F455270

General Info

Members Datasets Scaffolds Average Seq Length
498 324 996 320

Family's Representative Sequence

Representative Sequence 3300048926|Ga0496123_0001967|Ga0496123_0001967_23085_24038
Length 307
Sequence MRVLLTGSSGWLGRFLAPRLRAAGHTVIGLDVAPGADTDIVGSVADRATVDRAFARGVDAVIHAGALHKPDIARYPAQAFVDVNVTGTLNLLEAAAAARHDRFVFTSTTSLMISEAIRSEAGSQAIWLDETSGPLLPRNIYGVTKLAAEGLCRIHAQQHGLNCVVLRTGRFFPEEDDTHRTPSGENLKANELLSRRLTVEDAADAHVVALDRAPAIGFGIYILAAPTPFARDDVAALKRDAASVLYARRGWTLPASIGRVYDATLAERELGFRCATGFADVLAALRAGRDPPVAHDPSYVPPKEQRR

Samples

Sample ID Description Type Environment
1 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
114 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
251 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
259 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
260 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
261 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
269 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
270 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
271 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
272 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
274 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
275 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
279 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
280 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
281 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
282 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
283 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
284 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
285 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
286 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
287 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
288 2643221556 Massilia sp. Root1485 Isolate Unclassified
289 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
290 2643221684 Massilia sp. Root133 Isolate Unclassified
291 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
292 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
293 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
294 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
295 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
296 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
297 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
298 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
299 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
300 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
301 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
302 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
303 2904699407
304 2906610324
305 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
306 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
307 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
308 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
309 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
310 2922425934
311 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
312 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
313 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
314 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
315 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
316 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
317 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
