F455227

General Info

Members Datasets Scaffolds Average Seq Length
498 305 420 249

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_071358|Ga0400483_071358_110_946
Length 278
Sequence MSRYVAGMQWRPLGSPHPSTIGEARMKVLVPVKRVIDYNVKVRVKPDGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKAEEIVAVSIGVEKAQETLRTALAMGADRAILVTATDDVNTDIEPLAVAKILKAVIDEEQPGLVLLGKQAIDNDMNATGQMLAALLGWSQATFASELAVEGDHALVTREVDGGLQKIKVAMPAIVSVDLRLNEPRYASLPNIMKAKKKPLDKKAPADLGVDVAPRLTVVSTTEPEARKAGVRVESVAELVEKLKTEAGVI

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
7 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
8 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
9 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
12 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
13 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
14 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
15 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
16 2643221582 Rhizobium sp. Root651 Isolate Unclassified
17 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
18 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
19 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
20 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
21 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
22 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
23 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
24 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
25 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
26 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
27 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
28 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
29 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
30 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
31 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
32 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
33 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
34 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
35 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
36 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
37 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
38 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
39 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
40 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
41 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
42 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
43 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
44 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
45 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
46 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
47 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
48 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
49 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
50 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
51 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
52 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
53 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
54 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
55 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
56 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
57 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
60 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
104 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
173 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
181 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
182 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
302 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
303 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
304 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
305 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.53
Metatranscriptomes 1.81
Isolates 15.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 1.61
Nodule 3.21
Rhizoplane 4.62
Rhizosphere 75.1
Stem 0
Stem Tuber 0.2
Unclassified 14.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000321 3300001979 Bacteria 20355
2 JGI24739J22299_10003749 3300001989 Bacteria 5802
3 JGI24735J21928_10000185 3300002067 Bacteria 22276
4 JGI24735J21928_10000536 3300002067 Bacteria 13384
5 JGI24738J21930_10008608 3300002075 Bacteria 2318
6 JGI25406J46586_10000707 3300003203 Bacteria 15594
7 Ga0007409J51694_1022478 3300003575 Bacteria 1169
8 Ga0007409J51694_1033728 3300003575 Bacteria 932
9 Ga0055525_1001632 3300003759 Bacteria 3485
10 Ga0055540_1013687 3300003792 Bacteria 2462
11 Ga0065714_10068786 3300005288 Bacteria 4546
12 Ga0070658_10009845 3300005327 Bacteria 7678
13 Ga0070658_10018549 3300005327 Bacteria 5571
14 Ga0070658_10309121 3300005327 Bacteria 1349
15 Ga0070658_10459200 3300005327 Bacteria 1098
16 Ga0070690_100196601 3300005330 Bacteria 1401
17 Ga0070680_100025975 3300005336 Bacteria 4684
18 Ga0070675_100142125 3300005354 Bacteria 2052
19 Ga0070673_100348371 3300005364 Bacteria 1314
20 Ga0070659_100139129 3300005366 Bacteria 1976
21 Ga0070705_100021147 3300005440 Bacteria 3456
22 Ga0070663_100057164 3300005455 Bacteria 2797
23 Ga0070663_100119645 3300005455 Bacteria 1988
24 Ga0070679_100022584 3300005530 Bacteria 6150
25 Ga0068853_100603228 3300005539 Bacteria 1043
26 Ga0070665_100018494 3300005548 Bacteria 6984
27 Ga0070665_100587718 3300005548 Bacteria 1126
28 Ga0070704_100055363 3300005549 Bacteria 2812
29 Ga0068855_100004807 3300005563 Bacteria 16490
30 Ga0068855_100277965 3300005563 Bacteria 1860
31 Ga0068855_100458709 3300005563 Bacteria 1390
32 Ga0068855_100510115 3300005563 Bacteria 1306
33 Ga0068857_100293752 3300005577 Bacteria 1497
34 Ga0068856_100228370 3300005614 Bacteria 1877
35 Ga0068856_100259230 3300005614 Bacteria 1754
36 Ga0068856_100942907 3300005614 Bacteria 882
37 Ga0068852_100388627 3300005616 Bacteria 1370
38 Ga0068859_100023328 3300005617 Bacteria 6210
39 Ga0068862_100025030 3300005844 Bacteria 5010
40 Ga0068862_100081412 3300005844 Bacteria 2809
41 Ga0081539_10000054 3300005985 Bacteria 259053
42 Ga0075428_100173706 3300006844 Bacteria 2335
43 Ga0075430_100059073 3300006846 Bacteria 3224
44 Ga0075429_100148146 3300006880 Bacteria 2055
45 Ga0068865_100101216 3300006881 Bacteria 2110
46 Ga0097620_100023328 3300006931 Bacteria 6210
47 Ga0105251_10000789 3300009011 Bacteria 28691
48 Ga0105251_10021755 3300009011 Bacteria 3342
49 Ga0105240_10000528 3300009093 Bacteria 70421
50 Ga0105240_10009265 3300009093 Bacteria 13964
51 Ga0105240_10167754 3300009093 Bacteria 2602
52 Ga0105240_10205516 3300009093 Bacteria 2305
53 Ga0105240_10213170 3300009093 Bacteria 2255
54 Ga0105240_10238803 3300009093 Bacteria 2108
55 Ga0105241_10073576 3300009174 Bacteria 2659
56 Ga0105241_10154617 3300009174 Bacteria 1880
57 Ga0105241_10196389 3300009174 Bacteria 1683
58 Ga0105241_10233552 3300009174 Bacteria 1551
