1498
108 Ga0068853_100005087 3300005539 Bacteria 10262
109 Ga0068853_100010682 3300005539 Bacteria 7433
110 Ga0068853_100101570 3300005539 Bacteria 2543
111 Ga0070672_100175728 3300005543 Bacteria 1783
112 Ga0070672_100178755 3300005543 Bacteria 1767
113 Ga0070686_100097347 3300005544 Bacteria 1980
114 Ga0070695_100291205 3300005545 Bacteria 1203
115 Ga0070695_100476441 3300005545 Bacteria 961
116 Ga0070695_100951287 3300005545 Unclassified 696
117 Ga0070696_100046765 3300005546 Unclassified 3002
118 Ga0070696_100072022 3300005546 Bacteria 2433
119 Ga0070696_100092786 3300005546 Bacteria 2152
120 Ga0070693_100098482 3300005547 Bacteria 1777
121 Ga0070693_100435347 3300005547 Bacteria 917
122 Ga0070665_100237784 3300005548 Bacteria 1822
123 Ga0070704_100077876 3300005549 Bacteria 2430
124 Ga0070704_100391633 3300005549 Bacteria 1183
125 Ga0068855_100457794 3300005563 Bacteria 1391
126 Ga0068855_100459814 3300005563 Bacteria 1388
127 Ga0070664_100002145 3300005564 Bacteria 15812
128 Ga0070664_100021164 3300005564 Bacteria 5357
129 Ga0068857_100241658 3300005577 Bacteria 1653
130 Ga0068854_100065028 3300005578 Bacteria 2651
131 Ga0068856_100005065 3300005614 Bacteria 13041
132 Ga0068856_100995567 3300005614 Bacteria 857
133 Ga0070702_100250650 3300005615 Bacteria 1200
134 Ga0070702_100273481 3300005615 Bacteria 1156
135 Ga0068852_100025692 3300005616 Bacteria 4776
136 Ga0068852_100312414 3300005616 Bacteria 1524
137 Ga0068852_100790209 3300005616 Unclassified 963
138 Ga0068859_100008267 3300005617 Bacteria 10551
139 Ga0068859_100028738 3300005617 Bacteria 5574
140 Ga0068859_100086895 3300005617 Bacteria 3174
141 Ga0068859_100131903 3300005617 Bacteria 2570
142 Ga0068859_100164248 3300005617 Unclassified 2299
143 Ga0068864_100050313 3300005618 Bacteria 3586
144 Ga0068864_100135768 3300005618 Bacteria 2215
145 Ga0068864_100233899 3300005618 Bacteria 1700
146 Ga0068864_100345073 3300005618 Bacteria 1404
147 Ga0068864_100494665 3300005618 Bacteria 1176
148 Ga0068861_100006204 3300005719 Bacteria 8134
149 Ga0068861_100448513 3300005719 Unclassified 1155
150 Ga0068870_10089753 3300005840 Unclassified 1716
151 Ga0068870_10208448 3300005840 Bacteria 1189
152 Ga0068870_10274290 3300005840 Unclassified 1055
153 Ga0068863_100204215 3300005841 Bacteria 1901
154 Ga0068863_100270716 3300005841 Bacteria 1644
155 Ga0068863_100473260 3300005841 Bacteria 1231
156 Ga0068858_100000051 3300005842 Bacteria 120692
157 Ga0068858_100108593 3300005842 Bacteria 2590
158 Ga0068858_100147301 3300005842 Bacteria 2212
159 Ga0068858_100620755 3300005842 Bacteria 1049
160 Ga0068858_100813773 3300005842 Bacteria 912
161 Ga0068860_100061286 3300005843 Unclassified 3574
162 Ga0068860_100423456 3300005843 Bacteria 1320
163 Ga0068860_101317523 3300005843 Unclassified 743
164 Ga0068862_100008314 3300005844 Bacteria 8587
165 Ga0068862_100053059 3300005844 Bacteria 3470
166 Ga0068862_100088469 3300005844 Bacteria 2695
167 Ga0068862_100122516 3300005844 Bacteria 2293
168 Ga0068862_100416813 3300005844 Bacteria 1259
169 Ga0081455_10414226 3300005937 Bacteria 931
170 Ga0081539_10001244 3300005985 Bacteria 45293
171 Ga0070716_100000003 3300006173 Bacteria 312721
172 Ga0070716_100295903 3300006173 Bacteria 1124
173 Ga0097621_100081546 3300006237 Unclassified 2692
174 Ga0097621_100102507 3300006237 Bacteria 2409
175 Ga0097621_100134105 3300006237 Bacteria 2110
176 Ga0068871_100477828 3300006358 Bacteria 1120
177 Ga0075428_100143367 3300006844 Bacteria 2597
178 Ga0075428_100308704 3300006844 Bacteria 1700
179 Ga0075433_10027319 3300006852 Bacteria 4838
180 Ga0075434_100418798 3300006871 Bacteria 1360
181 Ga0075434_100424810 3300006871 Bacteria 1350
182 Ga0075429_100008602 3300006880 Bacteria 8878
183 Ga0075429_100046987 3300006880 Bacteria 3756
184 Ga0068865_100038472 3300006881 Bacteria 3238
185 Ga0068865_100107062 3300006881 Unclassified 2056
186 Ga0068865_100861070 3300006881 Bacteria 786
187 Ga0068865_101024061 3300006881 Unclassified 724
188 Ga0097620_100008267 3300006931 Bacteria 10551