318 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
319 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
320 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
321 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
322 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
323 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
324 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.11
Metatranscriptomes 0
Isolates 8.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.07
Nodule 4.82
Rhizoplane 2.61
Rhizosphere 60.84
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496123_0001967 3300048926 Bacteria 26671
2 JGI24741J21665_1002303 3300001915 Bacteria 5020
3 JGI24740J21852_10003974 3300001979 Bacteria 6419
4 JGI24737J22298_10016381 3300001990 Bacteria 2393
5 JGI24749J21850_1001461 3300002076 Bacteria 3336
6 JGI24751J29686_10000357 3300002459 Bacteria 15936
7 JGI25153J46596_10013111 3300003215 Bacteria 3524
8 rootH1_10130120 3300003316 Bacteria 2794
9 rootH2_10014115 3300003320 Bacteria 2993
10 rootH1_10283578 3300003323 Bacteria 2608
11 Ga0055525_1000186 3300003759 Bacteria 75686
12 Ga0055526_1033145 3300003771 Bacteria 1440
13 Ga0055537_1001019 3300003773 Bacteria 12668
14 Ga0055537_1006876 3300003773 Bacteria 2820
15 Ga0055524_1000539 3300003775 Bacteria 28724
16 Ga0055536_1009630 3300003781 Bacteria 3959
17 Ga0055530_10003402 3300003791 Bacteria 9077
18 Ga0055530_10007609 3300003791 Bacteria 4526
19 Ga0055540_1006750 3300003792 Bacteria 4488
20 Ga0055531_10003730 3300003794 Bacteria 9574
21 Ga0055531_10004059 3300003794 Bacteria 9077
22 Ga0055543_1011995 3300004625 Bacteria 1755
23 Ga0065165_1003679 3300005262 Bacteria 10426
24 Ga0065165_1005379 3300005262 Bacteria 7235
25 Ga0065165_1037227 3300005262 Bacteria 1476
26 Ga0065707_10093872 3300005295 Bacteria 3569
27 Ga0070670_100000178 3300005331 Bacteria 57676
28 Ga0070660_100102256 3300005339 Bacteria 2271
29 Ga0070661_100143793 3300005344 Bacteria 1799
30 Ga0070669_100000119 3300005353 Bacteria 73001
31 Ga0070675_100242562 3300005354 Bacteria 1575
32 Ga0070674_100024610 3300005356 Bacteria 3910
33 Ga0070674_100106425 3300005356 Bacteria 2052
34 Ga0070673_100184294 3300005364 Bacteria 1789
35 Ga0070667_100000088 3300005367 Bacteria 113956
36 Ga0070667_100000407 3300005367 Bacteria 46001
37 Ga0070667_100202315 3300005367 Bacteria 1762
38 Ga0070678_100017439 3300005456 Bacteria 4624
39 Ga0070662_100185244 3300005457 Bacteria 1643
40 Ga0068853_100023854 3300005539 Bacteria 5126
41 Ga0070665_100000323 3300005548 Bacteria 73605
42 Ga0070664_100028482 3300005564 Bacteria 4647
43 Ga0068857_100347931 3300005577 Bacteria 1372
44 Ga0068859_100008045 3300005617 Bacteria 10690
45 Ga0068864_100000183 3300005618 Bacteria 57684
46 Ga0068861_100000001 3300005719 Bacteria 116118
47 Ga0068861_100001052 3300005719 Bacteria 16975
48 Ga0068851_10053336 3300005834 Bacteria 2058
49 Ga0068858_100000327 3300005842 Bacteria 50180
50 Ga0068860_100000055 3300005843 Bacteria 203538
51 Ga0068860_100000220 3300005843 Bacteria 89460
52 Ga0068862_100000011 3300005844 Bacteria 270105
53 Ga0068862_100010652 3300005844 Bacteria 7596
54 Ga0081540_1066166 3300005983 Bacteria 1695
55 Ga0081539_10011418 3300005985 Bacteria 7021
56 Ga0075368_10000016 3300006042 Bacteria 42234
57 Ga0075364_10000807 3300006051 Bacteria 16518
58 Ga0070712_100145779 3300006175 Bacteria 1812
59 Ga0075367_10000154 3300006178 Bacteria 21481
60 Ga0075369_10003090 3300006186 Bacteria 6029
