F455262

General Info

Members Datasets Scaffolds Average Seq Length
498 262 994 405

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0157748|Ga0496110_0157748_560_2014
Length 477
Sequence VQRLVPELPGDKAEHQTGDDPVARFVGGGLYVGRKRRGHRLILFFAGMRFATTRPLRGQIQHLLPERPFSVEFWDGTRVPSTSGNGPVFSVRSPRAAAHALRAPGQLGLGRAYVAGDLEVDDMDAVIALLDSWQPPPLERGERVRLALAAALAAGLTAPPRRPASELQPSGRRHSRERDARAVRHHYDVSNDFFALFLDESMTYSCALFSRGAEGLEQAQEQKLELICTKLALREGERVLDVGCGWGSFPVHAAARHGVEVVGITLSEPQAELARRRAADAGVADRVEIRVMDYRDLAGERFDAIASIGMVEHVGAERIDEYASVLAGLLSPGGRLLNHGIARLRHSDPEAGAFSERYVFPDADPLHLSRVILALERAGFLTRHVEDLRADYAETLRHWAARLDENLDEAIRLAGPERVRVWRLYLRAARNGFETGFTSIFQVRAEIPGRRLSAGSGRSGGEAAASDSGSTSTAVGH

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 10.64
Rhizosphere 80.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0157748 3300048913 Bacteria 2056
2 JGI24746J21847_1000015 3300001977 Bacteria 16109
3 JGI24034J26672_10000195 3300002239 Bacteria 8103
4 JGI24751J29686_10009606 3300002459 Bacteria 1991
5 JGI25407J50210_10000826 3300003373 Bacteria 6634
6 Ga0070658_10128416 3300005327 Bacteria 2111
7 Ga0070683_100005302 3300005329 Bacteria 10742
8 Ga0070683_100040582 3300005329 Bacteria 4280
9 Ga0070677_10000007 3300005333 Bacteria 74721
10 Ga0070666_10005160 3300005335 Bacteria 7995
11 Ga0070682_100000345 3300005337 Bacteria 31812
12 Ga0068868_100000314 3300005338 Bacteria 32538
13 Ga0068868_100070761 3300005338 Bacteria 2782
14 Ga0070660_100020502 3300005339 Bacteria 4859
15 Ga0070691_10007204 3300005341 Bacteria 5092
16 Ga0070675_100019589 3300005354 Bacteria 5394
17 Ga0070671_100026453 3300005355 Bacteria 4768
18 Ga0070674_100000001 3300005356 Bacteria 277173
19 Ga0070674_100000026 3300005356 Bacteria 77168
20 Ga0070673_100002141 3300005364 Bacteria 11965
21 Ga0070659_100002933 3300005366 Bacteria 12155
22 Ga0070667_100043968 3300005367 Bacteria 3750
23 Ga0070709_10055387 3300005434 Bacteria 2504
24 Ga0070714_100009169 3300005435 Bacteria 7766
25 Ga0070714_100077491 3300005435 Bacteria 2888
26 Ga0070713_100015565 3300005436 Bacteria 5694
27 Ga0070713_100177456 3300005436 Bacteria 1912
28 Ga0070710_10032682 3300005437 Bacteria 2820
29 Ga0070711_100005354 3300005439 Bacteria 7670
30 Ga0070711_100026511 3300005439 Bacteria 3798
31 Ga0070700_100033167 3300005441 Bacteria 3108
32 Ga0070700_100033618 3300005441 Bacteria 3090
33 Ga0070694_100081168 3300005444 Bacteria 2256
34 Ga0070663_100011666 3300005455 Bacteria 5525
35 Ga0070663_100016000 3300005455 Bacteria 4857
36 Ga0070662_100000079 3300005457 Bacteria 53583
37 Ga0070662_100113238 3300005457 Bacteria 2070
38 Ga0068867_100000246 3300005459 Bacteria 35737
39 Ga0070685_10006505 3300005466 Bacteria 5958
40 Ga0070685_10175702 3300005466 Bacteria 1375
41 Ga0070679_100002291 3300005530 Bacteria 17304
42 Ga0070684_100012062 3300005535 Bacteria 6910
43 Ga0070684_100041628 3300005535 Bacteria 3962
44 Ga0070684_100153534 3300005535 Bacteria 2087
45 Ga0068853_100001022 3300005539 Bacteria 19725
46 Ga0068853_100048853 3300005539 Bacteria 3635
47 Ga0070695_100092906 3300005545 Bacteria 2018
48 Ga0070693_100018373 3300005547 Bacteria 3651
49 Ga0070693_100074471 3300005547 Bacteria 2009
50 Ga0070665_100032295 3300005548 Bacteria 5270
51 Ga0070704_100072695 3300005549 Bacteria 2503
52 Ga0068856_100091968 3300005614 Bacteria 3018
53 Ga0068852_100121743 3300005616 Bacteria 2390
54 Ga0068859_100176044 3300005617 Bacteria 2221
55 Ga0068864_100000201 3300005618 Bacteria 54044
56 Ga0068866_10000006 3300005718 Bacteria 176129
57 Ga0068866_10000234 3300005718 Bacteria 26134
58 Ga0068866_10018430 3300005718 Bacteria 3157
59 Ga0068866_10020142 3300005718 Bacteria 3051
60 Ga0068861_100011933 3300005719 Bacteria 6050
61 Ga0068851_10017161 3300005834 Bacteria 3472
62 Ga0068863_100000039 3300005841 Bacteria 161450
63 Ga0068858_100000178 3300005842 Bacteria 67760
64 Ga0068858_100071350 3300005842 Bacteria 3221
65 Ga0081455_10015455 3300005937 Bacteria 7416
66 Ga0081455_10029996 3300005937 Bacteria 4949
67 Ga0081455_10034521 3300005937 Bacteria 4530
68 Ga0081455_10131927 3300005937 Bacteria 1952
69 Ga0081538_10000119 3300005981 Bacteria 79144
70 Ga0081538_10000223 3300005981 Bacteria 63727
71 Ga0081538_10000406 3300005981 Bacteria 48785
72 Ga0081538_10001086 3300005981 Bacteria 28963
73 Ga0081538_10001472 3300005981 Bacteria 24187
74 Ga0081538_10004573 3300005981 Bacteria 12735
75 Ga0081538_10009465 3300005981 Bacteria 8129
76 Ga0081538_10038066 3300005981 Bacteria 3109
77 Ga0081540_1041020 3300005983 Bacteria 2404
78 Ga0070717_10005544 3300006028 Bacteria 9208
79 Ga0075365_10016501 3300006038 Bacteria 4493
80 Ga0075365_10034297 3300006038 Bacteria 3277
81 Ga0075365_10054777 3300006038 Bacteria 2646
82 Ga0075364_10004238 3300006051 Bacteria 8233
83 Ga0070715_10000003 3300006163 Bacteria 345282
84 Ga0070716_100031085 3300006173 Bacteria 2902
85 Ga0070716_100032121 3300006173 Bacteria 2860
86 Ga0070712_100021056 3300006175 Bacteria 4276
87 Ga0075428_100005802 3300006844 Bacteria 13711
88 Ga0075428_100050699 3300006844 Bacteria 4552
89 Ga0075428_100220984 3300006844 Bacteria 2045
90 Ga0075428_100231936 3300006844 Bacteria 1992
91 Ga0075428_100297955 3300006844 Bacteria 1734