59 Ga0105237_10032573 3300009545 Bacteria 5276
60 Ga0105237_10056325 3300009545 Bacteria 3935
61 Ga0105238_10126502 3300009551 Bacteria 2534
62 Ga0105238_10162234 3300009551 Bacteria 2211
63 Ga0105238_10250654 3300009551 Bacteria 1749
64 Ga0105239_10099382 3300010375 Bacteria 3217
65 Ga0105239_10102953 3300010375 Bacteria 3160
66 Ga0105239_10106923 3300010375 Bacteria 3099
67 Ga0105239_10191626 3300010375 Bacteria 2288
68 Ga0105239_10297698 3300010375 Bacteria 1817
69 Ga0157373_10249457 3300013100 Bacteria 1255
70 Ga0157371_10008332 3300013102 Bacteria 8273
71 Ga0157370_10023816 3300013104 Bacteria 6074
72 Ga0157370_10028282 3300013104 Bacteria 5517
73 Ga0157370_10075991 3300013104 Bacteria 3165
74 Ga0157370_10126782 3300013104 Bacteria 2382
75 Ga0157369_10000126 3300013105 Bacteria 109644
76 Ga0157369_10007456 3300013105 Bacteria 12599
77 Ga0157369_10167853 3300013105 Bacteria 2313
78 Ga0157372_10115275 3300013307 Bacteria 3080
79 Ga0157380_10137776 3300014326 Bacteria 2092
80 Ga0182008_10050262 3300014497 Bacteria 2069
81 Ga0182006_1044595 3300015261 Bacteria 1729
82 Ga0183363_1005 3300015690 Bacteria 403020
83 Ga0183361_10002 3300016635 Bacteria 907642
84 Ga0183361_10039 3300016635 Bacteria 25237
85 Ga0163161_10049491 3300017792 Bacteria 3038
86 Ga0163161_10226702 3300017792 Bacteria 1449
87 Ga0197907_10533598 3300020069 Bacteria 957
88 Ga0206349_1389287 3300020075 Bacteria 1058
89 Ga0206350_10498766 3300020080 Bacteria 1993
90 Ga0206354_11162103 3300020081 Bacteria 3329
91 Ga0213872_10043710 3300021361 Bacteria 2041
92 Ga0213875_10019792 3300021388 Bacteria 3235
93 Ga0224712_10016383 3300022467 Bacteria 2434
94 Ga0209233_1029195 3300025261 Bacteria 1315
95 Ga0207713_1001874 3300025735 Bacteria 15974
96 Ga0207705_10000909 3300025909 Bacteria 24236
97 Ga0207705_10008134 3300025909 Bacteria 7680
98 Ga0207705_10409579 3300025909 Bacteria 1049
99 Ga0207654_10025279 3300025911 Bacteria 3201
100 Ga0207654_10040815 3300025911 Bacteria 2617
101 Ga0207654_10079946 3300025911 Bacteria 1965
102 Ga0207695_10001649 3300025913 Bacteria 35962
103 Ga0207695_10057015 3300025913 Bacteria 4061
104 Ga0207695_10092956 3300025913 Bacteria 3026
105 Ga0207695_10096687 3300025913 Bacteria 2955
106 Ga0207695_10098468 3300025913 Bacteria 2923
107 Ga0207695_10243967 3300025913 Bacteria 1697
108 Ga0207695_10426145 3300025913 Bacteria 1211
109 Ga0207671_10162637 3300025914 Bacteria 1729
110 Ga0207671_10187577 3300025914 Bacteria 1611
111 Ga0207660_10047341 3300025917 Bacteria 3039
112 Ga0207657_10237941 3300025919 Bacteria 1454
113 Ga0207649_10179012 3300025920 Bacteria 1483
114 Ga0207652_10008279 3300025921 Bacteria 8360
115 Ga0207694_10075189 3300025924 Bacteria 2644
116 Ga0207659_10091733 3300025926 Bacteria 2270
117 Ga0207690_10058112 3300025932 Bacteria 2615
118 Ga0207709_10224066 3300025935 Bacteria 1358
119 Ga0207670_10348293 3300025936 Bacteria 1172
120 Ga0207669_10046192 3300025937 Bacteria 2572
121 Ga0207711_10191826 3300025941 Bacteria 1862
122 Ga0207667_10005385 3300025949 Bacteria 15603
123 Ga0207667_10183027 3300025949 Bacteria 2151
124 Ga0207667_10270906 3300025949 Bacteria 1736
125 Ga0207667_10305436 3300025949 Bacteria 1625
126 Ga0207667_10727265 3300025949 Bacteria 993
127 Ga0207651_10260339 3300025960 Bacteria 1424
128 Ga0207639_10032334 3300026041 Bacteria 3851
129 Ga0207678_10077300 3300026067 Bacteria 2851
130 Ga0207678_10217882 3300026067 Bacteria 1633
131 Ga0207678_10234215 3300026067 Bacteria 1572
132 Ga0207702_10453034 3300026078 Bacteria 1245
133 Ga0207648_10091050 3300026089 Bacteria 2666
134 Ga0207674_10063707 3300026116 Bacteria 3720
135 Ga0209983_1016437 3300027665 Bacteria 1528
136 Ga0209966_1010685 3300027695 Bacteria 1661
137 Ga0209966_1014767 3300027695 Bacteria 1461
138 Ga0209974_10039044 3300027876 Bacteria 1579
139 Ga0268266_10055699 3300028379 Bacteria 3399
140 Ga0268265_10041130 3300028380 Bacteria 3418
141 Ga0268265_10622831 3300028380 Bacteria 1034
142 Ga0265323_10004666 3300028653 Bacteria 5881
143 Ga0265324_10008485 3300029957 Bacteria 4079
144 Ga0265324_10012600 3300029957 Bacteria 3184
145 Ga0237817_11579 3300030083 Bacteria 1099
146 Ga0265330_10002470 3300031235 Bacteria 10054
147 Ga0265340_10000353 3300031247 Bacteria 24451
148 Ga0265340_10001830 3300031247 Bacteria 12157
149 Ga0265340_10178668 3300031247 Bacteria 960
150 Ga0265339_10015108 3300031249 Bacteria 4639
151 Ga0265339_10130288 3300031249 Bacteria 1287
152 Ga0265331_10022694 3300031250 Bacteria 3200
153 Ga0265331_10039047 3300031250 Bacteria 2317
154 Ga0265316_10022994 3300031344 Bacteria 5244
155 Ga0265316_10032425 3300031344 Bacteria 4263
156 Ga0265316_10106641 3300031344 Bacteria 2125
157 Ga0265316_10117251 3300031344 Bacteria 2013
158 Ga0265316_10180089 3300031344 Bacteria 1574
159 Ga0307513_10116644 3300031456 Unclassified 2649
160 Ga0307509_10103946 3300031507 Bacteria 2867
161 Ga0307408_100288238 3300031548 Bacteria 1370
162 Ga0265313_10005546 3300031595 Bacteria 9249
163 Ga0265314_10040683 3300031711 Bacteria 3334
164 Ga0265314_10077461 3300031711 Bacteria 2205
165 Ga0265314_10102259 3300031711 Bacteria 1839
166 Ga0265342_10014194 3300031712 Bacteria 5298
167 Ga0316576_10008183 3300031727 Bacteria 6645
168 Ga0307405_10344407 3300031731 Bacteria 1147
169 Ga0307416_100129991 3300032002 Bacteria 2265
170 Ga0316593_10046868 3300032168 Bacteria 1452
171 Ga0373934_0184746 3300035086 Bacteria 857
172 Ga0373931_0040154 3300035691 Bacteria 2454
173 Ga0373925_0017082 3300037068 Bacteria 5253
174 Ga0373925_0515301 3300037068 Bacteria 982
175 Ga0395899_0000005 3300037312 Bacteria 772966
176 Ga0395899_0000041 3300037312 Bacteria 255615
177 Ga0395899_0005775 3300037312 Bacteria 9606
178 Ga0395900_0000077 3300037418 Bacteria 179525
179 Ga0395900_0000090 3300037418 Bacteria 169213
180 Ga0395900_0000097 3300037418 Bacteria 161598
181 Ga0395900_0058918 3300037418 Bacteria 3953
182 Ga0395900_0205411 3300037418 Bacteria 1991
183 Ga0395900_0903915 3300037418 Bacteria 806
184 Ga0395898_0000003 3300037466 Bacteria 772986
185 Ga0395898_0000220 3300037466 Bacteria 146473
186 Ga0395898_0142502 3300037466 Bacteria 2294
187 Ga0395898_0545405 3300037466 Bacteria 1101
188 Ga0395905_0053858 3300037471 Bacteria 3765
189 Ga0395905_0466454 3300037471 Bacteria 1161
190 Ga0436364_0107567 3300037853 Bacteria 975
191 Ga0436364_0210663 3300037853 Bacteria 9471
192 Ga0436364_0836559 3300037853 Bacteria 4449
193 Ga0395901_0000096 3300038443 Bacteria 118723
194 Ga0395901_0001807 3300038443 Bacteria 22099
195 Ga0395901_0032893 3300038443 Bacteria 5350
196 Ga0400483_038604 3300039062 Bacteria 2294
197 Ga0400483_071358 3300039062 Bacteria 1129
198 Ga0400483_074493 3300039062 Bacteria 1324
199 Ga0400483_167249 3300039062 Bacteria 2817
200 Ga0400483_213659 3300039062 Bacteria 2007
201 Ga0400483_264211 3300039062 Bacteria 4013
202 Ga0436361_0178339 3300039447 Bacteria 3425
203 Ga0436363_0732576 3300039450 Bacteria 1913