61 Ga0075366_10023439 3300006195 Bacteria 3595
62 Ga0075370_10011024 3300006353 Bacteria 4740
63 Ga0097620_100008045 3300006931 Bacteria 10690
64 Ga0099822_1020871 3300006943 Bacteria 6426
65 Ga0105240_10617028 3300009093 Unclassified 1192
66 Ga0105247_10012729 3300009101 Bacteria 5049
67 Ga0105243_10000033 3300009148 Bacteria 180464
68 Ga0105243_10188381 3300009148 Bacteria 1800
69 Ga0105241_10001031 3300009174 Bacteria 21221
70 Ga0105248_10000685 3300009177 Bacteria 38290
71 Ga0105248_10000998 3300009177 Bacteria 31278
72 Ga0105248_10001758 3300009177 Bacteria 24108
73 Ga0105248_10002949 3300009177 Bacteria 18868
74 Ga0105248_10311368 3300009177 Unclassified 1773
75 Ga0105237_10472577 3300009545 Unclassified 1260
76 Ga0105239_10065247 3300010375 Bacteria 3998
77 Ga0105239_10259055 3300010375 Bacteria 1954
78 Ga0157326_1002414 3300012513 Bacteria 2000
79 Ga0157371_10000059 3300013102 Bacteria 170541
80 Ga0157370_10105124 3300013104 Bacteria 2643
81 Ga0157374_10184987 3300013296 Bacteria 2037
82 Ga0157378_10045746 3300013297 Bacteria 3890
83 Ga0163162_10013938 3300013306 Bacteria 7854
84 Ga0157372_10191971 3300013307 Bacteria 2365
85 Ga0163163_10011516 3300014325 Bacteria 8031
86 Ga0157380_10000087 3300014326 Bacteria 50956
87 Ga0163161_10030181 3300017792 Bacteria 3856
88 Ga0163161_10052945 3300017792 Bacteria 2942
89 Ga0213872_10000321 3300021361 Bacteria 40934
90 Ga0213872_10002552 3300021361 Bacteria 10608
91 Ga0213872_10036518 3300021361 Bacteria 2245
92 Ga0213876_10001077 3300021384 Bacteria 17543
93 Ga0209674_108949 3300025226 Bacteria 1148
94 Ga0209563_100145 3300025230 Bacteria 75938
95 Ga0209646_1002642 3300025246 Bacteria 3848
96 Ga0209565_1000008 3300025263 Bacteria 774179
97 Ga0209565_1000134 3300025263 Bacteria 104013
98 Ga0209673_1001779 3300025273 Bacteria 17881
99 Ga0209673_1007209 3300025273 Bacteria 5180
100 Ga0209675_1005513 3300025291 Bacteria 5283
101 Ga0209676_1003684 3300025292 Bacteria 9169
102 Ga0209564_1000622 3300025295 Bacteria 53970
103 Ga0209758_1000001 3300025297 Bacteria 1981790
104 Ga0209758_1038954 3300025297 Bacteria 1815
105 Ga0209050_1000001 3300025298 Bacteria 3563507
106 Ga0209050_1000581 3300025298 Bacteria 59224
107 Ga0209050_1012997 3300025298 Bacteria 3756
108 Ga0209050_1016987 3300025298 Bacteria 2936
109 Ga0209050_1017353 3300025298 Bacteria 2877
110 Ga0209256_1000009 3300025299 Bacteria 922071
111 Ga0209256_1000010 3300025299 Bacteria 912110
112 Ga0209051_1000191 3300025303 Bacteria 108763
113 Ga0209257_1000577 3300025304 Bacteria 61710
114 Ga0209257_1000597 3300025304 Bacteria 59900
115 Ga0209257_1000876 3300025304 Bacteria 42634
116 Ga0209257_1005749 3300025304 Bacteria 8479
117 Ga0209257_1015960 3300025304 Bacteria 3074
118 Ga0209257_1019098 3300025304 Bacteria 2599
119 Ga0207656_10002881 3300025321 Bacteria 5864
120 Ga0207705_10000203 3300025909 Bacteria 60016
121 Ga0207654_10000897 3300025911 Bacteria 16495
122 Ga0207671_10058290 3300025914 Bacteria 2863
123 Ga0207693_10080522 3300025915 Bacteria 2550
124 Ga0207657_10096223 3300025919 Bacteria 2463
125 Ga0207681_10000001 3300025923 Bacteria 1105841
126 Ga0207650_10000050 3300025925 Bacteria 169589
127 Ga0207659_10031315 3300025926 Bacteria 3640
128 Ga0207706_10051503 3300025933 Bacteria 3635
129 Ga0207709_10000059 3300025935 Bacteria 211914
130 Ga0207709_10181554 3300025935 Bacteria 1486
131 Ga0207669_10000341 3300025937 Bacteria 21234