92 Ga0075430_100027749 3300006846 Bacteria 4809
93 Ga0075430_100079419 3300006846 Bacteria 2749
94 Ga0075430_100102325 3300006846 Bacteria 2391
95 Ga0075431_100002561 3300006847 Bacteria 17549
96 Ga0075431_100073969 3300006847 Bacteria 3516
97 Ga0075431_100081540 3300006847 Bacteria 3340
98 Ga0075433_10000032 3300006852 Bacteria 55399
99 Ga0075433_10001949 3300006852 Bacteria 15514
100 Ga0075433_10006968 3300006852 Bacteria 8960
101 Ga0075433_10069761 3300006852 Bacteria 3087
102 Ga0068865_100121628 3300006881 Bacteria 1942
103 Ga0097620_100176037 3300006931 Bacteria 2221
104 Ga0075435_100077161 3300007076 Bacteria 2731
105 Ga0111539_10123222 3300009094 Bacteria 3038
106 Ga0105245_10000049 3300009098 Bacteria 128277
107 Ga0105245_10000824 3300009098 Bacteria 28281
108 Ga0105245_10001474 3300009098 Bacteria 21245
109 Ga0105245_10103136 3300009098 Bacteria 2642
110 Ga0105245_10170112 3300009098 Bacteria 2074
111 Ga0114129_10002211 3300009147 Bacteria 26822
112 Ga0114129_10023154 3300009147 Bacteria 8811
113 Ga0114129_10031913 3300009147 Bacteria 7448
114 Ga0114129_10157791 3300009147 Bacteria 3102
115 Ga0114129_10159851 3300009147 Bacteria 3079
116 Ga0114129_10661101 3300009147 Bacteria 1347
117 Ga0105243_10039010 3300009148 Bacteria 3701
118 Ga0105243_10388270 3300009148 Bacteria 1293
119 Ga0105238_10000014 3300009551 Bacteria 241954
120 Ga0105249_10000039 3300009553 Bacteria 196325
121 Ga0105249_10000963 3300009553 Bacteria 25455
122 Ga0105249_10054658 3300009553 Bacteria 3652
123 Ga0105239_10044343 3300010375 Bacteria 4876
124 Ga0105239_10093615 3300010375 Bacteria 3318
125 Ga0105246_10217516 3300011119 Bacteria 1495
126 Ga0157370_10010686 3300013104 Bacteria 9657
127 Ga0157375_10003759 3300013308 Bacteria 13161
128 Ga0163163_10244937 3300014325 Bacteria 1843
129 Ga0163163_10279270 3300014325 Bacteria 1722
130 Ga0157380_10000277 3300014326 Bacteria 30723
131 Ga0157377_10007466 3300014745 Bacteria 5281
132 Ga0157379_10003439 3300014968 Bacteria 13397
133 Ga0157379_10048778 3300014968 Bacteria 3779
134 Ga0163161_10000013 3300017792 Bacteria 258747
135 Ga0163161_10119486 3300017792 Bacteria 1979
136 Ga0213874_10009621 3300021377 Bacteria 2396
137 Ga0213876_10006531 3300021384 Bacteria 6358
138 Ga0213876_10036428 3300021384 Bacteria 2594
139 Ga0213875_10000095 3300021388 Bacteria 102332
140 Ga0213875_10014215 3300021388 Bacteria 3888
141 Ga0207653_10016701 3300025885 Bacteria 2306
142 Ga0207682_10000007 3300025893 Bacteria 88967
143 Ga0207642_10000001 3300025899 Bacteria 714030
144 Ga0207642_10000003 3300025899 Bacteria 650651
145 Ga0207642_10000004 3300025899 Bacteria 407822
146 Ga0207642_10000022 3300025899 Bacteria 54810
147 Ga0207688_10001389 3300025901 Bacteria 12586
148 Ga0207688_10016752 3300025901 Bacteria 3978
149 Ga0207688_10030533 3300025901 Bacteria 2972
150 Ga0207680_10001305 3300025903 Bacteria 11789
151 Ga0207685_10000003 3300025905 Bacteria 344527
152 Ga0207705_10099113 3300025909 Bacteria 2142
153 Ga0207693_10001018 3300025915 Bacteria 25130
154 Ga0207693_10001605 3300025915 Bacteria 20004
155 Ga0207693_10010494 3300025915 Bacteria 7517
156 Ga0207663_10003516 3300025916 Bacteria 7685
157 Ga0207662_10049795 3300025918 Bacteria 2486
158 Ga0207657_10008406 3300025919 Bacteria 10478
159 Ga0207652_10001427 3300025921 Bacteria 21179
160 Ga0207652_10105709 3300025921 Bacteria 2491
161 Ga0207694_10000008 3300025924 Bacteria 484902
162 Ga0207650_10298264 3300025925 Bacteria 1316
163 Ga0207687_10000012 3300025927 Bacteria 370729
164 Ga0207687_10000353 3300025927 Bacteria 30581
165 Ga0207700_10086728 3300025928 Bacteria 2460
166 Ga0207664_10050285 3300025929 Bacteria 3286
167 Ga0207664_10091549 3300025929 Bacteria 2494
168 Ga0207706_10000302 3300025933 Bacteria 53541
169 Ga0207706_10002594 3300025933 Bacteria 17594
170 Ga0207709_10024070 3300025935 Bacteria 3473
171 Ga0207669_10000002 3300025937 Bacteria 377651
172 Ga0207669_10000041 3300025937 Bacteria 67085
173 Ga0207669_10091560 3300025937 Bacteria 1981
174 Ga0207704_10099090 3300025938 Bacteria 1938
175 Ga0207661_10003655 3300025944 Bacteria 10716
176 Ga0207661_10081093 3300025944 Bacteria 2679
177 Ga0207679_10017644 3300025945 Bacteria 4765
178 Ga0207651_10000172 3300025960 Bacteria 28069
179 Ga0207712_10000003 3300025961 Bacteria 615314
180 Ga0207712_10125099 3300025961 Bacteria 1951
181 Ga0207658_10092848 3300025986 Bacteria 2345
182 Ga0207677_10000218 3300026023 Bacteria 45820
183 Ga0207703_10000381 3300026035 Bacteria 47426
184 Ga0207678_10083163 3300026067 Bacteria 2738
185 Ga0207678_10161805 3300026067 Bacteria 1911
186 Ga0207708_10008922 3300026075 Bacteria 7423
187 Ga0207708_10020016 3300026075 Bacteria 5046
188 Ga0207708_10117357 3300026075 Bacteria 2071
189 Ga0207702_10156388 3300026078 Bacteria 2078
190 Ga0207641_10000065 3300026088 Bacteria 156066
191 Ga0207648_10000783 3300026089 Bacteria 35821
192 Ga0207648_10071957 3300026089 Bacteria 3013
193 Ga0207676_10000026 3300026095 Bacteria 248593
194 Ga0207674_10162978 3300026116 Bacteria 2184
195 Ga0207675_100002396 3300026118 Bacteria 18565
196 Ga0207683_10026564 3300026121 Bacteria 4997