189 Ga0097620_100028740 3300006931 Bacteria 5574
190 Ga0097620_100086894 3300006931 Bacteria 3174
191 Ga0097620_100131901 3300006931 Bacteria 2570
192 Ga0097620_100164243 3300006931 Unclassified 2299
193 Ga0075435_100624793 3300007076 Bacteria 934
194 Ga0105251_10238313 3300009011 Unclassified 819
195 Ga0111539_10065088 3300009094 Bacteria 4310
196 Ga0111539_10144414 3300009094 Bacteria 2786
197 Ga0111539_10384707 3300009094 Bacteria 1634
198 Ga0105245_10045151 3300009098 Bacteria 3934
199 Ga0105247_10000004 3300009101 Bacteria 455497
200 Ga0114129_10021399 3300009147 Bacteria 9181
201 Ga0114129_10035058 3300009147 Bacteria 7089
202 Ga0114129_10300936 3300009147 Bacteria 2138
203 Ga0114129_10514373 3300009147 Bacteria 1562
204 Ga0114129_11446692 3300009147 Unclassified 846
205 Ga0105243_10000446 3300009148 Bacteria 43049
206 Ga0105243_10470793 3300009148 Bacteria 1183
207 Ga0105243_10549971 3300009148 Bacteria 1103
208 Ga0105241_10549829 3300009174 Bacteria 1036
209 Ga0105241_10590782 3300009174 Bacteria 1002
210 Ga0105241_10612916 3300009174 Bacteria 984
211 Ga0105241_11041697 3300009174 Bacteria 767
212 Ga0105242_10001013 3300009176 Bacteria 22070
213 Ga0105242_10003928 3300009176 Bacteria 11551
214 Ga0105242_10023838 3300009176 Bacteria 4827
215 Ga0105242_10081745 3300009176 Bacteria 2702
216 Ga0105242_10918653 3300009176 Unclassified 877
217 Ga0105248_10013612 3300009177 Bacteria 8955
218 Ga0105248_10421429 3300009177 Bacteria 1503
219 Ga0105248_10695275 3300009177 Bacteria 1147
220 Ga0105248_10814322 3300009177 Bacteria 1054
221 Ga0105248_10854147 3300009177 Bacteria 1027
222 Ga0105248_11105142 3300009177 Unclassified 896
223 Ga0105237_10050235 3300009545 Bacteria 4190
224 Ga0105249_10017805 3300009553 Bacteria 6313
225 Ga0105249_10106766 3300009553 Bacteria 2642
226 Ga0105249_10799596 3300009553 Bacteria 1007
227 Ga0105249_11169482 3300009553 Unclassified 840
228 Ga0099796_10246599 3300010159 Bacteria 740
229 Ga0105239_10298715 3300010375 Unclassified 1813
230 Ga0105239_10426036 3300010375 Bacteria 1504
231 Ga0105246_10057378 3300011119 Bacteria 2694
232 Ga0105246_10187732 3300011119 Unclassified 1597
233 Ga0157373_10009902 3300013100 Bacteria 7026
234 Ga0157373_10025815 3300013100 Unclassified 4247
235 Ga0157371_10002099 3300013102 Bacteria 19457
236 Ga0157370_10304894 3300013104 Bacteria 1470
237 Ga0157369_10346478 3300013105 Bacteria 1543
238 Ga0157369_10357543 3300013105 Bacteria 1516
239 Ga0157374_10096903 3300013296 Bacteria 2821
240 Ga0157378_10000004 3300013297 Bacteria 201051
241 Ga0157378_10008455 3300013297 Bacteria 8965
242 Ga0157378_10015793 3300013297 Bacteria 6612
243 Ga0157378_10019632 3300013297 Bacteria 5941
244 Ga0157378_10116895 3300013297 Bacteria 2453
245 Ga0157378_10214352 3300013297 Unclassified 1827
246 Ga0157378_10546937 3300013297 Bacteria 1163
247 Ga0157378_10623294 3300013297 Bacteria 1092
248 Ga0157378_11265022 3300013297 Unclassified 778
249 Ga0163162_10026360 3300013306 Bacteria 5744
250 Ga0163162_10047575 3300013306 Bacteria 4299
251 Ga0163162_10118009 3300013306 Bacteria 2755
252 Ga0163162_10207060 3300013306 Bacteria 2091
253 Ga0163162_10985617 3300013306 Unclassified 952
254 Ga0157372_10002796 3300013307 Bacteria 18867
255 Ga0157372_10010938 3300013307 Bacteria 9657
256 Ga0157372_10070958 3300013307 Bacteria 3921
257 Ga0157375_10000479 3300013308 Bacteria 36426
258 Ga0157375_10054284 3300013308 Bacteria 3946
259 Ga0157375_10066315 3300013308 Unclassified 3603
260 Ga0157375_10145214 3300013308 Bacteria 2503
261 Ga0157375_10236150 3300013308 Unclassified 1987
262 Ga0157375_10499273 3300013308 Bacteria 1381
263 Ga0157375_10759080 3300013308 Bacteria 1121
264 Ga0157375_10843862 3300013308 Bacteria 1063
265 Ga0163163_10003828 3300014325 Bacteria 12813
266 Ga0163163_10063185 3300014325 Unclassified 3670
267 Ga0163163_10229485 3300014325 Bacteria 1905
268 Ga0163163_10638982 3300014325 Unclassified 1128
269 Ga0163163_10693279 3300014325 Unclassified 1082
270 Ga0163163_10720689 3300014325 Unclassified 1061