132 Ga0207669_10105521 3300025937 Bacteria 1874
133 Ga0207711_10000662 3300025941 Bacteria 34294
134 Ga0207711_10000852 3300025941 Bacteria 29486
135 Ga0207711_10004113 3300025941 Bacteria 12471
136 Ga0207711_10016633 3300025941 Bacteria 6108
137 Ga0207711_10285677 3300025941 Unclassified 1520
138 Ga0207679_10060401 3300025945 Bacteria 2816
139 Ga0207667_10000002 3300025949 Bacteria 895662
140 Ga0207668_10074535 3300025972 Bacteria 2436
141 Ga0207640_10000799 3300025981 Bacteria 17925
142 Ga0207658_10000064 3300025986 Bacteria 117779
143 Ga0207658_10001936 3300025986 Bacteria 15451
144 Ga0207703_10000244 3300026035 Bacteria 61520
145 Ga0207639_10005826 3300026041 Bacteria 8346
146 Ga0207639_10010643 3300026041 Bacteria 6369
147 Ga0207702_10003062 3300026078 Bacteria 15548
148 Ga0207641_10403089 3300026088 Bacteria 1313
149 Ga0207676_10000004 3300026095 Bacteria 725417
150 Ga0207676_10003426 3300026095 Bacteria 11218
151 Ga0207674_10475189 3300026116 Bacteria 1208
152 Ga0207675_100000159 3300026118 Bacteria 59714
153 Ga0207683_10002724 3300026121 Bacteria 15430
154 Ga0207698_10011101 3300026142 Bacteria 5824
155 Ga0209589_1000007 3300027357 Bacteria 425699
156 Ga0209489_100008 3300027361 Bacteria 425699
157 Ga0209700_100009 3300027363 Bacteria 425699
158 Ga0209813_10000014 3300027866 Bacteria 87712
159 Ga0268266_10000002 3300028379 Bacteria 3059047
160 Ga0268266_10088054 3300028379 Unclassified 2717
161 Ga0268265_10000002 3300028380 Bacteria 1035381
162 Ga0268265_10005540 3300028380 Bacteria 8618
163 Ga0268264_10000035 3300028381 Bacteria 398196
164 Ga0268264_10000112 3300028381 Bacteria 203742
165 Ga0268264_10000384 3300028381 Bacteria 63602
166 Ga0307517_10024293 3300028786 Bacteria 7480
167 Ga0307517_10024453 3300028786 Bacteria 7441
168 Ga0307509_10184800 3300031507 Bacteria 1944
169 Ga0307408_100061064 3300031548 Bacteria 2750
170 Ga0307508_10000114 3300031616 Bacteria 95098
171 Ga0307514_10153227 3300031649 Bacteria 1542
172 Ga0307516_10045233 3300031730 Bacteria 4349
173 Ga0307516_10083452 3300031730 Bacteria 3036
174 Ga0307405_10073578 3300031731 Bacteria 2207
175 Ga0307413_10044048 3300031824 Bacteria 2634
176 Ga0307413_10111086 3300031824 Bacteria 1835
177 Ga0307410_10010880 3300031852 Bacteria 5179
178 Ga0307410_10051603 3300031852 Bacteria 2773
179 Ga0307410_10162999 3300031852 Bacteria 1672
180 Ga0307407_10003482 3300031903 Bacteria 6467
181 Ga0307412_10016403 3300031911 Bacteria 4412
182 Ga0307412_10066138 3300031911 Bacteria 2449
183 Ga0307409_100035606 3300031995 Bacteria 3650
184 Ga0307409_100060415 3300031995 Bacteria 2955
185 Ga0307409_100224891 3300031995 Bacteria 1697
186 Ga0307409_100270990 3300031995 Bacteria 1563
187 Ga0307416_100029785 3300032002 Bacteria 4084
188 Ga0307416_100234678 3300032002 Bacteria 1771
189 Ga0307414_10016784 3300032004 Bacteria 4463
190 Ga0307414_10244851 3300032004 Bacteria 1486
191 Ga0307411_10004666 3300032005 Bacteria 6605
192 Ga0307415_100033228 3300032126 Bacteria 3348
193 Ga0307415_100493194 3300032126 Bacteria 1069
194 Ga0307507_10020656 3300033179 Bacteria 7365
195 Ga0307510_10038576 3300033180 Bacteria 5280
196 Ga0307510_10045195 3300033180 Bacteria 4758
197 Ga0373927_0015379 3300035695 Bacteria 5057
198 Ga0373927_0043498 3300035695 Bacteria 2908
199 Ga0373947_0156097 3300035725 Bacteria 1473
200 Ga0395899_0034460 3300037312 Bacteria 3802
201 Ga0395899_0105526 3300037312 Bacteria 2029
202 Ga0395899_0157624 3300037312 Bacteria 1606