204 Ga0439453_0024531 3300041408 Bacteria 1107
205 Ga0451841_0799575 3300041498 Bacteria 1311
206 Ga0439441_005529 3300042001 Bacteria 1970
207 Ga0439435_0005347 3300042436 Bacteria 2819
208 Ga0439444_0007101 3300042437 Bacteria 1711
209 Ga0451577_0000186 3300042876 Bacteria 131630
210 Ga0451577_0007642 3300042876 Bacteria 10601
211 Ga0451577_0016740 3300042876 Bacteria 6781
212 Ga0451577_0040155 3300042876 Bacteria 4202
213 Ga0466969_0011145 3300044656 Bacteria 4762
214 Ga0466969_0017288 3300044656 Bacteria 3768
215 Ga0466969_0026644 3300044656 Bacteria 2963
216 Ga0466969_0054663 3300044656 Bacteria 1955
217 Ga0466972_0026427 3300044658 Bacteria 2878
218 Ga0466973_0015470 3300044659 Bacteria 7211
219 Ga0466977_0000158 3300044666 Bacteria 16846
220 Ga0466978_0213382 3300044671 Bacteria 1143
221 Ga0453683_0137708 3300044673 Bacteria 1540
222 Ga0466965_0000245 3300044683 Bacteria 17435
223 Ga0466965_0018157 3300044683 Bacteria 3368
224 Ga0466966_0000002 3300044684 Bacteria 370962
225 Ga0466966_0000033 3300044684 Bacteria 101862
226 Ga0466966_0049025 3300044684 Bacteria 2690
227 Ga0466966_0128542 3300044684 Bacteria 1552
228 Ga0466961_0000061 3300044693 Bacteria 64795
229 Ga0466961_0001363 3300044693 Bacteria 15069
230 Ga0466961_0034112 3300044693 Bacteria 3267
231 Ga0466961_0302725 3300044693 Bacteria 976
232 Ga0466963_0003013 3300044694 Bacteria 9526
233 Ga0466963_0067160 3300044694 Bacteria 2406
234 Ga0466964_0002043 3300044706 Bacteria 7098
235 Ga0466964_0030792 3300044706 Bacteria 2125
236 Ga0453684_0000121 3300044712 Bacteria 341067
237 Ga0453684_0026586 3300044712 Bacteria 8346
238 Ga0466971_0038874 3300044719 Bacteria 2135
239 Ga0466971_0298253 3300044719 Bacteria 773
240 Ga0466968_0046064 3300044735 Bacteria 1852
241 Ga0466970_0001731 3300044765 Bacteria 10520
242 Ga0466970_0111582 3300044765 Bacteria 1493
243 Ga0466970_0178515 3300044765 Bacteria 1178
244 Ga0466957_0002815 3300044842 Bacteria 9408
245 Ga0466957_0008605 3300044842 Bacteria 5807
246 Ga0466957_0034095 3300044842 Bacteria 3054
247 Ga0466957_0217358 3300044842 Bacteria 1261
248 Ga0466959_0003607 3300045049 Bacteria 10204
249 Ga0466959_0039385 3300045049 Bacteria 3492
250 Ga0466959_0140168 3300045049 Bacteria 1709
251 Ga0451576_0005812 3300045051 Bacteria 15341
252 Ga0451576_0373609 3300045051 Bacteria 1494
253 Ga0466958_0003344 3300045836 Bacteria 8311
254 Ga0466958_0004230 3300045836 Bacteria 7548
255 Ga0466958_0006705 3300045836 Bacteria 6283
256 Ga0466958_0010621 3300045836 Bacteria 5162
257 Ga0466958_0137250 3300045836 Bacteria 1538
258 Ga0466967_0920450 3300045976 Bacteria 870
259 Ga0495603_0077869 3300046455 Bacteria 1945
260 Ga0495603_0098484 3300046455 Bacteria 1707
261 Ga0495590_0008310 3300046457 Bacteria 3965
262 Ga0495591_002588 3300046458 Bacteria 9931
263 Ga0495629_0222597 3300046459 Bacteria 1301
264 Ga0495653_0056724 3300046463 Bacteria 2984
265 Ga0495580_0000758 3300046472 Bacteria 27688
266 Ga0495580_0001122 3300046472 Bacteria 23573
267 Ga0495580_0143763 3300046472 Bacteria 1653
268 Ga0495580_0461836 3300046472 Bacteria 851
269 Ga0495582_0033474 3300046473 Bacteria 2825
270 Ga0495582_0036064 3300046473 Bacteria 2720
271 Ga0495662_0077267 3300046476 Bacteria 1617
272 Ga0495664_0058951 3300046477 Bacteria 2284
273 Ga0495584_0000990 3300046491 Bacteria 17819
274 Ga0495585_0021023 3300046492 Bacteria 3748
275 Ga0495596_0026911 3300046500 Bacteria 2315
276 Ga0495596_0072614 3300046500 Bacteria 1336
277 Ga0495607_0025653 3300046501 Bacteria 3663
278 Ga0495606_0025424 3300046507 Bacteria 4240
279 Ga0495606_0222100 3300046507 Bacteria 1064
280 Ga0495608_0045574 3300046511 Bacteria 2921
281 Ga0495620_0016698 3300046515 Bacteria 3677
282 Ga0495628_0282080 3300046516 Bacteria 1233
283 Ga0495630_0001574 3300046517 Bacteria 15859
284 Ga0495630_0005881 3300046517 Bacteria 8676
285 Ga0495666_0276025 3300046526 Bacteria 762
286 Ga0495652_0058906 3300046529 Bacteria 3251
287 Ga0495665_0000077 3300046531 Bacteria 42404
288 Ga0495665_0009519 3300046531 Bacteria 5262
289 Ga0495586_0019454 3300046535 Bacteria 3615
290 Ga0495586_0072438 3300046535 Bacteria 1884
291 Ga0495586_0108407 3300046535 Bacteria 1545
292 Ga0495587_0016885 3300046536 Bacteria 4539
293 Ga0495587_0143439 3300046536 Bacteria 1362
294 Ga0495621_0003484 3300046539 Bacteria 4344
295 Ga0495621_0010403 3300046539 Bacteria 2845
296 Ga0495597_0008733 3300046542 Bacteria 5061
297 Ga0495645_0252713 3300046543 Bacteria 1171
298 Ga0495622_0000544 3300046557 Bacteria 22645
299 Ga0495667_0126414 3300046559 Bacteria 1650
300 Ga0495611_0074484 3300046648 Bacteria 1555
301 Ga0495625_0000146 3300046660 Bacteria 108123
302 Ga0495625_0004613 3300046660 Bacteria 12953
303 Ga0495661_0135767 3300046665 Bacteria 1343
304 Ga0495599_0000226 3300046678 Bacteria 35902
305 Ga0495599_0010350 3300046678 Bacteria 5703
306 Ga0495599_0022952 3300046678 Bacteria 3897
307 Ga0495658_0060800 3300046683 Bacteria 2167
308 Ga0495669_0098140 3300046684 Bacteria 1359
309 Ga0495613_0018317 3300046689 Bacteria 5222
310 Ga0495624_0012093 3300046690 Bacteria 5910
311 Ga0495649_0325779 3300046694 Bacteria 779
312 Ga0495600_0043320 3300046809 Bacteria 2935
313 Ga0495581_0113235 3300047315 Bacteria 1577
314 Ga0495674_0027440 3300047319 Bacteria 5204
315 Ga0495674_0187068 3300047319 Bacteria 1723
316 Ga0495674_0442196 3300047319 Bacteria 1045
317 Ga0495676_0128939 3300047321 Bacteria 1829
318 Ga0495683_0000642 3300047323 Bacteria 26000
319 Ga0495683_0060229 3300047323 Bacteria 1882
320 Ga0495687_018714 3300047443 Bacteria 3415
321 Ga0495687_049395 3300047443 Bacteria 1798
322 Ga0495679_019676 3300047446 Bacteria 2365
323 Ga0495679_045361 3300047446 Bacteria 1343
324 Ga0495602_0073146 3300048088 Bacteria 2919
325 Ga0495626_0086085 3300048091 Bacteria 1389
326 Ga0496100_0000078 3300048903 Bacteria 54410
327 Ga0496100_0005911 3300048903 Bacteria 6632
328 Ga0496101_0000205 3300048904 Bacteria 45101
329 Ga0496101_0000694 3300048904 Bacteria 20286
330 Ga0496102_0000165 3300048905 Bacteria 89141
331 Ga0496102_0001233 3300048905 Bacteria 23156
332 Ga0496102_0064503 3300048905 Bacteria 3354
333 Ga0496102_0152712 3300048905 Bacteria 2170
334 Ga0496102_0355612 3300048905 Bacteria 1379
335 Ga0496103_0000668 3300048906 Bacteria 25769
336 Ga0496103_0001056 3300048906 Bacteria 19218
337 Ga0496103_0006236 3300048906 Bacteria 7127
338 Ga0496103_0007741 3300048906 Bacteria 6387
339 Ga0496104_0008622 3300048907 Bacteria 9068
340 Ga0496104_0191190 3300048907 Bacteria 1958
341 Ga0496105_0079305 3300048908 Bacteria 2711
342 Ga0496105_0726330 3300048908 Bacteria 760
343 Ga0496108_0225199 3300048911 Bacteria 1630
344 Ga0496108_0283238 3300048911 Bacteria 1443
345 Ga0496111_0004800 3300048914 Bacteria 8573
346 Ga0496112_0002697 3300048915 Bacteria 14354
347 Ga0496113_0027885 3300048916 Bacteria 4054
348 Ga0496115_0304036 3300048918 Bacteria 1307
349 Ga0496116_0031167 3300048919 Bacteria 3822
350 Ga0496116_0146352 3300048919 Bacteria 1320