197 Ga0207683_10119320 3300026121 Bacteria 2366
198 Ga0268266_10000342 3300028379 Bacteria 72894
199 Ga0268266_10066279 3300028379 Bacteria 3122
200 Ga0268264_10255574 3300028381 Bacteria 1630
201 Ga0265337_1000074 3300028556 Bacteria 46897
202 Ga0265326_10000035 3300028558 Bacteria 89561
203 Ga0265319_1024918 3300028563 Bacteria 2146
204 Ga0265322_10000009 3300028654 Bacteria 170768
205 Ga0265336_10012573 3300028666 Bacteria 2845
206 Ga0265338_10231495 3300028800 Bacteria 1374
207 Ga0265324_10000168 3300029957 Bacteria 50622
208 Ga0265328_10003665 3300031239 Bacteria 6769
209 Ga0265320_10000024 3300031240 Bacteria 170768
210 Ga0265331_10027196 3300031250 Bacteria 2869
211 Ga0265327_10000227 3300031251 Bacteria 114777
212 Ga0265327_10014250 3300031251 Bacteria 5210
213 Ga0265316_10033614 3300031344 Bacteria 4174
214 Ga0307408_100062608 3300031548 Bacteria 2719
215 Ga0265314_10000647 3300031711 Bacteria 42707
216 Ga0265314_10126363 3300031711 Bacteria 1601
217 Ga0265342_10131924 3300031712 Bacteria 1399
218 Ga0307405_10015738 3300031731 Bacteria 4105
219 Ga0307405_10023331 3300031731 Bacteria 3515
220 Ga0307410_10016908 3300031852 Bacteria 4363
221 Ga0307406_10017018 3300031901 Bacteria 4231
222 Ga0307406_10113526 3300031901 Bacteria 1870
223 Ga0307416_100005913 3300032002 Bacteria 7596
224 Ga0307416_100013708 3300032002 Bacteria 5520
225 Ga0307416_100171211 3300032002 Bacteria 2022
226 Ga0307414_10116145 3300032004 Bacteria 2048
227 Ga0373933_0102616 3300035724 Bacteria 1776
228 Ga0373937_0006399 3300036401 Bacteria 10162
229 Ga0395900_0030255 3300037418 Bacteria 5558
230 Ga0395905_0056077 3300037471 Bacteria 3687
231 Ga0436364_0226761 3300037853 Bacteria 1579
232 Ga0436364_0344803 3300037853 Bacteria 4836
233 Ga0436364_0374446 3300037853 Bacteria 6350
234 Ga0436364_0715728 3300037853 Bacteria 1484
235 Ga0436364_0738291 3300037853 Bacteria 4665
236 Ga0436364_1065693 3300037853 Bacteria 1576
237 Ga0436364_1294613 3300037853 Bacteria 100298
238 Ga0436364_1338915 3300037853 Bacteria 30372
239 Ga0436364_1369993 3300037853 Bacteria 1798
240 Ga0395901_0001837 3300038443 Bacteria 21942
241 Ga0395901_0032935 3300038443 Bacteria 5347
242 Ga0395901_0204733 3300038443 Bacteria 2068
243 Ga0436365_0157247 3300039437 Bacteria 20207
244 Ga0436365_0184729 3300039437 Bacteria 53150
245 Ga0436365_1326100 3300039437 Bacteria 2495
246 Ga0436365_1504096 3300039437 Bacteria 20425
247 Ga0436365_1631777 3300039437 Bacteria 6711
248 Ga0436365_1677847 3300039437 Bacteria 6999
249 Ga0436363_0003726 3300039450 Bacteria 6283
250 Ga0436363_0806883 3300039450 Bacteria 2865
251 Ga0436363_1245252 3300039450 Bacteria 6503
252 Ga0436362_0201136 3300039453 Bacteria 2756
253 Ga0466969_0013581 3300044656 Bacteria 4288
254 Ga0466966_0012741 3300044684 Bacteria 5574
255 Ga0466966_0038232 3300044684 Bacteria 3093
256 Ga0466966_0058846 3300044684 Bacteria 2428
257 Ga0466966_0090340 3300044684 Bacteria 1902
258 Ga0466961_0004110 3300044693 Bacteria 9087
259 Ga0466961_0023207 3300044693 Bacteria 3990
260 Ga0466963_0000025 3300044694 Bacteria 51171
261 Ga0466963_0009215 3300044694 Bacteria 5941
262 Ga0466963_0017347 3300044694 Bacteria 4487
263 Ga0466963_0035684 3300044694 Bacteria 3240
264 Ga0453684_0034064 3300044712 Bacteria 7080
265 Ga0466971_0017893 3300044719 Bacteria 3139
266 Ga0466970_0077042 3300044765 Bacteria 1797
267 Ga0466957_0005072 3300044842 Bacteria 7369
268 Ga0466957_0056018 3300044842 Bacteria 2410
269 Ga0466959_0002713 3300045049 Bacteria 11375
270 Ga0466959_0009169 3300045049 Bacteria 7027
271 Ga0466959_0028733 3300045049 Bacteria 4122
272 Ga0466959_0053316 3300045049 Bacteria 2957
273 Ga0466959_0058930 3300045049 Bacteria 2797
274 Ga0466959_0148705 3300045049 Bacteria 1652
275 Ga0466958_0001670 3300045836 Bacteria 10703
276 Ga0466958_0007369 3300045836 Bacteria 6046
277 Ga0466967_0000913 3300045976 Bacteria 15849
278 Ga0466967_0001039 3300045976 Bacteria 15239
279 Ga0466967_0010877 3300045976 Bacteria 6855
280 Ga0466967_0035137 3300045976 Bacteria 4262
281 Ga0466967_0047163 3300045976 Bacteria 3755
282 Ga0466967_0274229 3300045976 Bacteria 1617
283 Ga0495592_0028879 3300046454 Bacteria 4198
284 Ga0495603_0000431 3300046455 Bacteria 23265
285 Ga0495603_0009177 3300046455 Bacteria 5978
286 Ga0495641_0000095 3300046461 Bacteria 60441
287 Ga0495651_0006942 3300046462 Bacteria 8658
288 Ga0495651_0012985 3300046462 Bacteria 6435
289 Ga0495653_0001046 3300046463 Bacteria 21304
290 Ga0495653_0017317 3300046463 Bacteria 5861
291 Ga0495653_0064597 3300046463 Bacteria 2757
292 Ga0495653_0068567 3300046463 Bacteria 2660
293 Ga0495653_0109184 3300046463 Bacteria 1991
294 Ga0495582_0000082 3300046473 Bacteria 48118
295 Ga0495664_0099124 3300046477 Bacteria 1755
296 Ga0495608_0004501 3300046511 Bacteria 9955
297 Ga0495608_0045608 3300046511 Bacteria 2920
298 Ga0495608_0106204 3300046511 Bacteria 1807
299 Ga0495618_0000046 3300046514 Bacteria 93942
300 Ga0495618_0000097 3300046514 Bacteria 63474
301 Ga0495618_0013715 3300046514 Bacteria 4932
302 Ga0495628_0000048 3300046516 Bacteria 96944
303 Ga0495628_0109274 3300046516 Bacteria 2128
304 Ga0495630_0000082 3300046517 Bacteria 75280