203 Ga0395899_0253187 3300037312 Bacteria 1207
204 Ga0395899_0280228 3300037312 Bacteria 1134
205 Ga0395900_0002029 3300037418 Bacteria 22751
206 Ga0395900_0201500 3300037418 Bacteria 2013
207 Ga0395900_0206130 3300037418 Bacteria 1987
208 Ga0395905_0000365 3300037471 Bacteria 64175
209 Ga0395905_0411564 3300037471 Bacteria 1247
210 Ga0395901_0000898 3300038443 Bacteria 32720
211 Ga0395901_0111905 3300038443 Bacteria 2867
212 Ga0395901_0251611 3300038443 Bacteria 1840
213 Ga0400483_105072 3300039062 Bacteria 2268
214 Ga0436365_1117045 3300039437 Bacteria 20483
215 Ga0436361_0118740 3300039447 Bacteria 13719
216 Ga0436361_0422717 3300039447 Bacteria 3366
217 Ga0436361_0567500 3300039447 Bacteria 7795
218 Ga0436361_0684862 3300039447 Bacteria 3208
219 Ga0436361_0800986 3300039447 Bacteria 3122
220 Ga0436361_0986572 3300039447 Bacteria 2169
221 Ga0436361_0991627 3300039447 Bacteria 5125
222 Ga0436361_1110176 3300039447 Bacteria 18005
223 Ga0439436_0014239 3300041404 Bacteria 2402
224 Ga0439461_0002997 3300041410 Bacteria 2749
225 Ga0439465_0008796 3300041413 Bacteria 3180
226 Ga0439431_0001353 3300041997 Bacteria 5407
227 Ga0439431_0020543 3300041997 Bacteria 1578
228 Ga0439445_0028786 3300042004 Bacteria 1433
229 Ga0439448_0046189 3300042005 Bacteria 1419
230 Ga0439432_013213 3300042006 Bacteria 2810
231 Ga0439455_0001522 3300042012 Bacteria 3908
232 Ga0439462_0016380 3300042015 Bacteria 1914
233 Ga0439446_0010759 3300042156 Bacteria 2471
234 Ga0450909_003791 3300042185 Bacteria 2146
235 Ga0439434_0001561 3300042435 Bacteria 6606
236 Ga0466969_0017985 3300044656 Bacteria 3687
237 Ga0466972_0000466 3300044658 Bacteria 20596
238 Ga0466972_0029370 3300044658 Bacteria 2707
239 Ga0466965_0012486 3300044683 Bacteria 3995
240 Ga0466965_0036275 3300044683 Bacteria 2418
241 Ga0466966_0011486 3300044684 Bacteria 5874
242 Ga0466966_0014692 3300044684 Bacteria 5181
243 Ga0466966_0045368 3300044684 Bacteria 2810
244 Ga0466961_0027986 3300044693 Bacteria 3625
245 Ga0466961_0033773 3300044693 Bacteria 3286
246 Ga0466968_0002809 3300044735 Bacteria 6432
247 Ga0466968_0034456 3300044735 Bacteria 2113
248 Ga0466970_0091423 3300044765 Bacteria 1652
249 Ga0466957_0002374 3300044842 Bacteria 10109
250 Ga0466957_0044507 3300044842 Bacteria 2690
251 Ga0466959_0003025 3300045049 Bacteria 10867
252 Ga0466959_0062594 3300045049 Bacteria 2703
253 Ga0466959_0191634 3300045049 Bacteria 1426
254 Ga0466959_0193771 3300045049 Bacteria 1417
255 Ga0466958_0046743 3300045836 Bacteria 2612
256 Ga0466967_0040917 3300045976 Bacteria 3992
257 Ga0495650_0000440 3300046471 Bacteria 66809
258 Ga0495605_0000555 3300046474 Bacteria 30522
259 Ga0495605_0018642 3300046474 Bacteria 3715
260 Ga0495664_0223013 3300046477 Bacteria 1141
261 Ga0495584_0001058 3300046491 Bacteria 17100
262 Ga0495584_0025293 3300046491 Bacteria 3010
263 Ga0495585_0079473 3300046492 Bacteria 1779
264 Ga0495594_0126095 3300046499 Bacteria 1449
265 Ga0495607_0000317 3300046501 Bacteria 50197
266 Ga0495607_0001250 3300046501 Bacteria 22779
267 Ga0495607_0113130 3300046501 Bacteria 1436
268 Ga0495583_0000212 3300046506 Bacteria 97784
269 Ga0495583_0033420 3300046506 Bacteria 2474
270 Ga0495583_0074301 3300046506 Bacteria 1488
271 Ga0495583_0083066 3300046506 Bacteria 1389
272 Ga0495606_0007068 3300046507 Bacteria 10158
273 Ga0495606_0009337 3300046507 Bacteria 8313
274 Ga0495616_0014271 3300046513 Bacteria 4454