351 Ga0496117_0000707 3300048920 Bacteria 52889
352 Ga0496117_0015289 3300048920 Bacteria 6553
353 Ga0496117_0053154 3300048920 Bacteria 2848
354 Ga0496118_0000283 3300048921 Bacteria 89206
355 Ga0496118_0002388 3300048921 Bacteria 25379
356 Ga0496118_0046400 3300048921 Bacteria 3380
357 Ga0496119_0149264 3300048922 Bacteria 1254
358 Ga0496121_0003158 3300048924 Bacteria 23745
359 Ga0496121_0076846 3300048924 Bacteria 2661
360 Ga0496122_0008812 3300048925 Bacteria 10779
361 Ga0496122_0155299 3300048925 Bacteria 1405
362 Ga0496123_0005833 3300048926 Bacteria 12212
363 Ga0496123_0064823 3300048926 Bacteria 2326
364 Ga0496124_0013497 3300048927 Bacteria 7972
365 Ga0496125_0014028 3300048928 Bacteria 7833
366 Ga0496125_0023533 3300048928 Bacteria 5684
367 Ga0496125_0261453 3300048928 Bacteria 1084
368 Ga0496126_0039442 3300048929 Bacteria 4382
369 Ga0496126_0046408 3300048929 Bacteria 3985
370 Ga0501318_038297 3300049534 Bacteria 677
371 Ga0501032_0322739 3300049569 Bacteria 996
372 Ga0501033_0003745 3300049570 Bacteria 12362
373 Ga0501033_0037476 3300049570 Bacteria 3629
374 Ga0501034_0000293 3300049571 Bacteria 88978
375 Ga0501034_0000874 3300049571 Bacteria 44331
376 Ga0501034_0001048 3300049571 Bacteria 39365
377 Ga0501034_0005695 3300049571 Bacteria 13543
378 Ga0501034_0380522 3300049571 Bacteria 1336
379 Ga0501038_0200717 3300049574 Bacteria 1601
380 Ga0501038_0414315 3300049574 Bacteria 1040
381 Ga0501039_0118985 3300049575 Bacteria 2069
382 Ga0501041_0017101 3300049577 Bacteria 4315
383 Ga0501043_0046207 3300049579 Bacteria 3424
384 Ga0501043_0231617 3300049579 Bacteria 1427
385 Ga0501047_0070134 3300049581 Bacteria 3374
386 Ga0501047_0152099 3300049581 Bacteria 2190
387 Ga0501047_0392940 3300049581 Bacteria 1220
388 Ga0501067_0049914 3300049583 Bacteria 2319
389 Ga0501069_0001386 3300049585 Bacteria 11897
390 Ga0501070_0730381 3300049586 Bacteria 781
391 Ga0501071_0052012 3300049587 Bacteria 2953
392 Ga0501072_0013175 3300049588 Bacteria 6331
393 Ga0501074_0249562 3300049590 Bacteria 1262
394 Ga0501076_0000922 3300049592 Bacteria 19182
395 Ga0501077_0041392 3300049593 Bacteria 2933
396 Ga0501079_0024619 3300049741 Bacteria 4619
397 Ga0501080_0103518 3300049742 Bacteria 2640
398 Ga0501081_0073088 3300049743 Bacteria 2392
399 Ga0501083_0053381 3300049744 Bacteria 2714
400 Ga0501035_0070688 3300049822 Bacteria 3091
401 Ga0501044_0024961 3300049823 Bacteria 6338
402 Ga0501045_0188791 3300049824 Bacteria 1536
403 nmdc:mga0k408_51309_c1 3300050493 Bacteria 2390
404 nmdc:mga09592_321782_c1 3300050508 Bacteria 1340
405 nmdc:mga09592_35337_c1 3300050508 Bacteria 4184
406 nmdc:mga09592_606152_c1 3300050508 Bacteria 938
407 nmdc:mga0qj67_107148_c1 3300050509 Bacteria 2254
408 nmdc:mga0qj67_306355_c1 3300050509 Bacteria 1287
409 nmdc:mga06r32_253526_c1 3300050510 Bacteria 1747
410 nmdc:mga06r32_510372_c1 3300050510 Bacteria 1179
411 Ga0500643_000017 3300053087 Bacteria 305781
412 Ga0500641_0061268 3300053096 Bacteria 1567
413 Ga0500658_0000012 3300053134 Bacteria 160010
414 Ga0500636_0210211 3300053177 Bacteria 1022
415 Ga0501084_0561330 3300054114 Bacteria 965
416 Ga0501082_0054698 3300060353 Bacteria 3440
417 Ga0466962_0012688 3300061719 Bacteria 4053
418 Ga0466962_0017508 3300061719 Bacteria 3449
419 Ga0466962_0194663 3300061719 Bacteria 989
420 Ga0530510_0000977 3300061734 Bacteria 18901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0298253 Ga0466971_0298253_108_761 217
2 3300046517 Ga0495630_0005881 Ga0495630_0005881_62_715 217
3 3300048908 Ga0496105_0726330 Ga0496105_0726330_36_689 217
4 3300049534 Ga0501318_038297 Ga0501318_038297_13_666 217
5 3300049586 Ga0501070_0730381 Ga0501070_0730381_13_687 224
6 iso_pu_bacteria 2501025502 2501081175 231
7 3300021388 Ga0213875_10019792 Ga0213875_100197924 232
8 3300037853 Ga0436364_0210663 Ga0436364_0210663_3630_4379 232
9 3300046455 Ga0495603_0077869 Ga0495603_0077869_36_743 235
10 3300047446 Ga0495679_045361 Ga0495679_045361_326_1033 235
11 3300015261 Ga0182006_1044595 Ga0182006_10445951 236
12 iso_pu_bacteria 2857357740 2857365627 238
13 iso_pu_bacteria 2923556063 2923563034 238
14 3300046526 Ga0495666_0276025 Ga0495666_0276025_29_751 240
15 3300046694 Ga0495649_0325779 Ga0495649_0325779_11_733 240
16 3300047315 Ga0495581_0113235 Ga0495581_0113235_829_1551 240
17 iso_pu_bacteria 2898795034 2898798160 241
18 iso_pu_bacteria 2643221582 2643919749 244
19 iso_pu_bacteria 2713897090 2715501373 244
20 iso_pu_bacteria 2834578030 2834580546 244
21 iso_pu_bacteria 2840878972 2840880694 244
22 iso_pu_bacteria 2842775625 2842779021 244
23 iso_pu_bacteria 2855020534 2855021453 244
24 iso_pu_bacteria 2889914905 2889916899 244
25 iso_pu_bacteria 2899259804 2899262031 244
26 iso_pu_bacteria 2899275550 2899277375 244
27 iso_pu_bacteria 2929138655 2929141677 244
28 iso_pu_bacteria 3000017691 3000019244 244
29 iso_pu_bacteria 3000017691 3000019367 244
30 iso_pu_bacteria 8057132660 8057134437 244
31 iso_pu_bacteria 8057132660 8057134476 244
32 3300045049 Ga0466959_0140168 Ga0466959_0140168_961_1698 245
33 iso_pu_bacteria 2501025502 2501083019 245
34 iso_pu_bacteria 2510065045 2510247052 245
35 iso_pu_bacteria 2510917013 2511085950 245
36 iso_pu_bacteria 2510917013 2511091004 245
37 iso_pu_bacteria 2510917015 2511108044 245
38 iso_pu_bacteria 2511231027 2511388133 245
39 iso_pu_bacteria 2512047030 2512352016 245
40 iso_pu_bacteria 2512047030 2512352449 245
41 iso_pu_bacteria 2512047030 2512352616 245
42 iso_pu_bacteria 2513237082 2513554200 245
43 iso_pu_bacteria 2515154122 2515681176 245
44 iso_pu_bacteria 2515154122 2515685909 245
45 iso_pu_bacteria 2515154189 2516024324 245
46 iso_pu_bacteria 2526164713 2527077549 245
47 iso_pu_bacteria 2585428057 2587727658 245
48 iso_pu_bacteria 2585428058 2587733034 245
49 iso_pu_bacteria 2588253510 2588291331 245
50 iso_pu_bacteria 2600255067 2600810876 245
51 iso_pu_bacteria 2718217991 2719637927 245
52 iso_pu_bacteria 2734482258 2735816734 245
53 iso_pu_bacteria 2738541296 2738819046 245
54 iso_pu_bacteria 2738541298 2738830798 245
55 iso_pu_bacteria 2738541306 2738872324 245
56 iso_pu_bacteria 2738543002 2739183955 245
57 iso_pu_bacteria 2738543008 2739218925 245
58 iso_pu_bacteria 2744054900 2746087124 245
59 iso_pu_bacteria 2744054900 2746088228 245
60 iso_pu_bacteria 2744054900 2746089534 245
61 iso_pu_bacteria 2744054901 2746096878 245
62 iso_pu_bacteria 2744054901 2746098393 245
63 iso_pu_bacteria 2751185846 2753568241 245
64 iso_pu_bacteria 2775507266 2778179875 245
65 iso_pu_bacteria 2775507266 2778180181 245
66 iso_pu_bacteria 2791355137 2792837842 245
67 iso_pu_bacteria 2791355137 2792839220 245
68 iso_pu_bacteria 2854681122 2854685294 245
69 iso_pu_bacteria 2857357740 2857361058 245
70 iso_pu_bacteria 2857357740 2857361333 245
71 iso_pu_bacteria 2883087390 2883087860 245
72 iso_pu_bacteria 2885270888 2885271636 245
73 iso_pu_bacteria 2894772417 2894777555 245