305 Ga0495630_0006357 3300046517 Bacteria 8396
306 Ga0495644_0008690 3300046523 Bacteria 3909
307 Ga0495652_0022568 3300046529 Bacteria 5584
308 Ga0495652_0042882 3300046529 Bacteria 3900
309 Ga0495640_0017239 3300046533 Bacteria 5386
310 Ga0495640_0041316 3300046533 Bacteria 3223
311 Ga0495586_0000560 3300046535 Bacteria 21545
312 Ga0495587_0000967 3300046536 Bacteria 18810
313 Ga0495587_0007418 3300046536 Bacteria 7102
314 Ga0495621_0002976 3300046539 Bacteria 4623
315 Ga0495645_0000152 3300046543 Bacteria 47567
316 Ga0495645_0018715 3300046543 Bacteria 4979
317 Ga0495645_0051261 3300046543 Bacteria 3003
318 Ga0495667_0000053 3300046559 Bacteria 105370
319 Ga0495656_0004485 3300046615 Bacteria 4783
320 Ga0495634_0000616 3300046642 Bacteria 34537
321 Ga0495634_0002295 3300046642 Bacteria 15998
322 Ga0495634_0032656 3300046642 Bacteria 3579
323 Ga0495634_0077433 3300046642 Bacteria 2181
324 Ga0495635_0000006 3300046663 Bacteria 301820
325 Ga0495635_0034962 3300046663 Bacteria 3485
326 Ga0495635_0058713 3300046663 Bacteria 2647
327 Ga0495635_0099010 3300046663 Bacteria 1992
328 Ga0495657_0000011 3300046675 Bacteria 207360
329 Ga0495657_0008769 3300046675 Bacteria 7710
330 Ga0495657_0023036 3300046675 Bacteria 4455
331 Ga0495657_0104763 3300046675 Bacteria 1798
332 Ga0495599_0004225 3300046678 Bacteria 8486
333 Ga0495646_0062175 3300046680 Bacteria 2221
334 Ga0495658_0000070 3300046683 Bacteria 52450
335 Ga0495669_0000545 3300046684 Bacteria 16848
336 Ga0495613_0172201 3300046689 Bacteria 1536
337 Ga0495624_0000049 3300046690 Bacteria 75485
338 Ga0495624_0003321 3300046690 Bacteria 11977
339 Ga0495604_0000862 3300047317 Bacteria 25312
340 Ga0495674_0000063 3300047319 Bacteria 71737
341 Ga0495676_0000187 3300047321 Bacteria 49042
342 Ga0495676_0004369 3300047321 Bacteria 12917
343 Ga0495680_0000336 3300047322 Bacteria 52443
344 Ga0495680_0000364 3300047322 Bacteria 50773
345 Ga0495680_0007408 3300047322 Bacteria 10065
346 Ga0495680_0010323 3300047322 Bacteria 8334
347 Ga0495675_0090378 3300047444 Bacteria 1922
348 Ga0495679_004373 3300047446 Bacteria 6543
349 Ga0495593_0056501 3300047673 Bacteria 2063
350 Ga0495593_0093241 3300047673 Bacteria 1550
351 Ga0495602_0021653 3300048088 Bacteria 6320
352 Ga0495602_0080896 3300048088 Bacteria 2734
353 Ga0496100_0000004 3300048903 Bacteria 321778
354 Ga0496100_0000032 3300048903 Bacteria 99877
355 Ga0496100_0005784 3300048903 Bacteria 6688
356 Ga0496100_0008421 3300048903 Bacteria 5751
357 Ga0496100_0091560 3300048903 Bacteria 2076
358 Ga0496101_0000007 3300048904 Bacteria 321778
359 Ga0496101_0000012 3300048904 Bacteria 268127
360 Ga0496101_0002691 3300048904 Bacteria 10902
361 Ga0496101_0041251 3300048904 Bacteria 3290
362 Ga0496102_0003732 3300048905 Bacteria 12874
363 Ga0496102_0113698 3300048905 Bacteria 2526
364 Ga0496102_0158629 3300048905 Bacteria 2127
365 Ga0496103_0003208 3300048906 Bacteria 10031
366 Ga0496103_0032075 3300048906 Bacteria 3205
367 Ga0496104_0000003 3300048907 Bacteria 669219
368 Ga0496105_0000003 3300048908 Bacteria 713251
369 Ga0496105_0187871 3300048908 Bacteria 1690
370 Ga0496106_0000004 3300048909 Bacteria 279896
371 Ga0496106_0000092 3300048909 Bacteria 70312
372 Ga0496106_0000130 3300048909 Bacteria 57887
373 Ga0496106_0001258 3300048909 Bacteria 18997
374 Ga0496106_0012223 3300048909 Bacteria 6335
375 Ga0496106_0033414 3300048909 Bacteria 3838
376 Ga0496107_0000001 3300048910 Bacteria 321778
377 Ga0496107_0000031 3300048910 Bacteria 100522
378 Ga0496107_0000637 3300048910 Bacteria 19758
379 Ga0496107_0004573 3300048910 Bacteria 9377
380 Ga0496107_0032416 3300048910 Bacteria 3735
381 Ga0496107_0068101 3300048910 Bacteria 2583
382 Ga0496107_0117275 3300048910 Bacteria 1960
383 Ga0496108_0000002 3300048911 Bacteria 700890
384 Ga0496108_0007827 3300048911 Bacteria 8660
385 Ga0496108_0089600 3300048911 Bacteria 2614
386 Ga0496108_0127093 3300048911 Bacteria 2189
387 Ga0496109_0000001 3300048912 Bacteria 700852
388 Ga0496109_0000131 3300048912 Bacteria 76860
389 Ga0496109_0166805 3300048912 Bacteria 2065
390 Ga0496110_0010737 3300048913 Bacteria 7461
391 Ga0496110_0045312 3300048913 Bacteria 3844
392 Ga0496110_0054320 3300048913 Bacteria 3523
393 Ga0496110_0154713 3300048913 Bacteria 2077
394 Ga0496111_0010505 3300048914 Bacteria 6218
395 Ga0496111_0016627 3300048914 Bacteria 5073
396 Ga0496111_0231083 3300048914 Bacteria 1374
397 Ga0496112_0000002 3300048915 Bacteria 782039
398 Ga0496112_0003818 3300048915 Bacteria 12587
399 Ga0496113_0004103 3300048916 Bacteria 8876
400 Ga0496113_0021990 3300048916 Bacteria 4504
401 Ga0496113_0174418 3300048916 Bacteria 1703
402 Ga0496114_0041521 3300048917 Bacteria 3812
403 Ga0496115_0000183 3300048918 Bacteria 58406
404 Ga0496115_0010721 3300048918 Bacteria 6854
405 Ga0496116_0000557 3300048919 Bacteria 49954
406 Ga0496117_0014892 3300048920 Bacteria 6670
407 Ga0496117_0080007 3300048920 Bacteria 2151
408 Ga0496118_0005961 3300048921 Bacteria 13607
409 Ga0496118_0104679 3300048921 Bacteria 1899
410 Ga0496119_0009332 3300048922 Bacteria 8440
411 Ga0496119_0009695 3300048922 Bacteria 8203
412 Ga0496120_0002060 3300048923 Bacteria 21705
413 Ga0496121_0010244 3300048924 Bacteria 10607