271 Ga0163163_10803800 3300014325 Bacteria 1004
272 Ga0157380_10001887 3300014326 Bacteria 13902
273 Ga0157380_10002797 3300014326 Bacteria 11862
274 Ga0157380_10041947 3300014326 Bacteria 3574
275 Ga0157377_10174066 3300014745 Unclassified 1348
276 Ga0157377_10738961 3300014745 Bacteria 719
277 Ga0163161_10410496 3300017792 Unclassified 1087
278 Ga0163161_10599949 3300017792 Bacteria 908
279 Ga0213876_10000112 3300021384 Bacteria 89665
280 Ga0207672_1000002 3300025223 Bacteria 31879
281 Ga0207653_10000163 3300025885 Bacteria 47337
282 Ga0207692_10315608 3300025898 Bacteria 955
283 Ga0207642_10070031 3300025899 Bacteria 1665
284 Ga0207642_10131299 3300025899 Bacteria 1308
285 Ga0207710_10000002 3300025900 Bacteria 1251998
286 Ga0207680_10034812 3300025903 Bacteria 2884
287 Ga0207645_10014191 3300025907 Bacteria 5336
288 Ga0207645_10340095 3300025907 Bacteria 1003
289 Ga0207643_10103372 3300025908 Bacteria 1672
290 Ga0207684_10001129 3300025910 Bacteria 29818
291 Ga0207684_10067409 3300025910 Bacteria 3042
292 Ga0207684_10119015 3300025910 Bacteria 2264
293 Ga0207684_10470421 3300025910 Archaea 1079
294 Ga0207684_10520722 3300025910 Unclassified 1019
295 Ga0207654_10505856 3300025911 Bacteria 853
296 Ga0207707_10000008 3300025912 Bacteria 330313
297 Ga0207707_10026167 3300025912 Bacteria 5101
298 Ga0207707_10512896 3300025912 Bacteria 1022
299 Ga0207660_10019420 3300025917 Bacteria 4544
300 Ga0207662_10016043 3300025918 Unclassified 4222
301 Ga0207662_10064160 3300025918 Bacteria 2209
302 Ga0207662_10252639 3300025918 Unclassified 1158
303 Ga0207657_10001461 3300025919 Bacteria 25304
304 Ga0207657_10056266 3300025919 Bacteria 3394
305 Ga0207657_10120581 3300025919 Bacteria 2158
306 Ga0207657_10335503 3300025919 Bacteria 1194
307 Ga0207649_10186955 3300025920 Bacteria 1454
308 Ga0207649_10490050 3300025920 Bacteria 933
309 Ga0207652_10000085 3300025921 Bacteria 101176
310 Ga0207652_10155141 3300025921 Bacteria 2051
311 Ga0207652_10193390 3300025921 Bacteria 1830
312 Ga0207646_10042513 3300025922 Unclassified 4082
313 Ga0207646_10250256 3300025922 Archaea 1601
314 Ga0207646_10274039 3300025922 Unclassified 1525
315 Ga0207646_10524731 3300025922 Unclassified 1066
316 Ga0207681_10115201 3300025923 Bacteria 1962
317 Ga0207681_10170327 3300025923 Bacteria 1650
318 Ga0207681_10553045 3300025923 Bacteria 947
319 Ga0207650_10000675 3300025925 Bacteria 26793
320 Ga0207659_10142165 3300025926 Bacteria 1864
321 Ga0207659_10387846 3300025926 Bacteria 1166
322 Ga0207687_10281420 3300025927 Bacteria 1333
323 Ga0207644_10000179 3300025931 Bacteria 45397
324 Ga0207644_10003580 3300025931 Bacteria 10053
325 Ga0207644_10043980 3300025931 Bacteria 3171
326 Ga0207690_10002569 3300025932 Bacteria 10965
327 Ga0207690_10045877 3300025932 Bacteria 2890
328 Ga0207706_10000040 3300025933 Bacteria 132285
329 Ga0207706_10047991 3300025933 Bacteria 3776
330 Ga0207706_10088891 3300025933 Bacteria 2716
331 Ga0207706_10491213 3300025933 Unclassified 1060
332 Ga0207686_10000003 3300025934 Bacteria 376934
333 Ga0207686_10000127 3300025934 Bacteria 61880
334 Ga0207686_10000965 3300025934 Bacteria 17144
335 Ga0207686_10075763 3300025934 Bacteria 2179
336 Ga0207709_10000017 3300025935 Bacteria 470753
337 Ga0207709_10003560 3300025935 Bacteria 9208
338 Ga0207709_10259618 3300025935 Bacteria 1273
339 Ga0207670_10059209 3300025936 Bacteria 2605
340 Ga0207670_10497503 3300025936 Unclassified 989
341 Ga0207704_10072800 3300025938 Unclassified 2186
342 Ga0207704_10160850 3300025938 Bacteria 1597
343 Ga0207665_10000003 3300025939 Bacteria 220666
344 Ga0207691_10000845 3300025940 Bacteria 30493
345 Ga0207691_10071431 3300025940 Bacteria 3132
346 Ga0207691_10200522 3300025940 Bacteria 1737
347 Ga0207711_10524895 3300025941 Bacteria 1104
348 Ga0207711_10586191 3300025941 Bacteria 1040
349 Ga0207689_10001578 3300025942 Bacteria 21602
350 Ga0207689_10013933 3300025942 Bacteria 6848
351 Ga0207689_10075365 3300025942 Bacteria 2773
352 Ga0207689_10477356 3300025942 Unclassified 1044