275 Ga0495616_0014626 3300046513 Bacteria 4387
276 Ga0495631_0041989 3300046518 Bacteria 2022
277 Ga0495637_0010987 3300046520 Bacteria 4363
278 Ga0495643_0003463 3300046522 Bacteria 11527
279 Ga0495643_0018864 3300046522 Bacteria 3996
280 Ga0495643_0073096 3300046522 Bacteria 1797
281 Ga0495648_0000459 3300046524 Bacteria 44196
282 Ga0495648_0026583 3300046524 Bacteria 3893
283 Ga0495648_0043060 3300046524 Bacteria 2834
284 Ga0495648_0157980 3300046524 Bacteria 1175
285 Ga0495663_0003362 3300046525 Bacteria 4626
286 Ga0495642_0000210 3300046528 Bacteria 34170
287 Ga0495642_0009054 3300046528 Bacteria 3811
288 Ga0495654_0052374 3300046530 Bacteria 1988
289 Ga0495609_0000009 3300046538 Bacteria 354860
290 Ga0495609_0013033 3300046538 Bacteria 3934
291 Ga0495609_0097092 3300046538 Bacteria 1278
292 Ga0495622_0012589 3300046557 Bacteria 3920
293 Ga0495622_0082176 3300046557 Bacteria 1482
294 Ga0495633_0000391 3300046558 Bacteria 46143
295 Ga0495656_0009580 3300046615 Bacteria 3488
296 Ga0495656_0064526 3300046615 Bacteria 1608
297 Ga0495668_0172145 3300046616 Bacteria 1186
298 Ga0495611_0039751 3300046648 Bacteria 2095
299 Ga0495625_0000106 3300046660 Bacteria 125985
300 Ga0495625_0020905 3300046660 Bacteria 5046
301 Ga0495625_0034464 3300046660 Bacteria 3736
302 Ga0495625_0042326 3300046660 Bacteria 3311
303 Ga0495625_0202671 3300046660 Bacteria 1308
304 Ga0495661_0000113 3300046665 Bacteria 96815
305 Ga0495661_0004134 3300046665 Bacteria 10566
306 Ga0495661_0014294 3300046665 Bacteria 5320
307 Ga0495661_0033369 3300046665 Bacteria 3247
308 Ga0495661_0082032 3300046665 Bacteria 1857
309 Ga0495661_0137855 3300046665 Bacteria 1330
310 Ga0495588_0000118 3300046674 Bacteria 134942
311 Ga0495669_0000148 3300046684 Bacteria 44972
312 Ga0495670_0000002 3300046691 Bacteria 601814
313 Ga0495649_0072392 3300046694 Bacteria 1847
314 Ga0495649_0084774 3300046694 Bacteria 1691
315 Ga0495589_0000037 3300046794 Bacteria 150603
316 Ga0495589_0028378 3300046794 Bacteria 2824
317 Ga0495600_0028612 3300046809 Bacteria 3605
318 Ga0495660_0000050 3300046810 Bacteria 140329
319 Ga0495660_0039347 3300046810 Bacteria 2626
320 Ga0495672_0152649 3300047320 Bacteria 1196
321 Ga0495683_0006914 3300047323 Bacteria 6164
322 Ga0495687_000068 3300047443 Bacteria 161081
323 Ga0495687_000097 3300047443 Bacteria 132755
324 Ga0495687_000168 3300047443 Bacteria 97267
325 Ga0495687_000563 3300047443 Bacteria 43682
326 Ga0495687_000654 3300047443 Bacteria 39715
327 Ga0495687_010878 3300047443 Bacteria 4943
328 Ga0495677_0000011 3300047445 Bacteria 149837
329 Ga0495677_0000251 3300047445 Bacteria 23487
330 Ga0495677_0002971 3300047445 Bacteria 6596
331 Ga0495677_0020710 3300047445 Bacteria 2383
332 Ga0495673_0025860 3300047469 Bacteria 2814
333 Ga0495686_0000619 3300047472 Bacteria 49008
334 Ga0495686_0016175 3300047472 Bacteria 5067
335 Ga0495686_0086220 3300047472 Bacteria 1911
336 Ga0495626_0000081 3300048091 Bacteria 128894
337 Ga0495626_0000772 3300048091 Bacteria 29300
338 Ga0495626_0086632 3300048091 Bacteria 1383
339 Ga0496102_0002779 3300048905 Bacteria 14916
340 Ga0496102_0089177 3300048905 Bacteria 2853
341 Ga0496103_0001865 3300048906 Bacteria 13700
342 Ga0496106_0011029 3300048909 Bacteria 6680
343 Ga0496106_0034658 3300048909 Bacteria 3771
344 Ga0496109_0112418 3300048912 Bacteria 2533
345 Ga0496110_0026296 3300048913 Bacteria 4978
346 Ga0496111_0116116 3300048914 Bacteria 1974