414 Ga0496121_0027224 3300048924 Bacteria 5355
415 Ga0496124_0136748 3300048927 Bacteria 1939
416 Ga0496126_0008398 3300048929 Bacteria 11144
417 Ga0496126_0031997 3300048929 Bacteria 4962
418 Ga0501031_0004439 3300049568 Bacteria 9097
419 Ga0501031_0049877 3300049568 Bacteria 2728
420 Ga0501032_0006547 3300049569 Bacteria 8553
421 Ga0501033_0007143 3300049570 Bacteria 8715
422 Ga0501033_0116317 3300049570 Bacteria 1943
423 Ga0501036_0007537 3300049572 Bacteria 8878
424 Ga0501036_0029691 3300049572 Bacteria 4619
425 Ga0501036_0145366 3300049572 Bacteria 2000
426 Ga0501038_0006540 3300049574 Bacteria 10781
427 Ga0501039_0007704 3300049575 Bacteria 8221
428 Ga0501039_0137936 3300049575 Bacteria 1916
429 Ga0501041_0025850 3300049577 Bacteria 3530
430 Ga0501041_0060398 3300049577 Bacteria 2320
431 Ga0501041_0111559 3300049577 Bacteria 1696
432 Ga0501042_0048511 3300049578 Bacteria 3028
433 Ga0501042_0086511 3300049578 Bacteria 2248
434 Ga0501043_0006360 3300049579 Bacteria 9489
435 Ga0501046_0008009 3300049580 Bacteria 9235
436 Ga0501047_0008867 3300049581 Bacteria 9486
437 Ga0501047_0021963 3300049581 Bacteria 6129
438 Ga0501048_0004413 3300049582 Bacteria 10713
439 Ga0501068_0039823 3300049584 Bacteria 2819
440 Ga0501068_0130264 3300049584 Bacteria 1573
441 Ga0501069_0004180 3300049585 Bacteria 7462
442 Ga0501069_0019147 3300049585 Bacteria 3698
443 Ga0501070_0008411 3300049586 Bacteria 8715
444 Ga0501070_0085069 3300049586 Bacteria 2618
445 Ga0501071_0090667 3300049587 Bacteria 2245
446 Ga0501072_0046823 3300049588 Bacteria 3405
447 Ga0501072_0072495 3300049588 Bacteria 2722
448 Ga0501073_0006290 3300049589 Bacteria 8847
449 Ga0501074_0034773 3300049590 Bacteria 3652
450 Ga0501074_0136497 3300049590 Bacteria 1754
451 Ga0501075_0027512 3300049591 Bacteria 4191
452 Ga0501075_0042012 3300049591 Bacteria 3428
453 Ga0501076_0041658 3300049592 Bacteria 3614
454 Ga0501079_0012476 3300049741 Bacteria 6487
455 Ga0501079_0053871 3300049741 Bacteria 3103
456 Ga0501083_0009810 3300049744 Bacteria 6759
457 Ga0501083_0013898 3300049744 Bacteria 5628
458 Ga0501035_0008616 3300049822 Bacteria 9489
459 Ga0501044_0011988 3300049823 Bacteria 9391
460 Ga0501044_0137238 3300049823 Bacteria 2436
461 Ga0501045_0045019 3300049824 Bacteria 3213
462 Ga0501045_0078924 3300049824 Bacteria 2427
463 nmdc:mga03n38_60718_c1 3300050490 Bacteria 1719
464 nmdc:mga00v17_12656_c1 3300050491 Bacteria 4659
465 nmdc:mga05p37_135743_c1 3300050507 Bacteria 3017
466 nmdc:mga05p37_198164_c1 3300050507 Bacteria 2434
467 nmdc:mga05p37_20314_c1 3300050507 Bacteria 8036
468 nmdc:mga09592_231140_c1 3300050508 Bacteria 1602
469 nmdc:mga0qj67_77525_c1 3300050509 Bacteria 2659
470 nmdc:mga0qj67_92670_c1 3300050509 Bacteria 2429
471 nmdc:mga0qj67_98437_c1 3300050509 Bacteria 2356
472 nmdc:mga06r32_74744_c1 3300050510 Bacteria 3286
473 nmdc:mga0a205_1636_c1 3300050515 Bacteria 19228
474 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
475 nmdc:mga0a205_81433_c1 3300050515 Bacteria 3127
476 Ga0495601_0000209 3300053077 Bacteria 31307
477 Ga0495601_0008029 3300053077 Bacteria 6219
478 Ga0495601_0041033 3300053077 Bacteria 2900
479 Ga0495612_0000076 3300053078 Bacteria 44649
480 Ga0495612_0002977 3300053078 Bacteria 7033
481 Ga0495612_0009779 3300053078 Bacteria 3886
482 Ga0495655_0015429 3300053083 Bacteria 1623
483 Ga0495595_0000262 3300053084 Bacteria 20924
484 Ga0495619_0000060 3300053085 Bacteria 89377
485 Ga0495619_0001010 3300053085 Bacteria 18420
486 Ga0495619_0001967 3300053085 Bacteria 13702
487 Ga0495619_0004736 3300053085 Bacteria 8656
488 Ga0495619_0005900 3300053085 Bacteria 7761
489 Ga0495619_0026212 3300053085 Bacteria 3749
490 Ga0495619_0037772 3300053085 Bacteria 3149
491 Ga0500566_0052970 3300053094 Bacteria 2317
492 Ga0500614_000923 3300053123 Bacteria 7352
493 Ga0501082_0009954 3300060353 Bacteria 8199
494 Ga0501082_0204367 3300060353 Bacteria 1718
495 Ga0466962_0006190 3300061719 Bacteria 5749
496 Ga0530510_0007973 3300061734 Bacteria 7387
497 Ga0530510_0138699 3300061734 Bacteria 1791
498 Ga0496110_0157748
499 JGI24746J21847_1000015
500 JGI24034J26672_10000195
501 JGI24751J29686_10009606
502 JGI25407J50210_10000826
503 Ga0070658_10128416
504 Ga0070683_100005302
505 Ga0070683_100040582
506 Ga0070677_10000007
507 Ga0070666_10005160
508 Ga0070682_100000345
509 Ga0068868_100000314
510 Ga0068868_100070761
511 Ga0070660_100020502
512 Ga0070691_10007204
513 Ga0070675_100019589
514 Ga0070671_100026453
515 Ga0070674_100000001
516 Ga0070674_100000026
517 Ga0070673_100002141
518 Ga0070659_100002933
519 Ga0070667_100043968
520 Ga0070709_10055387
521 Ga0070714_100009169
522 Ga0070714_100077491
523 Ga0070713_100015565
524 Ga0070713_100177456
525 Ga0070710_10032682
526 Ga0070711_100005354
527 Ga0070711_100026511
528 Ga0070700_100033167
529 Ga0070700_100033618
530 Ga0070694_100081168
531 Ga0070663_100011666
532 Ga0070663_100016000
533 Ga0070662_100000079
534 Ga0070662_100113238
535 Ga0068867_100000246
536 Ga0070685_10006505
537 Ga0070685_10175702
538 Ga0070679_100002291
539 Ga0070684_100012062
540 Ga0070684_100041628
541 Ga0070684_100153534
542 Ga0068853_100001022