353 Ga0207661_10206394 3300025944 Bacteria 1730
354 Ga0207679_10014249 3300025945 Bacteria 5223
355 Ga0207679_10085908 3300025945 Bacteria 2418
356 Ga0207679_10122103 3300025945 Bacteria 2076
357 Ga0207667_10016457 3300025949 Bacteria 8356
358 Ga0207667_10370712 3300025949 Bacteria 1459
359 Ga0207667_11093036 3300025949 Unclassified 781
360 Ga0207651_10000458 3300025960 Bacteria 17210
361 Ga0207651_10083005 3300025960 Bacteria 2316
362 Ga0207651_10217531 3300025960 Bacteria 1542
363 Ga0207651_10842905 3300025960 Unclassified 814
364 Ga0207712_10407046 3300025961 Bacteria 1145
365 Ga0207640_10038600 3300025981 Bacteria 3015
366 Ga0207640_10095816 3300025981 Bacteria 2067
367 Ga0207658_10801764 3300025986 Bacteria 855
368 Ga0207677_10196867 3300026023 Bacteria 1598
369 Ga0207677_10384693 3300026023 Unclassified 1185
370 Ga0207703_10000114 3300026035 Bacteria 96051
371 Ga0207703_10529451 3300026035 Unclassified 1109
372 Ga0207703_11451440 3300026035 Unclassified 660
373 Ga0207639_10022909 3300026041 Bacteria 4504
374 Ga0207639_10024805 3300026041 Bacteria 4345
375 Ga0207639_10126280 3300026041 Bacteria 2110
376 Ga0207678_10193285 3300026067 Bacteria 1740
377 Ga0207708_10003764 3300026075 Bacteria 11175
378 Ga0207708_10068329 3300026075 Bacteria 2720
379 Ga0207702_10143299 3300026078 Bacteria 2165
380 Ga0207641_10049788 3300026088 Bacteria 3542
381 Ga0207641_10284056 3300026088 Bacteria 1558
382 Ga0207641_11055260 3300026088 Unclassified 810
383 Ga0207648_10166571 3300026089 Unclassified 1947
384 Ga0207648_10222715 3300026089 Bacteria 1677
385 Ga0207648_10421987 3300026089 Bacteria 1211
386 Ga0207676_10011521 3300026095 Bacteria 6324
387 Ga0207676_10045523 3300026095 Bacteria 3391
388 Ga0207676_10179495 3300026095 Bacteria 1853
389 Ga0207676_10269075 3300026095 Unclassified 1542
390 Ga0207676_10379037 3300026095 Unclassified 1316
391 Ga0207674_10002177 3300026116 Bacteria 24786
392 Ga0207674_10203461 3300026116 Bacteria 1929
393 Ga0207675_100005128 3300026118 Bacteria 12611
394 Ga0207675_100580907 3300026118 Bacteria 1122
395 Ga0207683_10436456 3300026121 Bacteria 1207
396 Ga0209983_1044634 3300027665 Bacteria 963
397 Ga0207428_10001780 3300027907 Bacteria 22062
398 Ga0207428_10038699 3300027907 Bacteria 3875
399 Ga0268265_10025222 3300028380 Bacteria 4217
400 Ga0268265_10325009 3300028380 Bacteria 1395
401 Ga0268265_10377246 3300028380 Bacteria 1303
402 Ga0268265_10382835 3300028380 Unclassified 1295
403 Ga0268264_10664672 3300028381 Bacteria 1032
404 Ga0307405_10011070 3300031731 Bacteria 4709
405 Ga0307413_10114587 3300031824 Bacteria 1812
406 Ga0307407_10069112 3300031903 Bacteria 2095
407 Ga0307412_10111368 3300031911 Bacteria 1955
408 Ga0307414_10038324 3300032004 Bacteria 3218
409 Ga0307414_10194859 3300032004 Bacteria 1643
410 Ga0307415_100242011 3300032126 Bacteria 1460
411 Ga0373952_0025361 3300035092 Bacteria 1280
412 Ga0373923_0027593 3300035111 Bacteria 2266
413 Ga0373936_0143241 3300035113 Bacteria 1033
414 Ga0373954_0008910 3300035118 Bacteria 4415
415 Ga0373955_0001640 3300035172 Bacteria 9578
416 Ga0373927_0041502 3300035695 Bacteria 2984
417 Ga0373933_0002364 3300035724 Bacteria 10666
418 Ga0373947_0570968 3300035725 Bacteria 770
419 Ga0373937_0002367 3300036401 Bacteria 15699
420 Ga0373925_0436168 3300037068 Bacteria 1071
421 Ga0395898_0161219 3300037466 Bacteria 2145
422 Ga0395905_0004964 3300037471 Bacteria 13707
423 Ga0242420_000770 3300038996 Bacteria 3882
424 Ga0436365_1425589 3300039437 Bacteria 204653
425 Ga0436363_0593977 3300039450 Unclassified 1238
426 Ga0453683_0279070 3300044673 Bacteria 1067
427 Ga0466957_0091648 3300044842 Bacteria 1905
428 Ga0451576_0026804 3300045051 Bacteria 6194
429 Ga0451576_0264042 3300045051 Bacteria 1800
430 Ga0495592_0134551 3300046454 Bacteria 1725
431 Ga0495629_0006722 3300046459 Bacteria 8503
432 Ga0495651_0000265 3300046462 Bacteria 40572
433 Ga0495653_0000794 3300046463 Bacteria 24254
434 Ga0495664_0030987 3300046477 Bacteria 3134
435 Ga0495594_0371333 3300046499 Bacteria 814