74 iso_pu_bacteria 2900634093 2900641510 245
75 iso_pu_bacteria 2902682994 2902685397 245
76 iso_pu_bacteria 2902682994 2902686378 245
77 iso_pu_bacteria 2902682994 2902687379 245
78 iso_pu_bacteria 2928027323 2928028185 245
79 iso_pu_bacteria 2945934425 2945937728 245
80 iso_pu_bacteria 2984555340 2984558525 245
81 iso_pu_bacteria 2984564862 2984567068 245
82 iso_pu_bacteria 2990703756 2990705554 245
83 iso_pu_bacteria 2993356040 2993358157 245
84 iso_pu_bacteria 2995392953 2995393690 245
85 iso_pu_bacteria 3000405567 3000406589 245
86 iso_pu_bacteria 8001845381 8001846995 245
87 iso_pu_bacteria 8019555841 8019563522 245
88 iso_pu_bacteria 8019565922 8019573597 245
89 iso_pu_bacteria 8055266321 8055271527 245
90 iso_pu_bacteria 8055266321 8055272850 245
91 3300005288 Ga0065714_10068786 Ga0065714_100687864 248
92 3300005327 Ga0070658_10009845 Ga0070658_1000984510 248
93 3300005327 Ga0070658_10459200 Ga0070658_104592002 248
94 3300005336 Ga0070680_100025975 Ga0070680_1000259753 248
95 3300005530 Ga0070679_100022584 Ga0070679_1000225846 248
96 3300005539 Ga0068853_100603228 Ga0068853_1006032281 248
97 3300005548 Ga0070665_100018494 Ga0070665_1000184943 248
98 3300005548 Ga0070665_100587718 Ga0070665_1005877181 248
99 3300005563 Ga0068855_100277965 Ga0068855_1002779652 248
100 3300005577 Ga0068857_100293752 Ga0068857_1002937522 248
101 3300005614 Ga0068856_100228370 Ga0068856_1002283701 248
102 3300005844 Ga0068862_100081412 Ga0068862_1000814123 248
103 3300006881 Ga0068865_100101216 Ga0068865_1001012162 248
104 3300009093 Ga0105240_10000528 Ga0105240_1000052843 248
105 3300009093 Ga0105240_10009265 Ga0105240_100092652 248
106 3300009093 Ga0105240_10167754 Ga0105240_101677542 248
107 3300009093 Ga0105240_10205516 Ga0105240_102055162 248
108 3300009093 Ga0105240_10213170 Ga0105240_102131703 248
109 3300009174 Ga0105241_10154617 Ga0105241_101546173 248
110 3300009174 Ga0105241_10196389 Ga0105241_101963891 248
111 3300009174 Ga0105241_10233552 Ga0105241_102335522 248
112 3300009545 Ga0105237_10056325 Ga0105237_100563253 248
113 3300009551 Ga0105238_10162234 Ga0105238_101622343 248
114 3300009551 Ga0105238_10250654 Ga0105238_102506543 248
115 3300010375 Ga0105239_10099382 Ga0105239_100993823 248
116 3300010375 Ga0105239_10102953 Ga0105239_101029533 248
117 3300010375 Ga0105239_10106923 Ga0105239_101069233 248
118 3300010375 Ga0105239_10191626 Ga0105239_101916262 248
119 3300010375 Ga0105239_10297698 Ga0105239_102976982 248
120 3300025909 Ga0207705_10008134 Ga0207705_1000813410 248
121 3300025911 Ga0207654_10025279 Ga0207654_100252792 248
122 3300025911 Ga0207654_10079946 Ga0207654_100799463 248
123 3300025913 Ga0207695_10001649 Ga0207695_1000164940 248
124 3300025913 Ga0207695_10057015 Ga0207695_100570152 248
125 3300025913 Ga0207695_10092956 Ga0207695_100929563 248
126 3300025913 Ga0207695_10098468 Ga0207695_100984682 248
127 3300025913 Ga0207695_10243967 Ga0207695_102439672 248
128 3300025913 Ga0207695_10426145 Ga0207695_104261452 248
129 3300025914 Ga0207671_10162637 Ga0207671_101626371 248
130 3300025917 Ga0207660_10047341 Ga0207660_100473412 248
131 3300025919 Ga0207657_10237941 Ga0207657_102379412 248
132 3300025921 Ga0207652_10008279 Ga0207652_100082795 248
133 3300025924 Ga0207694_10075189 Ga0207694_100751892 248
134 3300025949 Ga0207667_10183027 Ga0207667_101830273 248
135 3300025949 Ga0207667_10305436 Ga0207667_103054362 248
136 3300026078 Ga0207702_10453034 Ga0207702_104530342 248
137 3300026116 Ga0207674_10063707 Ga0207674_100637073 248
138 3300028379 Ga0268266_10055699 Ga0268266_100556993 248
139 3300028380 Ga0268265_10041130 Ga0268265_100411303 248
140 3300031235 Ga0265330_10002470 Ga0265330_100024707 248
141 3300031247 Ga0265340_10000353 Ga0265340_1000035320 248
142 3300031247 Ga0265340_10001830 Ga0265340_100018309 248
143 3300031247 Ga0265340_10178668 Ga0265340_101786681 248
144 3300031249 Ga0265339_10015108 Ga0265339_100151081 248
145 3300031249 Ga0265339_10130288 Ga0265339_101302882 248
146 3300031250 Ga0265331_10022694 Ga0265331_100226942 248
147 3300031250 Ga0265331_10039047 Ga0265331_100390473 248
148 3300031344 Ga0265316_10032425 Ga0265316_100324253 248
149 3300031344 Ga0265316_10180089 Ga0265316_101800892 248
150 3300031595 Ga0265313_10005546 Ga0265313_100055465 248
151 3300031711 Ga0265314_10040683 Ga0265314_100406831 248
152 3300031712 Ga0265342_10014194 Ga0265342_100141945 248
153 3300032168 Ga0316593_10046868 Ga0316593_100468681 248
154 3300035086 Ga0373934_0184746 Ga0373934_0184746_93_839 248
155 3300037418 Ga0395900_0205411 Ga0395900_0205411_549_1295 248
156 3300037418 Ga0395900_0903915 Ga0395900_0903915_49_795 248
157 3300037466 Ga0395898_0545405 Ga0395898_0545405_183_929 248
158 3300038443 Ga0395901_0032893 Ga0395901_0032893_3900_4646 248
159 3300039062 Ga0400483_038604 Ga0400483_038604_911_1669 248
160 3300039062 Ga0400483_074493 Ga0400483_074493_425_1183 248
161 3300039062 Ga0400483_213659 Ga0400483_213659_661_1419 248
162 3300039062 Ga0400483_264211 Ga0400483_264211_2420_3256 248
163 3300046491 Ga0495584_0000990 Ga0495584_0000990_4421_5179 248
164 3300046536 Ga0495587_0143439 Ga0495587_0143439_570_1316 248
165 3300046660 Ga0495625_0000146 Ga0495625_0000146_81008_81766 248
166 3300046660 Ga0495625_0004613 Ga0495625_0004613_8098_8856 248
167 3300047319 Ga0495674_0187068 Ga0495674_0187068_85_831 248
168 3300048088 Ga0495602_0073146 Ga0495602_0073146_368_1114 248
169 3300049570 Ga0501033_0003745 Ga0501033_0003745_5204_5950 248
170 3300049574 Ga0501038_0414315 Ga0501038_0414315_279_1025 248
171 3300049579 Ga0501043_0231617 Ga0501043_0231617_327_1073 248
172 3300049581 Ga0501047_0070134 Ga0501047_0070134_1248_1994 248
173 3300049581 Ga0501047_0152099 Ga0501047_0152099_339_1085 248
174 3300049583 Ga0501067_0049914 Ga0501067_0049914_307_1053 248
175 3300049822 Ga0501035_0070688 Ga0501035_0070688_1454_2200 248
176 3300049823 Ga0501044_0024961 Ga0501044_0024961_3295_4041 248
177 3300053087 Ga0500643_000017 Ga0500643_000017_136273_137019 248
178 3300053096 Ga0500641_0061268 Ga0500641_0061268_308_1054 248
179 3300053134 Ga0500658_0000012 Ga0500658_0000012_94415_95173 248
180 3300053177 Ga0500636_0210211 Ga0500636_0210211_257_1006 248
181 iso_pu_bacteria 2995392953 2995396404 248
182 3300001979 JGI24740J21852_10000321 JGI24740J21852_100003219 249
183 3300001989 JGI24739J22299_10003749 JGI24739J22299_100037493 249
184 3300002067 JGI24735J21928_10000185 JGI24735J21928_1000018517 249
185 3300002067 JGI24735J21928_10000536 JGI24735J21928_1000053614 249
186 3300002075 JGI24738J21930_10008608 JGI24738J21930_100086083 249
187 3300003203 JGI25406J46586_10000707 JGI25406J46586_1000070710 249
188 3300003575 Ga0007409J51694_1022478 Ga0007409J51694_10224781 249
189 3300003575 Ga0007409J51694_1033728 Ga0007409J51694_10337281 249
190 3300003759 Ga0055525_1001632 Ga0055525_10016322 249
191 3300003792 Ga0055540_1013687 Ga0055540_10136872 249