347 Ga0496111_0263170 3300048914 Bacteria 1280
348 Ga0496115_0000269 3300048918 Bacteria 45856
349 Ga0496115_0001129 3300048918 Bacteria 19266
350 Ga0496116_0033048 3300048919 Bacteria 3677
351 Ga0496117_0000887 3300048920 Bacteria 46091
352 Ga0496117_0013570 3300048920 Bacteria 7098
353 Ga0496118_0005843 3300048921 Bacteria 13797
354 Ga0496118_0009618 3300048921 Bacteria 9730
355 Ga0496118_0029534 3300048921 Bacteria 4595
356 Ga0496118_0241159 3300048921 Bacteria 1035
357 Ga0496119_0019694 3300048922 Bacteria 4954
358 Ga0496120_0026787 3300048923 Bacteria 3555
359 Ga0496121_0000009 3300048924 Bacteria 836971
360 Ga0496121_0004850 3300048924 Bacteria 17692
361 Ga0496121_0040867 3300048924 Bacteria 4062
362 Ga0496121_0354025 3300048924 Bacteria 977
363 Ga0496122_0002487 3300048925 Bacteria 26053
364 Ga0496122_0047324 3300048925 Bacteria 3321
365 Ga0496122_0073375 3300048925 Bacteria 2426
366 Ga0496123_0001567 3300048926 Bacteria 31277
367 Ga0496123_0058045 3300048926 Bacteria 2514
368 Ga0496123_0182997 3300048926 Bacteria 1092
369 Ga0496124_0000874 3300048927 Bacteria 49185
370 Ga0496124_0000960 3300048927 Bacteria 45969
371 Ga0496124_0005202 3300048927 Bacteria 14776
372 Ga0496124_0006631 3300048927 Bacteria 12562
373 Ga0496124_0012507 3300048927 Bacteria 8370
374 Ga0496124_0045594 3300048927 Bacteria 3758
375 Ga0496124_0196942 3300048927 Bacteria 1536
376 Ga0496125_0000956 3300048928 Bacteria 45452
377 Ga0496125_0109050 3300048928 Bacteria 2011
378 Ga0496125_0168675 3300048928 Bacteria 1475
379 Ga0496126_0000321 3300048929 Bacteria 102445
380 Ga0496126_0124692 3300048929 Bacteria 2230
381 Ga0495682_0025992 3300049460 Bacteria 2177
382 Ga0501032_0000174 3300049569 Bacteria 52564
383 Ga0501032_0205700 3300049569 Bacteria 1284
384 Ga0501033_0012210 3300049570 Bacteria 6556
385 Ga0501034_0001672 3300049571 Bacteria 28588
386 Ga0501034_0023822 3300049571 Bacteria 6234
387 Ga0501036_0010134 3300049572 Bacteria 7767
388 Ga0501036_0154588 3300049572 Bacteria 1935
389 Ga0501037_0171244 3300049573 Bacteria 1543
390 Ga0501038_0000906 3300049574 Bacteria 26241
391 Ga0501039_0019301 3300049575 Bacteria 5227
392 Ga0501043_0030136 3300049579 Bacteria 4262
393 Ga0501046_0002375 3300049580 Bacteria 17702
394 Ga0501046_0069743 3300049580 Bacteria 2734
395 Ga0501047_0001336 3300049581 Bacteria 24199
396 Ga0501047_0193738 3300049581 Bacteria 1895
397 Ga0501048_0309996 3300049582 Bacteria 1123
398 Ga0501067_0090640 3300049583 Bacteria 1697
399 Ga0501068_0012788 3300049584 Bacteria 4765
400 Ga0501069_0136628 3300049585 Bacteria 1405
401 Ga0501072_0302978 3300049588 Bacteria 1270
402 Ga0501073_0043700 3300049589 Bacteria 3159
403 Ga0501080_0002399 3300049742 Bacteria 16356
404 Ga0501241_013729 3300049758 Bacteria 1471
405 Ga0501044_0042146 3300049823 Bacteria 4750
406 Ga0501044_0193935 3300049823 Bacteria 1992
407 nmdc:mga0k408_61488_c1 3300050493 Bacteria 2183
408 nmdc:mga0k408_98499_c1 3300050493 Bacteria 1723
409 nmdc:mga06z11_47_c1 3300050494 Bacteria 51206
410 nmdc:mga04h51_18_c1 3300050495 Bacteria 74460
411 nmdc:mga07m45_1071_c1 3300050496 Bacteria 10955
412 Ga0500610_0000607 3300053079 Bacteria 10987
413 Ga0500635_0020061 3300053080 Bacteria 2042
414 Ga0500643_001242 3300053087 Bacteria 15099
415 Ga0500643_046710 3300053087 Bacteria 1250
416 Ga0500651_0022471 3300053093 Bacteria 3939
417 Ga0500566_0006685 3300053094 Bacteria 6826
418 Ga0500555_000216 3300053103 Bacteria 26527