436 Ga0495618_0001577 3300046514 Bacteria 15250
437 Ga0495628_0024335 3300046516 Bacteria 4957
438 Ga0495630_0261906 3300046517 Bacteria 1321
439 Ga0495652_0010236 3300046529 Bacteria 8503
440 Ga0495587_0003591 3300046536 Bacteria 10327
441 Ga0495598_0014643 3300046537 Bacteria 1965
442 Ga0495621_0085482 3300046539 Bacteria 1182
443 Ga0495667_0002082 3300046559 Bacteria 13299
444 Ga0495634_0019596 3300046642 Bacteria 4805
445 Ga0495635_0075401 3300046663 Bacteria 2310
446 Ga0495659_0191392 3300046664 Unclassified 836
447 Ga0495657_0082049 3300046675 Bacteria 2084
448 Ga0495599_0157125 3300046678 Bacteria 1406
449 Ga0495623_0150082 3300046679 Bacteria 1378
450 Ga0495646_0005043 3300046680 Bacteria 8328
451 Ga0495613_0400363 3300046689 Bacteria 936
452 Ga0495624_0028165 3300046690 Bacteria 3673
453 Ga0495600_0015406 3300046809 Bacteria 4833
454 Ga0495581_0055077 3300047315 Bacteria 2296
455 Ga0495604_0000118 3300047317 Bacteria 66698
456 Ga0495636_0014016 3300047318 Bacteria 3186
457 Ga0495674_0035843 3300047319 Bacteria 4472
458 Ga0495676_0024770 3300047321 Bacteria 5187
459 Ga0495680_0001567 3300047322 Bacteria 24484
460 Ga0495675_0017097 3300047444 Bacteria 4592
461 Ga0495684_0094079 3300047471 Bacteria 2270
462 Ga0495593_0042124 3300047673 Bacteria 2452
463 Ga0495602_0171041 3300048088 Bacteria 1686
464 Ga0496101_0783079 3300048904 Bacteria 752
465 Ga0496102_0417597 3300048905 Bacteria 1260
466 Ga0496102_0494783 3300048905 Bacteria 1144
467 Ga0496103_0385706 3300048906 Bacteria 900
468 Ga0496104_0126305 3300048907 Bacteria 2456
469 Ga0496104_0154561 3300048907 Bacteria 2202
470 Ga0496106_0001061 3300048909 Bacteria 20265
471 Ga0496106_0013867 3300048909 Bacteria 5955
472 Ga0496106_0114781 3300048909 Bacteria 2100
473 Ga0496107_0521092 3300048910 Bacteria 881
474 Ga0496109_0387194 3300048912 Bacteria 1321
475 Ga0496109_0471231 3300048912 Unclassified 1186
476 Ga0496109_0689132 3300048912 Bacteria 959
477 Ga0496111_0783394 3300048914 Bacteria 691
478 Ga0496114_0015654 3300048917 Bacteria 6102
479 Ga0496115_0244161 3300048918 Bacteria 1480
480 Ga0501048_0949693 3300049582 Bacteria 618
481 nmdc:mga05p37_1251401_c1 3300050507 Unclassified 761
482 nmdc:mga05p37_131870_c1 3300050507 Bacteria 3066
483 nmdc:mga05p37_370776_c1 3300050507 Bacteria 1680
484 nmdc:mga05p37_494463_c1 3300050507 Bacteria 1405
485 nmdc:mga09592_44391_c1 3300050508 Bacteria 3741
486 nmdc:mga09592_57792_c1 3300050508 Bacteria 3279
487 nmdc:mga0n895_303321_c1 3300050512 Bacteria 1619
488 nmdc:mga0n895_511244_c1 3300050512 Bacteria 1209
489 nmdc:mga0n895_655403_c1 3300050512 Bacteria 1048
490 nmdc:mga0a205_321973_c1 3300050515 Bacteria 1417
491 nmdc:mga0a205_785940_c1 3300050515 Bacteria 800
492 nmdc:mga0a205_79798_c1 3300050515 Unclassified 3162
493 Ga0495601_0088382 3300053077 Bacteria 1992
494 Ga0495601_0139145 3300053077 Bacteria 1583
495 Ga0495612_0003390 3300053078 Bacteria 6603
496 Ga0495595_0000324 3300053084 Bacteria 18614
497 Ga0495619_0135725 3300053085 Bacteria 1692
498 Ga0530510_0087213 3300061734 Bacteria 2274
499 Ga0373924_0143950
500 JGI24748J21848_1000001
501 JGI24034J26672_10000001
502 JGI25406J46586_10004972
503 rootL2_10270263
504 Ga0065704_10226521
505 Ga0065712_10007428
506 Ga0065712_10097629
507 Ga0065712_10230829
508 Ga0065712_10261260
509 Ga0065715_10006849
510 Ga0065715_10089819
511 Ga0065715_10096528
512 Ga0065715_10234882
513 Ga0065715_10288674
514 Ga0065715_10452523
515 Ga0065707_10092664
516 Ga0070676_10117649
517 Ga0070676_10189056
518 Ga0070683_100129090
519 Ga0070690_100071973
520 Ga0070690_100110116
521 Ga0070690_100181611
522 Ga0070690_100550259
523 Ga0070670_100001205
524 Ga0070670_100098707
525 Ga0068869_100063965
526 Ga0068869_100152273
527 Ga0070666_10210886
528 Ga0070680_100025267
529 Ga0070682_100117422
530 Ga0068868_100086036
531 Ga0068868_100486995
532 Ga0070660_100015860
533 Ga0070660_100111992
534 Ga0070660_100378574
535 Ga0070689_100073043
536 Ga0070689_100125021
537 Ga0070689_100367016
538 Ga0070687_100032970
539 Ga0070687_100136644