192 3300005327 Ga0070658_10018549 Ga0070658_100185492 249
193 3300005327 Ga0070658_10309121 Ga0070658_103091212 249
194 3300005330 Ga0070690_100196601 Ga0070690_1001966011 249
195 3300005354 Ga0070675_100142125 Ga0070675_1001421252 249
196 3300005364 Ga0070673_100348371 Ga0070673_1003483711 249
197 3300005366 Ga0070659_100139129 Ga0070659_1001391292 249
198 3300005440 Ga0070705_100021147 Ga0070705_1000211473 249
199 3300005455 Ga0070663_100057164 Ga0070663_1000571642 249
200 3300005455 Ga0070663_100119645 Ga0070663_1001196452 249
201 3300005549 Ga0070704_100055363 Ga0070704_1000553633 249
202 3300005563 Ga0068855_100004807 Ga0068855_1000048074 249
203 3300005563 Ga0068855_100458709 Ga0068855_1004587092 249
204 3300005563 Ga0068855_100510115 Ga0068855_1005101152 249
205 3300005614 Ga0068856_100259230 Ga0068856_1002592303 249
206 3300005614 Ga0068856_100942907 Ga0068856_1009429072 249
207 3300005616 Ga0068852_100388627 Ga0068852_1003886272 249
208 3300005617 Ga0068859_100023328 Ga0068859_1000233285 249
209 3300005844 Ga0068862_100025030 Ga0068862_1000250303 249
210 3300005985 Ga0081539_10000054 Ga0081539_10000054202 249
211 3300006844 Ga0075428_100173706 Ga0075428_1001737062 249
212 3300006846 Ga0075430_100059073 Ga0075430_1000590733 249
213 3300006880 Ga0075429_100148146 Ga0075429_1001481463 249
214 3300006931 Ga0097620_100023328 Ga0097620_1000233285 249
215 3300009011 Ga0105251_10000789 Ga0105251_1000078915 249
216 3300009011 Ga0105251_10021755 Ga0105251_100217554 249
217 3300009093 Ga0105240_10238803 Ga0105240_102388032 249
218 3300009174 Ga0105241_10073576 Ga0105241_100735762 249
219 3300009545 Ga0105237_10032573 Ga0105237_100325732 249
220 3300009551 Ga0105238_10126502 Ga0105238_101265023 249
221 3300013100 Ga0157373_10249457 Ga0157373_102494572 249
222 3300013102 Ga0157371_10008332 Ga0157371_100083324 249
223 3300013104 Ga0157370_10023816 Ga0157370_100238165 249
224 3300013104 Ga0157370_10028282 Ga0157370_100282823 249
225 3300013104 Ga0157370_10075991 Ga0157370_100759911 249
226 3300013104 Ga0157370_10126782 Ga0157370_101267823 249
227 3300013105 Ga0157369_10000126 Ga0157369_1000012628 249
228 3300013105 Ga0157369_10007456 Ga0157369_100074562 249
229 3300013105 Ga0157369_10167853 Ga0157369_101678534 249
230 3300013307 Ga0157372_10115275 Ga0157372_101152752 249
231 3300014326 Ga0157380_10137776 Ga0157380_101377762 249
232 3300014497 Ga0182008_10050262 Ga0182008_100502621 249
233 3300015690 Ga0183363_1005 Ga0183363_100524 249
234 3300016635 Ga0183361_10002 Ga0183361_10002633 249
235 3300016635 Ga0183361_10039 Ga0183361_1003911 249
236 3300017792 Ga0163161_10049491 Ga0163161_100494913 249
237 3300017792 Ga0163161_10226702 Ga0163161_102267022 249
238 3300020069 Ga0197907_10533598 Ga0197907_105335981 249
239 3300020075 Ga0206349_1389287 Ga0206349_13892872 249
240 3300020080 Ga0206350_10498766 Ga0206350_104987661 249
241 3300020081 Ga0206354_11162103 Ga0206354_111621033 249
242 3300021361 Ga0213872_10043710 Ga0213872_100437102 249
243 3300022467 Ga0224712_10016383 Ga0224712_100163832 249
244 3300025261 Ga0209233_1029195 Ga0209233_10291952 249
245 3300025735 Ga0207713_1001874 Ga0207713_10018749 249
246 3300025909 Ga0207705_10000909 Ga0207705_100009094 249
247 3300025909 Ga0207705_10409579 Ga0207705_104095791 249
248 3300025911 Ga0207654_10040815 Ga0207654_100408152 249
249 3300025913 Ga0207695_10096687 Ga0207695_100966873 249
250 3300025914 Ga0207671_10187577 Ga0207671_101875772 249
251 3300025920 Ga0207649_10179012 Ga0207649_101790122 249
252 3300025926 Ga0207659_10091733 Ga0207659_100917332 249
253 3300025932 Ga0207690_10058112 Ga0207690_100581122 249
254 3300025935 Ga0207709_10224066 Ga0207709_102240662 249
255 3300025936 Ga0207670_10348293 Ga0207670_103482932 249
256 3300025937 Ga0207669_10046192 Ga0207669_100461922 249
257 3300025941 Ga0207711_10191826 Ga0207711_101918262 249
258 3300025949 Ga0207667_10005385 Ga0207667_100053854 249
259 3300025949 Ga0207667_10270906 Ga0207667_102709062 249
260 3300025949 Ga0207667_10727265 Ga0207667_107272652 249
261 3300025960 Ga0207651_10260339 Ga0207651_102603391 249
262 3300026041 Ga0207639_10032334 Ga0207639_100323343 249
263 3300026067 Ga0207678_10077300 Ga0207678_100773003 249
264 3300026067 Ga0207678_10217882 Ga0207678_102178822 249
265 3300026067 Ga0207678_10234215 Ga0207678_102342152 249
266 3300026089 Ga0207648_10091050 Ga0207648_100910502 249
267 3300027665 Ga0209983_1016437 Ga0209983_10164372 249
268 3300027695 Ga0209966_1010685 Ga0209966_10106852 249
269 3300027695 Ga0209966_1014767 Ga0209966_10147672 249
270 3300027876 Ga0209974_10039044 Ga0209974_100390442 249
271 3300028380 Ga0268265_10622831 Ga0268265_106228311 249
272 3300028653 Ga0265323_10004666 Ga0265323_100046665 249
273 3300029957 Ga0265324_10008485 Ga0265324_100084854 249
274 3300029957 Ga0265324_10012600 Ga0265324_100126002 249
275 3300030083 Ga0237817_11579 Ga0237817_115791 249
276 3300031344 Ga0265316_10022994 Ga0265316_100229945 249
277 3300031344 Ga0265316_10106641 Ga0265316_101066412 249
278 3300031344 Ga0265316_10117251 Ga0265316_101172512 249
279 3300031456 Ga0307513_10116644 Ga0307513_101166443 249
280 3300031507 Ga0307509_10103946 Ga0307509_101039462 249
281 3300031548 Ga0307408_100288238 Ga0307408_1002882381 249
282 3300031711 Ga0265314_10077461 Ga0265314_100774612 249
283 3300031711 Ga0265314_10102259 Ga0265314_101022592 249
284 3300031727 Ga0316576_10008183 Ga0316576_100081834 249
285 3300031731 Ga0307405_10344407 Ga0307405_103444071 249
286 3300032002 Ga0307416_100129991 Ga0307416_1001299912 249
287 3300035691 Ga0373931_0040154 Ga0373931_0040154_385_1134 249
288 3300037068 Ga0373925_0017082 Ga0373925_0017082_883_1632 249
289 3300037068 Ga0373925_0515301 Ga0373925_0515301_67_816 249
290 3300037312 Ga0395899_0000005 Ga0395899_0000005_56000_56749 249
291 3300037312 Ga0395899_0000041 Ga0395899_0000041_135938_136687 249
292 3300037312 Ga0395899_0005775 Ga0395899_0005775_5569_6318 249
293 3300037418 Ga0395900_0000077 Ga0395900_0000077_151070_151819 249
294 3300037418 Ga0395900_0000090 Ga0395900_0000090_112465_113214 249
295 3300037418 Ga0395900_0000097 Ga0395900_0000097_41921_42670 249
296 3300037418 Ga0395900_0058918 Ga0395900_0058918_2234_2983 249
297 3300037466 Ga0395898_0000003 Ga0395898_0000003_56000_56749 249
298 3300037466 Ga0395898_0000220 Ga0395898_0000220_9732_10481 249
299 3300037466 Ga0395898_0142502 Ga0395898_0142502_116_865 249
300 3300037471 Ga0395905_0053858 Ga0395905_0053858_787_1548 249
301 3300037471 Ga0395905_0466454 Ga0395905_0466454_121_1083 249
302 3300037853 Ga0436364_0107567 Ga0436364_0107567_111_860 249
303 3300037853 Ga0436364_0836559 Ga0436364_0836559_2798_3547 249
304 3300038443 Ga0395901_0000096 Ga0395901_0000096_51639_52388 249
305 3300038443 Ga0395901_0001807 Ga0395901_0001807_5554_6303 249
306 3300039062 Ga0400483_071358 Ga0400483_071358_110_946 249
307 3300039062 Ga0400483_167249 Ga0400483_167249_1039_1800 249