543 Ga0068853_100048853
544 Ga0070695_100092906
545 Ga0070693_100018373
546 Ga0070693_100074471
547 Ga0070665_100032295
548 Ga0070704_100072695
549 Ga0068856_100091968
550 Ga0068852_100121743
551 Ga0068859_100176044
552 Ga0068864_100000201
553 Ga0068866_10000006
554 Ga0068866_10000234
555 Ga0068866_10018430
556 Ga0068866_10020142
557 Ga0068861_100011933
558 Ga0068851_10017161
559 Ga0068863_100000039
560 Ga0068858_100000178
561 Ga0068858_100071350
562 Ga0081455_10015455
563 Ga0081455_10029996
564 Ga0081455_10034521
565 Ga0081455_10131927
566 Ga0081538_10000119
567 Ga0081538_10000223
568 Ga0081538_10000406
569 Ga0081538_10001086
570 Ga0081538_10001472
571 Ga0081538_10004573
572 Ga0081538_10009465
573 Ga0081538_10038066
574 Ga0081540_1041020
575 Ga0070717_10005544
576 Ga0075365_10016501
577 Ga0075365_10034297
578 Ga0075365_10054777
579 Ga0075364_10004238
580 Ga0070715_10000003
581 Ga0070716_100031085
582 Ga0070716_100032121
583 Ga0070712_100021056
584 Ga0075428_100005802
585 Ga0075428_100050699
586 Ga0075428_100220984
587 Ga0075428_100231936
588 Ga0075428_100297955
589 Ga0075430_100027749
590 Ga0075430_100079419
591 Ga0075430_100102325
592 Ga0075431_100002561
593 Ga0075431_100073969
594 Ga0075431_100081540
595 Ga0075433_10000032
596 Ga0075433_10001949
597 Ga0075433_10006968
598 Ga0075433_10069761
599 Ga0068865_100121628
600 Ga0097620_100176037
601 Ga0075435_100077161
602 Ga0111539_10123222
603 Ga0105245_10000049
604 Ga0105245_10000824
605 Ga0105245_10001474
606 Ga0105245_10103136
607 Ga0105245_10170112
608 Ga0114129_10002211
609 Ga0114129_10023154
610 Ga0114129_10031913
611 Ga0114129_10157791
612 Ga0114129_10159851
613 Ga0114129_10661101
614 Ga0105243_10039010
615 Ga0105243_10388270
616 Ga0105238_10000014
617 Ga0105249_10000039
618 Ga0105249_10000963
619 Ga0105249_10054658
620 Ga0105239_10044343
621 Ga0105239_10093615
622 Ga0105246_10217516
623 Ga0157370_10010686
624 Ga0157375_10003759
625 Ga0163163_10244937
626 Ga0163163_10279270
627 Ga0157380_10000277
628 Ga0157377_10007466
629 Ga0157379_10003439
630 Ga0157379_10048778
631 Ga0163161_10000013
632 Ga0163161_10119486
633 Ga0213874_10009621
634 Ga0213876_10006531
635 Ga0213876_10036428
636 Ga0213875_10000095
637 Ga0213875_10014215
638 Ga0207653_10016701
639 Ga0207682_10000007
640 Ga0207642_10000001
641 Ga0207642_10000003
642 Ga0207642_10000004
643 Ga0207642_10000022
644 Ga0207688_10001389
645 Ga0207688_10016752
646 Ga0207688_10030533
647 Ga0207680_10001305
648 Ga0207685_10000003
649 Ga0207705_10099113
650 Ga0207693_10001018
651 Ga0207693_10001605
652 Ga0207693_10010494
653 Ga0207663_10003516
654 Ga0207662_10049795
655 Ga0207657_10008406
656 Ga0207652_10001427
657 Ga0207652_10105709
658 Ga0207694_10000008
659 Ga0207650_10298264
660 Ga0207687_10000012
661 Ga0207687_10000353
662 Ga0207700_10086728
663 Ga0207664_10050285
664 Ga0207664_10091549
665 Ga0207706_10000302
666 Ga0207706_10002594
667 Ga0207709_10024070
668 Ga0207669_10000002
669 Ga0207669_10000041
670 Ga0207669_10091560
671 Ga0207704_10099090
672 Ga0207661_10003655
673 Ga0207661_10081093
674 Ga0207679_10017644
675 Ga0207651_10000172
676 Ga0207712_10000003
677 Ga0207712_10125099
678 Ga0207658_10092848
679 Ga0207677_10000218
680 Ga0207703_10000381
681 Ga0207678_10083163
682 Ga0207678_10161805
683 Ga0207708_10008922
684 Ga0207708_10020016
685 Ga0207708_10117357
686 Ga0207702_10156388
687 Ga0207641_10000065
688 Ga0207648_10000783
689 Ga0207648_10071957
690 Ga0207676_10000026
691 Ga0207674_10162978
692 Ga0207675_100002396
693 Ga0207683_10026564
694 Ga0207683_10119320
695 Ga0268266_10000342
696 Ga0268266_10066279
697 Ga0268264_10255574
698 Ga0265337_1000074
699 Ga0265326_10000035
700 Ga0265319_1024918
701 Ga0265322_10000009
702 Ga0265336_10012573
703 Ga0265338_10231495
704 Ga0265324_10000168
705 Ga0265328_10003665
706 Ga0265320_10000024
707 Ga0265331_10027196
708 Ga0265327_10000227
709 Ga0265327_10014250
710 Ga0265316_10033614
711 Ga0307408_100062608
712 Ga0265314_10000647
713 Ga0265314_10126363
714 Ga0265342_10131924
715 Ga0307405_10015738
716 Ga0307405_10023331
717 Ga0307410_10016908
718 Ga0307406_10017018
719 Ga0307406_10113526
720 Ga0307416_100005913
721 Ga0307416_100013708
722 Ga0307416_100171211
723 Ga0307414_10116145
724 Ga0373933_0102616
725 Ga0373937_0006399
726 Ga0395900_0030255
727 Ga0395905_0056077
728 Ga0436364_0226761
729 Ga0436364_0344803
730 Ga0436364_0374446
731 Ga0436364_0715728
732 Ga0436364_0738291
733 Ga0436364_1065693
734 Ga0436364_1294613
735 Ga0436364_1338915
736 Ga0436364_1369993
737 Ga0395901_0001837
738 Ga0395901_0032935
739 Ga0395901_0204733
740 Ga0436365_0157247
741 Ga0436365_0184729
742 Ga0436365_1326100
743 Ga0436365_1504096
744 Ga0436365_1631777
745 Ga0436365_1677847
746 Ga0436363_0003726
747 Ga0436363_0806883
748 Ga0436363_1245252
749 Ga0436362_0201136
750 Ga0466969_0013581
751 Ga0466966_0012741
752 Ga0466966_0038232
753 Ga0466966_0058846
754 Ga0466966_0090340
755 Ga0466961_0004110
756 Ga0466961_0023207
757 Ga0466963_0000025
758 Ga0466963_0009215
759 Ga0466963_0017347
760 Ga0466963_0035684
761 Ga0453684_0034064
762 Ga0466971_0017893
763 Ga0466970_0077042
764 Ga0466957_0005072
765 Ga0466957_0056018
766 Ga0466959_0002713