540 Ga0070661_100024590
541 Ga0070661_100046710
542 Ga0070661_100171093
543 Ga0070661_100435726
544 Ga0070692_10212327
545 Ga0070669_100072967
546 Ga0070669_100100644
547 Ga0070669_100316382
548 Ga0070669_100473890
549 Ga0070675_100170986
550 Ga0070675_100264740
551 Ga0070671_100008298
552 Ga0070671_100035876
553 Ga0070671_100041069
554 Ga0070671_100311708
555 Ga0070671_100409967
556 Ga0070673_100000212
557 Ga0070673_100791978
558 Ga0070688_100158442
559 Ga0070659_100000997
560 Ga0070659_100001017
561 Ga0070659_100173016
562 Ga0070667_100159222
563 Ga0070667_100828340
564 Ga0070703_10000049
565 Ga0070710_10185525
566 Ga0070701_10013106
567 Ga0070701_10024328
568 Ga0070701_10031103
569 Ga0070700_100001704
570 Ga0070694_100220977
571 Ga0070708_100000191
572 Ga0070708_100000712
573 Ga0070708_100115867
574 Ga0070708_100401702
575 Ga0070663_100021070
576 Ga0070663_100142005
577 Ga0070678_100669402
578 Ga0070662_100004111
579 Ga0070662_100096935
580 Ga0070681_10002824
581 Ga0070681_10090269
582 Ga0070681_10279524
583 Ga0068867_100157560
584 Ga0068867_100200518
585 Ga0070685_10176710
586 Ga0070706_100014813
587 Ga0070706_100015375
588 Ga0070706_100130596
589 Ga0070706_100178958
590 Ga0070707_100073837
591 Ga0070707_100085947
592 Ga0070707_100120193
593 Ga0070707_100157293
594 Ga0070698_100015126
595 Ga0070698_100588645
596 Ga0070698_100751163
597 Ga0070699_100032163
598 Ga0070699_100154971
599 Ga0070679_100002739
600 Ga0070679_100020243
601 Ga0070697_100047176
602 Ga0070697_100066533
603 Ga0070697_100177249
604 Ga0070697_100254496
605 Ga0070697_100255843
606 Ga0068853_100005087
607 Ga0068853_100010682
608 Ga0068853_100101570
609 Ga0070672_100175728
610 Ga0070672_100178755
611 Ga0070686_100097347
612 Ga0070695_100291205
613 Ga0070695_100476441
614 Ga0070695_100951287
615 Ga0070696_100046765
616 Ga0070696_100072022
617 Ga0070696_100092786
618 Ga0070693_100098482
619 Ga0070693_100435347
620 Ga0070665_100237784
621 Ga0070704_100077876
622 Ga0070704_100391633
623 Ga0068855_100457794
624 Ga0068855_100459814
625 Ga0070664_100002145
626 Ga0070664_100021164
627 Ga0068857_100241658
628 Ga0068854_100065028
629 Ga0068856_100005065
630 Ga0068856_100995567
631 Ga0070702_100250650
632 Ga0070702_100273481
633 Ga0068852_100025692
634 Ga0068852_100312414
635 Ga0068852_100790209
636 Ga0068859_100008267
637 Ga0068859_100028738
638 Ga0068859_100086895
639 Ga0068859_100131903
640 Ga0068859_100164248
641 Ga0068864_100050313
642 Ga0068864_100135768
643 Ga0068864_100233899
644 Ga0068864_100345073
645 Ga0068864_100494665
646 Ga0068861_100006204
647 Ga0068861_100448513
648 Ga0068870_10089753
649 Ga0068870_10208448
650 Ga0068870_10274290
651 Ga0068863_100204215
652 Ga0068863_100270716
653 Ga0068863_100473260
654 Ga0068858_100000051
655 Ga0068858_100108593
656 Ga0068858_100147301
657 Ga0068858_100620755
658 Ga0068858_100813773
659 Ga0068860_100061286
660 Ga0068860_100423456
661 Ga0068860_101317523
662 Ga0068862_100008314
663 Ga0068862_100053059
664 Ga0068862_100088469
665 Ga0068862_100122516
666 Ga0068862_100416813
667 Ga0081455_10414226
668 Ga0081539_10001244
669 Ga0070716_100000003
670 Ga0070716_100295903
671 Ga0097621_100081546
672 Ga0097621_100102507
673 Ga0097621_100134105
674 Ga0068871_100477828
675 Ga0075428_100143367
676 Ga0075428_100308704
677 Ga0075433_10027319
678 Ga0075434_100418798
679 Ga0075434_100424810
680 Ga0075429_100008602
681 Ga0075429_100046987
682 Ga0068865_100038472
683 Ga0068865_100107062
684 Ga0068865_100861070
685 Ga0068865_101024061
686 Ga0097620_100008267
687 Ga0097620_100028740
688 Ga0097620_100086894
689 Ga0097620_100131901
690 Ga0097620_100164243
691 Ga0075435_100624793
692 Ga0105251_10238313
693 Ga0111539_10065088
694 Ga0111539_10144414
695 Ga0111539_10384707
696 Ga0105245_10045151
697 Ga0105247_10000004
698 Ga0114129_10021399
699 Ga0114129_10035058
700 Ga0114129_10300936
701 Ga0114129_10514373
702 Ga0114129_11446692
703 Ga0105243_10000446
704 Ga0105243_10470793
705 Ga0105243_10549971
706 Ga0105241_10549829
707 Ga0105241_10590782