308 3300039447 Ga0436361_0178339 Ga0436361_0178339_306_1055 249
309 3300039450 Ga0436363_0732576 Ga0436363_0732576_484_1236 249
310 3300041408 Ga0439453_0024531 Ga0439453_0024531_203_952 249
311 3300041498 Ga0451841_0799575 Ga0451841_0799575_421_1170 249
312 3300042001 Ga0439441_005529 Ga0439441_005529_827_1576 249
313 3300042436 Ga0439435_0005347 Ga0439435_0005347_1613_2362 249
314 3300042437 Ga0439444_0007101 Ga0439444_0007101_446_1195 249
315 3300042876 Ga0451577_0000186 Ga0451577_0000186_13800_14549 249
316 3300042876 Ga0451577_0007642 Ga0451577_0007642_993_1742 249
317 3300042876 Ga0451577_0016740 Ga0451577_0016740_3291_4058 249
318 3300042876 Ga0451577_0040155 Ga0451577_0040155_1295_2050 249
319 3300044656 Ga0466969_0011145 Ga0466969_0011145_3498_4247 249
320 3300044656 Ga0466969_0017288 Ga0466969_0017288_108_857 249
321 3300044656 Ga0466969_0026644 Ga0466969_0026644_1511_2260 249
322 3300044656 Ga0466969_0054663 Ga0466969_0054663_614_1363 249
323 3300044658 Ga0466972_0026427 Ga0466972_0026427_379_1128 249
324 3300044659 Ga0466973_0015470 Ga0466973_0015470_1476_2225 249
325 3300044666 Ga0466977_0000158 Ga0466977_0000158_14248_14997 249
326 3300044671 Ga0466978_0213382 Ga0466978_0213382_277_1026 249
327 3300044673 Ga0453683_0137708 Ga0453683_0137708_726_1487 249
328 3300044683 Ga0466965_0000245 Ga0466965_0000245_13880_14629 249
329 3300044683 Ga0466965_0018157 Ga0466965_0018157_2466_3215 249
330 3300044684 Ga0466966_0000002 Ga0466966_0000002_343939_344688 249
331 3300044684 Ga0466966_0000033 Ga0466966_0000033_53370_54119 249
332 3300044684 Ga0466966_0049025 Ga0466966_0049025_719_1468 249
333 3300044684 Ga0466966_0128542 Ga0466966_0128542_675_1424 249
334 3300044693 Ga0466961_0000061 Ga0466961_0000061_14371_15120 249
335 3300044693 Ga0466961_0001363 Ga0466961_0001363_12030_12779 249
336 3300044693 Ga0466961_0034112 Ga0466961_0034112_698_1462 249
337 3300044693 Ga0466961_0302725 Ga0466961_0302725_42_860 249
338 3300044694 Ga0466963_0003013 Ga0466963_0003013_2289_3053 249
339 3300044694 Ga0466963_0067160 Ga0466963_0067160_1406_2155 249
340 3300044706 Ga0466964_0002043 Ga0466964_0002043_1426_2175 249
341 3300044706 Ga0466964_0030792 Ga0466964_0030792_14_778 249
342 3300044712 Ga0453684_0000121 Ga0453684_0000121_241972_242721 249
343 3300044712 Ga0453684_0026586 Ga0453684_0026586_6708_7466 249
344 3300044719 Ga0466971_0038874 Ga0466971_0038874_495_1244 249
345 3300044735 Ga0466968_0046064 Ga0466968_0046064_441_1205 249
346 3300044765 Ga0466970_0001731 Ga0466970_0001731_2782_3546 249
347 3300044765 Ga0466970_0111582 Ga0466970_0111582_604_1353 249
348 3300044765 Ga0466970_0178515 Ga0466970_0178515_116_877 249
349 3300044842 Ga0466957_0002815 Ga0466957_0002815_5386_6135 249
350 3300044842 Ga0466957_0008605 Ga0466957_0008605_4707_5456 249
351 3300044842 Ga0466957_0034095 Ga0466957_0034095_355_1104 249
352 3300044842 Ga0466957_0217358 Ga0466957_0217358_404_1201 249
353 3300045049 Ga0466959_0003607 Ga0466959_0003607_8516_9265 249
354 3300045049 Ga0466959_0039385 Ga0466959_0039385_33_782 249
355 3300045051 Ga0451576_0005812 Ga0451576_0005812_12474_13223 249
356 3300045051 Ga0451576_0373609 Ga0451576_0373609_227_988 249
357 3300045836 Ga0466958_0003344 Ga0466958_0003344_6531_7280 249
358 3300045836 Ga0466958_0004230 Ga0466958_0004230_4065_4814 249
359 3300045836 Ga0466958_0006705 Ga0466958_0006705_4431_5180 249
360 3300045836 Ga0466958_0010621 Ga0466958_0010621_4126_4875 249
361 3300045836 Ga0466958_0137250 Ga0466958_0137250_735_1484 249
362 3300045976 Ga0466967_0920450 Ga0466967_0920450_48_797 249
363 3300046455 Ga0495603_0098484 Ga0495603_0098484_38_787 249
364 3300046457 Ga0495590_0008310 Ga0495590_0008310_699_1448 249
365 3300046458 Ga0495591_002588 Ga0495591_002588_5854_6636 249
366 3300046459 Ga0495629_0222597 Ga0495629_0222597_282_1031 249
367 3300046463 Ga0495653_0056724 Ga0495653_0056724_1770_2519 249
368 3300046472 Ga0495580_0000758 Ga0495580_0000758_8825_9790 249
369 3300046472 Ga0495580_0001122 Ga0495580_0001122_13730_14545 249
370 3300046472 Ga0495580_0143763 Ga0495580_0143763_570_1319 249
371 3300046472 Ga0495580_0461836 Ga0495580_0461836_15_764 249
372 3300046473 Ga0495582_0033474 Ga0495582_0033474_1740_2489 249
373 3300046473 Ga0495582_0036064 Ga0495582_0036064_898_1647 249
374 3300046476 Ga0495662_0077267 Ga0495662_0077267_815_1564 249
375 3300046477 Ga0495664_0058951 Ga0495664_0058951_554_1309 249
376 3300046492 Ga0495585_0021023 Ga0495585_0021023_1713_2462 249
377 3300046500 Ga0495596_0026911 Ga0495596_0026911_68_817 249
378 3300046500 Ga0495596_0072614 Ga0495596_0072614_240_989 249
379 3300046501 Ga0495607_0025653 Ga0495607_0025653_1389_2207 249
380 3300046507 Ga0495606_0025424 Ga0495606_0025424_431_1180 249
381 3300046507 Ga0495606_0222100 Ga0495606_0222100_246_995 249
382 3300046511 Ga0495608_0045574 Ga0495608_0045574_246_995 249
383 3300046515 Ga0495620_0016698 Ga0495620_0016698_1335_2084 249
384 3300046516 Ga0495628_0282080 Ga0495628_0282080_410_1159 249
385 3300046517 Ga0495630_0001574 Ga0495630_0001574_54_836 249
386 3300046529 Ga0495652_0058906 Ga0495652_0058906_511_1260 249
387 3300046531 Ga0495665_0000077 Ga0495665_0000077_18995_19744 249
388 3300046531 Ga0495665_0009519 Ga0495665_0009519_4246_5028 249
389 3300046535 Ga0495586_0019454 Ga0495586_0019454_1491_2240 249
390 3300046535 Ga0495586_0072438 Ga0495586_0072438_842_1624 249
391 3300046535 Ga0495586_0108407 Ga0495586_0108407_72_821 249
392 3300046536 Ga0495587_0016885 Ga0495587_0016885_3262_4011 249
393 3300046539 Ga0495621_0003484 Ga0495621_0003484_1719_2468 249
394 3300046539 Ga0495621_0010403 Ga0495621_0010403_1751_2500 249
395 3300046542 Ga0495597_0008733 Ga0495597_0008733_3419_4168 249
396 3300046543 Ga0495645_0252713 Ga0495645_0252713_132_881 249
397 3300046557 Ga0495622_0000544 Ga0495622_0000544_21611_22360 249
398 3300046559 Ga0495667_0126414 Ga0495667_0126414_73_822 249
399 3300046648 Ga0495611_0074484 Ga0495611_0074484_640_1422 249
400 3300046665 Ga0495661_0135767 Ga0495661_0135767_151_900 249
401 3300046678 Ga0495599_0000226 Ga0495599_0000226_17883_18632 249
402 3300046678 Ga0495599_0010350 Ga0495599_0010350_2512_3261 249
403 3300046678 Ga0495599_0022952 Ga0495599_0022952_196_975 249
404 3300046683 Ga0495658_0060800 Ga0495658_0060800_549_1298 249
405 3300046684 Ga0495669_0098140 Ga0495669_0098140_96_845 249
406 3300046689 Ga0495613_0018317 Ga0495613_0018317_3186_3935 249
407 3300046690 Ga0495624_0012093 Ga0495624_0012093_265_1014 249
408 3300046809 Ga0495600_0043320 Ga0495600_0043320_1903_2652 249
409 3300047319 Ga0495674_0027440 Ga0495674_0027440_4175_4924 249
410 3300047319 Ga0495674_0442196 Ga0495674_0442196_216_965 249
411 3300047321 Ga0495676_0128939 Ga0495676_0128939_478_1227 249
412 3300047323 Ga0495683_0000642 Ga0495683_0000642_22633_23382 249
413 3300047323 Ga0495683_0060229 Ga0495683_0060229_376_1125 249
414 3300047443 Ga0495687_018714 Ga0495687_018714_1134_1883 249