767 Ga0466959_0009169
768 Ga0466959_0028733
769 Ga0466959_0053316
770 Ga0466959_0058930
771 Ga0466959_0148705
772 Ga0466958_0001670
773 Ga0466958_0007369
774 Ga0466967_0000913
775 Ga0466967_0001039
776 Ga0466967_0010877
777 Ga0466967_0035137
778 Ga0466967_0047163
779 Ga0466967_0274229
780 Ga0495592_0028879
781 Ga0495603_0000431
782 Ga0495603_0009177
783 Ga0495641_0000095
784 Ga0495651_0006942
785 Ga0495651_0012985
786 Ga0495653_0001046
787 Ga0495653_0017317
788 Ga0495653_0064597
789 Ga0495653_0068567
790 Ga0495653_0109184
791 Ga0495582_0000082
792 Ga0495664_0099124
793 Ga0495608_0004501
794 Ga0495608_0045608
795 Ga0495608_0106204
796 Ga0495618_0000046
797 Ga0495618_0000097
798 Ga0495618_0013715
799 Ga0495628_0000048
800 Ga0495628_0109274
801 Ga0495630_0000082
802 Ga0495630_0006357
803 Ga0495644_0008690
804 Ga0495652_0022568
805 Ga0495652_0042882
806 Ga0495640_0017239
807 Ga0495640_0041316
808 Ga0495586_0000560
809 Ga0495587_0000967
810 Ga0495587_0007418
811 Ga0495621_0002976
812 Ga0495645_0000152
813 Ga0495645_0018715
814 Ga0495645_0051261
815 Ga0495667_0000053
816 Ga0495656_0004485
817 Ga0495634_0000616
818 Ga0495634_0002295
819 Ga0495634_0032656
820 Ga0495634_0077433
821 Ga0495635_0000006
822 Ga0495635_0034962
823 Ga0495635_0058713
824 Ga0495635_0099010
825 Ga0495657_0000011
826 Ga0495657_0008769
827 Ga0495657_0023036
828 Ga0495657_0104763
829 Ga0495599_0004225
830 Ga0495646_0062175
831 Ga0495658_0000070
832 Ga0495669_0000545
833 Ga0495613_0172201
834 Ga0495624_0000049
835 Ga0495624_0003321
836 Ga0495604_0000862
837 Ga0495674_0000063
838 Ga0495676_0000187
839 Ga0495676_0004369
840 Ga0495680_0000336
841 Ga0495680_0000364
842 Ga0495680_0007408
843 Ga0495680_0010323
844 Ga0495675_0090378
845 Ga0495679_004373
846 Ga0495593_0056501
847 Ga0495593_0093241
848 Ga0495602_0021653
849 Ga0495602_0080896
850 Ga0496100_0000004
851 Ga0496100_0000032
852 Ga0496100_0005784
853 Ga0496100_0008421
854 Ga0496100_0091560
855 Ga0496101_0000007
856 Ga0496101_0000012
857 Ga0496101_0002691
858 Ga0496101_0041251
859 Ga0496102_0003732
860 Ga0496102_0113698
861 Ga0496102_0158629
862 Ga0496103_0003208
863 Ga0496103_0032075
864 Ga0496104_0000003
865 Ga0496105_0000003
866 Ga0496105_0187871
867 Ga0496106_0000004
868 Ga0496106_0000092
869 Ga0496106_0000130
870 Ga0496106_0001258
871 Ga0496106_0012223
872 Ga0496106_0033414
873 Ga0496107_0000001
874 Ga0496107_0000031
875 Ga0496107_0000637
876 Ga0496107_0004573
877 Ga0496107_0032416
878 Ga0496107_0068101
879 Ga0496107_0117275
880 Ga0496108_0000002
881 Ga0496108_0007827
882 Ga0496108_0089600
883 Ga0496108_0127093
884 Ga0496109_0000001
885 Ga0496109_0000131
886 Ga0496109_0166805
887 Ga0496110_0010737
888 Ga0496110_0045312
889 Ga0496110_0054320
890 Ga0496110_0154713
891 Ga0496111_0010505
892 Ga0496111_0016627
893 Ga0496111_0231083
894 Ga0496112_0000002
895 Ga0496112_0003818
896 Ga0496113_0004103
897 Ga0496113_0021990
898 Ga0496113_0174418
899 Ga0496114_0041521
900 Ga0496115_0000183
901 Ga0496115_0010721
902 Ga0496116_0000557
903 Ga0496117_0014892
904 Ga0496117_0080007
905 Ga0496118_0005961
906 Ga0496118_0104679
907 Ga0496119_0009332
908 Ga0496119_0009695
909 Ga0496120_0002060
910 Ga0496121_0010244
911 Ga0496121_0027224
912 Ga0496124_0136748
913 Ga0496126_0008398
914 Ga0496126_0031997
915 Ga0501031_0004439
916 Ga0501031_0049877
917 Ga0501032_0006547
918 Ga0501033_0007143
919 Ga0501033_0116317
920 Ga0501036_0007537
921 Ga0501036_0029691
922 Ga0501036_0145366
923 Ga0501038_0006540
924 Ga0501039_0007704
925 Ga0501039_0137936
926 Ga0501041_0025850
927 Ga0501041_0060398
928 Ga0501041_0111559
929 Ga0501042_0048511
930 Ga0501042_0086511
931 Ga0501043_0006360
932 Ga0501046_0008009
933 Ga0501047_0008867
934 Ga0501047_0021963
935 Ga0501048_0004413
936 Ga0501068_0039823
937 Ga0501068_0130264
938 Ga0501069_0004180
939 Ga0501069_0019147
940 Ga0501070_0008411
941 Ga0501070_0085069
942 Ga0501071_0090667
943 Ga0501072_0046823
944 Ga0501072_0072495
945 Ga0501073_0006290
946 Ga0501074_0034773
947 Ga0501074_0136497
948 Ga0501075_0027512
949 Ga0501075_0042012
950 Ga0501076_0041658
951 Ga0501079_0012476
952 Ga0501079_0053871
953 Ga0501083_0009810
954 Ga0501083_0013898
955 Ga0501035_0008616
956 Ga0501044_0011988
957 Ga0501044_0137238
958 Ga0501045_0045019
959 Ga0501045_0078924
960 nmdc:mga03n38_60718_c1
961 nmdc:mga00v17_12656_c1
962 nmdc:mga05p37_135743_c1
963 nmdc:mga05p37_198164_c1
964 nmdc:mga05p37_20314_c1
965 nmdc:mga09592_231140_c1
966 nmdc:mga0qj67_77525_c1
967 nmdc:mga0qj67_92670_c1
968 nmdc:mga0qj67_98437_c1
969 nmdc:mga06r32_74744_c1
970 nmdc:mga0a205_1636_c1
971 nmdc:mga0a205_1_c2
972 nmdc:mga0a205_81433_c1
973 Ga0495601_0000209
974 Ga0495601_0008029
975 Ga0495601_0041033
976 Ga0495612_0000076
977 Ga0495612_0002977
978 Ga0495612_0009779
979 Ga0495655_0015429
980 Ga0495595_0000262
981 Ga0495619_0000060
982 Ga0495619_0001010
983 Ga0495619_0001967
984 Ga0495619_0004736
985 Ga0495619_0005900
986 Ga0495619_0026212
987 Ga0495619_0037772
988 Ga0500566_0052970
989 Ga0500614_000923
990 Ga0501082_0009954
991 Ga0501082_0204367
992 Ga0466962_0006190
993 Ga0530510_0007973
994 Ga0530510_0138699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02353