708 Ga0105241_10612916
709 Ga0105241_11041697
710 Ga0105242_10001013
711 Ga0105242_10003928
712 Ga0105242_10023838
713 Ga0105242_10081745
714 Ga0105242_10918653
715 Ga0105248_10013612
716 Ga0105248_10421429
717 Ga0105248_10695275
718 Ga0105248_10814322
719 Ga0105248_10854147
720 Ga0105248_11105142
721 Ga0105237_10050235
722 Ga0105249_10017805
723 Ga0105249_10106766
724 Ga0105249_10799596
725 Ga0105249_11169482
726 Ga0099796_10246599
727 Ga0105239_10298715
728 Ga0105239_10426036
729 Ga0105246_10057378
730 Ga0105246_10187732
731 Ga0157373_10009902
732 Ga0157373_10025815
733 Ga0157371_10002099
734 Ga0157370_10304894
735 Ga0157369_10346478
736 Ga0157369_10357543
737 Ga0157374_10096903
738 Ga0157378_10000004
739 Ga0157378_10008455
740 Ga0157378_10015793
741 Ga0157378_10019632
742 Ga0157378_10116895
743 Ga0157378_10214352
744 Ga0157378_10546937
745 Ga0157378_10623294
746 Ga0157378_11265022
747 Ga0163162_10026360
748 Ga0163162_10047575
749 Ga0163162_10118009
750 Ga0163162_10207060
751 Ga0163162_10985617
752 Ga0157372_10002796
753 Ga0157372_10010938
754 Ga0157372_10070958
755 Ga0157375_10000479
756 Ga0157375_10054284
757 Ga0157375_10066315
758 Ga0157375_10145214
759 Ga0157375_10236150
760 Ga0157375_10499273
761 Ga0157375_10759080
762 Ga0157375_10843862
763 Ga0163163_10003828
764 Ga0163163_10063185
765 Ga0163163_10229485
766 Ga0163163_10638982
767 Ga0163163_10693279
768 Ga0163163_10720689
769 Ga0163163_10803800
770 Ga0157380_10001887
771 Ga0157380_10002797
772 Ga0157380_10041947
773 Ga0157377_10174066
774 Ga0157377_10738961
775 Ga0163161_10410496
776 Ga0163161_10599949
777 Ga0213876_10000112
778 Ga0207672_1000002
779 Ga0207653_10000163
780 Ga0207692_10315608
781 Ga0207642_10070031
782 Ga0207642_10131299
783 Ga0207710_10000002
784 Ga0207680_10034812
785 Ga0207645_10014191
786 Ga0207645_10340095
787 Ga0207643_10103372
788 Ga0207684_10001129
789 Ga0207684_10067409
790 Ga0207684_10119015
791 Ga0207684_10470421
792 Ga0207684_10520722
793 Ga0207654_10505856
794 Ga0207707_10000008
795 Ga0207707_10026167
796 Ga0207707_10512896
797 Ga0207660_10019420
798 Ga0207662_10016043
799 Ga0207662_10064160
800 Ga0207662_10252639
801 Ga0207657_10001461
802 Ga0207657_10056266
803 Ga0207657_10120581
804 Ga0207657_10335503
805 Ga0207649_10186955
806 Ga0207649_10490050
807 Ga0207652_10000085
808 Ga0207652_10155141
809 Ga0207652_10193390
810 Ga0207646_10042513
811 Ga0207646_10250256
812 Ga0207646_10274039
813 Ga0207646_10524731
814 Ga0207681_10115201
815 Ga0207681_10170327
816 Ga0207681_10553045
817 Ga0207650_10000675
818 Ga0207659_10142165
819 Ga0207659_10387846
820 Ga0207687_10281420
821 Ga0207644_10000179
822 Ga0207644_10003580
823 Ga0207644_10043980
824 Ga0207690_10002569
825 Ga0207690_10045877
826 Ga0207706_10000040
827 Ga0207706_10047991
828 Ga0207706_10088891
829 Ga0207706_10491213
830 Ga0207686_10000003
831 Ga0207686_10000127
832 Ga0207686_10000965
833 Ga0207686_10075763
834 Ga0207709_10000017
835 Ga0207709_10003560
836 Ga0207709_10259618
837 Ga0207670_10059209
838 Ga0207670_10497503
839 Ga0207704_10072800
840 Ga0207704_10160850
841 Ga0207665_10000003
842 Ga0207691_10000845
843 Ga0207691_10071431
844 Ga0207691_10200522
845 Ga0207711_10524895
846 Ga0207711_10586191
847 Ga0207689_10001578
848 Ga0207689_10013933
849 Ga0207689_10075365
850 Ga0207689_10477356
851 Ga0207661_10206394
852 Ga0207679_10014249
853 Ga0207679_10085908
854 Ga0207679_10122103
855 Ga0207667_10016457
856 Ga0207667_10370712
857 Ga0207667_11093036
858 Ga0207651_10000458
859 Ga0207651_10083005
860 Ga0207651_10217531
861 Ga0207651_10842905
862 Ga0207712_10407046
863 Ga0207640_10038600
864 Ga0207640_10095816
865 Ga0207658_10801764
866 Ga0207677_10196867
867 Ga0207677_10384693
868 Ga0207703_10000114
869 Ga0207703_10529451
870 Ga0207703_11451440
871 Ga0207639_10022909
872 Ga0207639_10024805
873 Ga0207639_10126280
874 Ga0207678_10193285
875 Ga0207708_10003764
876 Ga0207708_10068329
877 Ga0207702_10143299
878 Ga0207641_10049788
879 Ga0207641_10284056
880 Ga0207641_11055260
881 Ga0207648_10166571
882 Ga0207648_10222715