415 3300047443 Ga0495687_049395 Ga0495687_049395_327_1076 249
416 3300047446 Ga0495679_019676 Ga0495679_019676_1366_2115 249
417 3300048091 Ga0495626_0086085 Ga0495626_0086085_26_775 249
418 3300048903 Ga0496100_0000078 Ga0496100_0000078_38393_39142 249
419 3300048903 Ga0496100_0005911 Ga0496100_0005911_1484_2233 249
420 3300048904 Ga0496101_0000205 Ga0496101_0000205_15355_16104 249
421 3300048904 Ga0496101_0000694 Ga0496101_0000694_4939_5688 249
422 3300048905 Ga0496102_0000165 Ga0496102_0000165_38311_39060 249
423 3300048905 Ga0496102_0001233 Ga0496102_0001233_20243_20992 249
424 3300048905 Ga0496102_0064503 Ga0496102_0064503_1547_2296 249
425 3300048905 Ga0496102_0152712 Ga0496102_0152712_1363_2112 249
426 3300048905 Ga0496102_0355612 Ga0496102_0355612_160_909 249
427 3300048906 Ga0496103_0000668 Ga0496103_0000668_19673_20422 249
428 3300048906 Ga0496103_0001056 Ga0496103_0001056_13075_13824 249
429 3300048906 Ga0496103_0006236 Ga0496103_0006236_5514_6317 249
430 3300048906 Ga0496103_0007741 Ga0496103_0007741_845_1594 249
431 3300048907 Ga0496104_0008622 Ga0496104_0008622_3372_4121 249
432 3300048907 Ga0496104_0191190 Ga0496104_0191190_1166_1915 249
433 3300048908 Ga0496105_0079305 Ga0496105_0079305_1444_2199 249
434 3300048911 Ga0496108_0225199 Ga0496108_0225199_645_1394 249
435 3300048911 Ga0496108_0283238 Ga0496108_0283238_239_988 249
436 3300048914 Ga0496111_0004800 Ga0496111_0004800_4193_4942 249
437 3300048915 Ga0496112_0002697 Ga0496112_0002697_12740_13489 249
438 3300048916 Ga0496113_0027885 Ga0496113_0027885_1367_2116 249
439 3300048918 Ga0496115_0304036 Ga0496115_0304036_519_1268 249
440 3300048919 Ga0496116_0031167 Ga0496116_0031167_1797_2546 249
441 3300048919 Ga0496116_0146352 Ga0496116_0146352_525_1274 249
442 3300048920 Ga0496117_0000707 Ga0496117_0000707_38298_39047 249
443 3300048920 Ga0496117_0015289 Ga0496117_0015289_1260_2063 249
444 3300048920 Ga0496117_0053154 Ga0496117_0053154_2087_2836 249
445 3300048921 Ga0496118_0000283 Ga0496118_0000283_50160_50909 249
446 3300048921 Ga0496118_0002388 Ga0496118_0002388_14648_15451 249
447 3300048921 Ga0496118_0046400 Ga0496118_0046400_1682_2431 249
448 3300048922 Ga0496119_0149264 Ga0496119_0149264_406_1155 249
449 3300048924 Ga0496121_0003158 Ga0496121_0003158_13888_14637 249
450 3300048924 Ga0496121_0076846 Ga0496121_0076846_1722_2471 249
451 3300048925 Ga0496122_0008812 Ga0496122_0008812_485_1246 249
452 3300048925 Ga0496122_0155299 Ga0496122_0155299_109_858 249
453 3300048926 Ga0496123_0005833 Ga0496123_0005833_50_799 249
454 3300048926 Ga0496123_0064823 Ga0496123_0064823_617_1378 249
455 3300048927 Ga0496124_0013497 Ga0496124_0013497_3428_4177 249
456 3300048928 Ga0496125_0014028 Ga0496125_0014028_649_1398 249
457 3300048928 Ga0496125_0023533 Ga0496125_0023533_3428_4177 249
458 3300048928 Ga0496125_0261453 Ga0496125_0261453_182_943 249
459 3300048929 Ga0496126_0039442 Ga0496126_0039442_958_1707 249
460 3300048929 Ga0496126_0046408 Ga0496126_0046408_2770_3519 249
461 3300049569 Ga0501032_0322739 Ga0501032_0322739_58_819 249
462 3300049570 Ga0501033_0037476 Ga0501033_0037476_1765_2514 249
463 3300049571 Ga0501034_0000293 Ga0501034_0000293_42500_43261 249
464 3300049571 Ga0501034_0000874 Ga0501034_0000874_8294_9055 249
465 3300049571 Ga0501034_0001048 Ga0501034_0001048_3203_3964 249
466 3300049571 Ga0501034_0005695 Ga0501034_0005695_10746_11507 249
467 3300049571 Ga0501034_0380522 Ga0501034_0380522_157_972 249
468 3300049574 Ga0501038_0200717 Ga0501038_0200717_373_1134 249
469 3300049575 Ga0501039_0118985 Ga0501039_0118985_181_930 249
470 3300049577 Ga0501041_0017101 Ga0501041_0017101_2084_2833 249
471 3300049579 Ga0501043_0046207 Ga0501043_0046207_1260_2009 249
472 3300049581 Ga0501047_0392940 Ga0501047_0392940_18_833 249
473 3300049585 Ga0501069_0001386 Ga0501069_0001386_2492_3241 249
474 3300049587 Ga0501071_0052012 Ga0501071_0052012_1207_1956 249
475 3300049588 Ga0501072_0013175 Ga0501072_0013175_2619_3368 249
476 3300049590 Ga0501074_0249562 Ga0501074_0249562_404_1153 249
477 3300049592 Ga0501076_0000922 Ga0501076_0000922_1147_1896 249
478 3300049593 Ga0501077_0041392 Ga0501077_0041392_722_1471 249
479 3300049741 Ga0501079_0024619 Ga0501079_0024619_2385_3134 249
480 3300049742 Ga0501080_0103518 Ga0501080_0103518_1172_1921 249
481 3300049743 Ga0501081_0073088 Ga0501081_0073088_671_1420 249
482 3300049744 Ga0501083_0053381 Ga0501083_0053381_1316_2065 249
483 3300049824 Ga0501045_0188791 Ga0501045_0188791_498_1247 249
484 3300050493 nmdc:mga0k408_51309_c1 nmdc:mga0k408_51309_c1_184_933 249
485 3300050508 nmdc:mga09592_321782_c1 nmdc:mga09592_321782_c1_432_1181 249
486 3300050508 nmdc:mga09592_35337_c1 nmdc:mga09592_35337_c1_2705_3454 249
487 3300050508 nmdc:mga09592_606152_c1 nmdc:mga09592_606152_c1_149_898 249
488 3300050509 nmdc:mga0qj67_107148_c1 nmdc:mga0qj67_107148_c1_819_1568 249
489 3300050509 nmdc:mga0qj67_306355_c1 nmdc:mga0qj67_306355_c1_490_1239 249
490 3300050510 nmdc:mga06r32_253526_c1 nmdc:mga06r32_253526_c1_659_1408 249
491 3300050510 nmdc:mga06r32_510372_c1 nmdc:mga06r32_510372_c1_40_789 249
492 3300054114 Ga0501084_0561330 Ga0501084_0561330_108_869 249
493 3300060353 Ga0501082_0054698 Ga0501082_0054698_96_845 249
494 3300061719 Ga0466962_0012688 Ga0466962_0012688_334_1083 249
495 3300061719 Ga0466962_0017508 Ga0466962_0017508_2245_2994 249
496 3300061719 Ga0466962_0194663 Ga0466962_0194663_62_811 249
497 3300061734 Ga0530510_0000977 Ga0530510_0000977_11208_11957 249
498 iso_pu_bacteria 2501025501 2501071635 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

50

236

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9723 1 224
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9514 1 224
2a1u-assembly1.cif.gz_B crystal structure of the human etf e165betaa mutant 0.9247 1 248
1efp-assembly2.cif.gz_D electron transfer flavoprotein (etf) from paracoccus denitrificans 0.9234 1 242
1efv-assembly1.cif.gz_B three-dimensional structure of human electron transfer flavoprotein to 2.1 a resolution 0.9216 1 248
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9723 1 224 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9514 1 224 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9325 2 248 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9217 2 248 3.40.50.620
af_A4I154_9_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9169 1 249 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T0QHW5-F1-model_v4 Electron transfer flavoprotein beta subunit 1.001 1 86 GO:0009055
AF-A0A3D5N4G0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9994 1 100 GO:0009055
AF-A0A1H2PLR8-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9979 1 113 GO:0009055
AF-A0A4S8F3U0-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9976 2 116 GO:0009055
AF-A0A7W6YVC3-F1-model_v4 deleted 0.9959 1 86

Feature Viewer

pLDDT pTM Quality
91.18 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map