CMAS

Mycolic acid cyclopropane synthetase

174

443

0.98

PF13649

Methyltransf_25

Methyltransferase domain

239

334

0.97

PF08241

Methyltransf_11

Methyltransferase domain

240

338

0.95

PF08242

Methyltransf_12

Methyltransferase domain

240

336

0.95

PF13489

Methyltransf_23

Methyltransferase domain

216

406

0.88

PF13847

Methyltransf_31

Methyltransferase domain

233

353

0.84

PF01728

FtsJ

FtsJ-like methyltransferase

208

338

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l1e-assembly2.cif.gz_B crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine 0.95 130 390
1tpy-assembly1.cif.gz_A structure of the cyclopropane synthase mmaa2 from mycobacterium tuberculosis 0.9498 123 390
1l1e-assembly2.cif.gz_B crystal structure of mycolic acid cyclopropane synthase pcaa complexed with s-adenosyl-l-homocysteine 0.9465 130 390
3hem-assembly1.cif.gz_A structure of mycobacterium tuberculosis mycolic acid cyclopropane synthase cmaa2 in complex with dioctylamine 0.9429 123 390
8t1a-assembly1.cif.gz_A crystal structure of s-adenosylmethionine-dependent methyltransferase umaa from mycobacterium tuberculosis (p32 twin) 0.9403 130 390
ID Description Score Start End Superfamily
af_O69687_132_410_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9635 112 390 3.40.50.150
af_O69687_132_410_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9601 112 390 3.40.50.150
1l1eB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.95 130 390 3.40.50.150
1l1eB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9465 130 390 3.40.50.150
af_Q2QUD2_542_827_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9449 115 390 3.40.50.150
ID Description Score Start End GO Terms
AF-J9DMY3-F1-model_v4 Cyclopropane-fatty-acyl-phospholipid synthase 0.9762 159 237
AF-A0A6B2XNI1-F1-model_v4 SAM-dependent methyltransferase 0.9677 269 390 GO:0008168
GO:0032259
AF-A0A377BCV2-F1-model_v4 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) 0.9673 117 260 GO:0008825
GO:0032259
AF-A0A323V5Q6-F1-model_v4 SAM-dependent methyltransferase 0.9671 103 391 GO:0008168
GO:0008610
GO:0032259
AF-A0A497ER25-F1-model_v4 SAM-dependent methyltransferase 0.9649 165 240 GO:0016279
GO:0032259

Map