883 Ga0207648_10421987
884 Ga0207676_10011521
885 Ga0207676_10045523
886 Ga0207676_10179495
887 Ga0207676_10269075
888 Ga0207676_10379037
889 Ga0207674_10002177
890 Ga0207674_10203461
891 Ga0207675_100005128
892 Ga0207675_100580907
893 Ga0207683_10436456
894 Ga0209983_1044634
895 Ga0207428_10001780
896 Ga0207428_10038699
897 Ga0268265_10025222
898 Ga0268265_10325009
899 Ga0268265_10377246
900 Ga0268265_10382835
901 Ga0268264_10664672
902 Ga0307405_10011070
903 Ga0307413_10114587
904 Ga0307407_10069112
905 Ga0307412_10111368
906 Ga0307414_10038324
907 Ga0307414_10194859
908 Ga0307415_100242011
909 Ga0373952_0025361
910 Ga0373923_0027593
911 Ga0373936_0143241
912 Ga0373954_0008910
913 Ga0373955_0001640
914 Ga0373927_0041502
915 Ga0373933_0002364
916 Ga0373947_0570968
917 Ga0373937_0002367
918 Ga0373925_0436168
919 Ga0395898_0161219
920 Ga0395905_0004964
921 Ga0242420_000770
922 Ga0436365_1425589
923 Ga0436363_0593977
924 Ga0453683_0279070
925 Ga0466957_0091648
926 Ga0451576_0026804
927 Ga0451576_0264042
928 Ga0495592_0134551
929 Ga0495629_0006722
930 Ga0495651_0000265
931 Ga0495653_0000794
932 Ga0495664_0030987
933 Ga0495594_0371333
934 Ga0495618_0001577
935 Ga0495628_0024335
936 Ga0495630_0261906
937 Ga0495652_0010236
938 Ga0495587_0003591
939 Ga0495598_0014643
940 Ga0495621_0085482
941 Ga0495667_0002082
942 Ga0495634_0019596
943 Ga0495635_0075401
944 Ga0495659_0191392
945 Ga0495657_0082049
946 Ga0495599_0157125
947 Ga0495623_0150082
948 Ga0495646_0005043
949 Ga0495613_0400363
950 Ga0495624_0028165
951 Ga0495600_0015406
952 Ga0495581_0055077
953 Ga0495604_0000118
954 Ga0495636_0014016
955 Ga0495674_0035843
956 Ga0495676_0024770
957 Ga0495680_0001567
958 Ga0495675_0017097
959 Ga0495684_0094079
960 Ga0495593_0042124
961 Ga0495602_0171041
962 Ga0496101_0783079
963 Ga0496102_0417597
964 Ga0496102_0494783
965 Ga0496103_0385706
966 Ga0496104_0126305
967 Ga0496104_0154561
968 Ga0496106_0001061
969 Ga0496106_0013867
970 Ga0496106_0114781
971 Ga0496107_0521092
972 Ga0496109_0387194
973 Ga0496109_0471231
974 Ga0496109_0689132
975 Ga0496111_0783394
976 Ga0496114_0015654
977 Ga0496115_0244161
978 Ga0501048_0949693
979 nmdc:mga05p37_1251401_c1
980 nmdc:mga05p37_131870_c1
981 nmdc:mga05p37_370776_c1
982 nmdc:mga05p37_494463_c1
983 nmdc:mga09592_44391_c1
984 nmdc:mga09592_57792_c1
985 nmdc:mga0n895_303321_c1
986 nmdc:mga0n895_511244_c1
987 nmdc:mga0n895_655403_c1
988 nmdc:mga0a205_321973_c1
989 nmdc:mga0a205_785940_c1
990 nmdc:mga0a205_79798_c1
991 Ga0495601_0088382
992 Ga0495601_0139145
993 Ga0495612_0003390
994 Ga0495595_0000324
995 Ga0495619_0135725
996 Ga0530510_0087213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

3

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9599 2 168
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9559 2 174
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9532 3 174
3av3-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus 0.9483 2 172
3kcq-assembly2.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum 0.9432 3 168
ID Description Score Start End Superfamily
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9619 3 172 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9585 2 168 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9532 3 174 3.40.50.170
3av3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9528 2 169 3.40.50.170
3kcqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9432 3 168 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3C0KBB1-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9798 87 175 GO:0004644
GO:0005829
GO:0006189
AF-Q1IM87-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.976 2 173 GO:0004644
GO:0005737
GO:0006189
AF-A0A2V8G8Z8-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9733 15 173 GO:0004644
GO:0005829
GO:0006189
AF-A0A2M8F696-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9698 2 173 GO:0004644
GO:0005829
GO:0006189
AF-E6W594-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9691 2 173 GO:0004644
GO:0005737
GO:0006189

Map