419 Ga0500562_003564 3300053108 Bacteria 3903
420 Ga0500595_001506 3300053119 Bacteria 12379
421 Ga0500607_000036 3300053121 Bacteria 87178
422 Ga0500607_004589 3300053121 Bacteria 9439
423 Ga0500608_000197 3300053122 Bacteria 24165
424 Ga0500642_0004805 3300053130 Bacteria 4276
425 Ga0500655_000422 3300053133 Bacteria 8829
426 Ga0500559_0000751 3300053136 Bacteria 21285
427 Ga0500559_0004177 3300053136 Bacteria 6929
428 Ga0500559_0011691 3300053136 Bacteria 3744
429 Ga0500559_0059915 3300053136 Bacteria 1695
430 Ga0500564_011201 3300053138 Bacteria 3949
431 Ga0500573_0000086 3300053140 Bacteria 42361
432 Ga0500573_0008076 3300053140 Bacteria 5785
433 Ga0500573_0078953 3300053140 Bacteria 1872
434 Ga0500590_008524 3300053148 Bacteria 5121
435 Ga0500590_082605 3300053148 Bacteria 1575
436 Ga0500616_0026669 3300053153 Bacteria 3196
437 Ga0500622_0004339 3300053156 Bacteria 8961
438 Ga0500622_0062020 3300053156 Bacteria 1905
439 Ga0500636_0072405 3300053177 Bacteria 1997
440 Ga0500637_0001378 3300053178 Bacteria 10321
441 Ga0500567_000864 3300053723 Bacteria 11500
442 Ga0500570_000114 3300053724 Bacteria 23229
443 Ga0500625_000001 3300053729 Bacteria 395993
444 Ga0500645_000002 3300053730 Bacteria 388892
445 Ga0500645_002885 3300053730 Bacteria 7355
446 Ga0500645_046518 3300053730 Bacteria 1273
447 Ga0500552_005812 3300053733 Bacteria 1359
448 Ga0500596_003355 3300053735 Bacteria 3057
449 Ga0501082_0090397 3300060353 Bacteria 2643
450 Ga0466962_0014941 3300061719 Bacteria 3742
451 Ga0466962_0055345 3300061719 Bacteria 1896
452 2512645114 2512564014 Bacteria 4639632
453 2513671048 2513237098 Bacteria 9902361
454 2513861538 2513237137 Bacteria 9558895
455 2513919779 2513237145 Bacteria 8979722
456 2517895210 2517572143 Bacteria 9484767
457 2524465938 2524023210 Bacteria 9029266
458 2524536337 2524023228 Bacteria 10118060
459 2585259764 2582581305 Bacteria 4895574
460 2600202834 2599185354 Bacteria 4398675
461 2600225506 2599185359 Bacteria 4772316
462 2643800819 2643221556 Bacteria 7251154
463 2644126031 2643221622 Bacteria 4212502
464 2644471049 2643221684 Bacteria 7145183
465 2728752173 2728368998 Bacteria 8720350
466 2739649002 2739367664 Bacteria 4114334
467 2740027475 2739367865 Bacteria 4114482
468 2793069160 2791355197 Bacteria 8420563
469 2819713943 2818991466 Bacteria 4748179
470 2837679896 2837678835 Bacteria 5252418
471 2861694122 2861691609 Bacteria 5628931
472 2885375645 2885374607 Bacteria 8927485
473 2885392354 2885383462 Bacteria 9473874
474 2903754282 2903748898 Bacteria 9972761
475 2903768803 2903768456 Bacteria 9749579
476 2904698272 2904690495 Bacteria 9412302
477 2904699950
478 2906611877
479 2906635850 2906635258 Bacteria 8601019
480 2906665441 2906660503 Bacteria 8595048
481 2908740600 2908739725 Bacteria 8628932
482 2908762872 2908756301 Bacteria 8864324
483 2919140089 2919138771 Bacteria 5281312
484 2922427421
485 2928528506 2928526807 Bacteria 4760224
486 2928970051 2928968154 Bacteria 4633371
487 2929201879 2929199973 Bacteria 7260745
488 2935637170 2935630451 Bacteria 8169952
489 2941513743 2941507105 Bacteria 8166816
490 2941521705 2941515067 Bacteria 8166720
491 2941529635 2941523033 Bacteria 8169134
492 3005477133 3005474847 Bacteria 9259049
493 8006938344 8006933436 Bacteria 10410654
494 8006978421 8006973647 Bacteria 10679141
495 8019560684 8019555841 Bacteria 9642137
496 8047677289 8047673197 Bacteria 7395230
497 8055910869 8055909800 Bacteria 7278581
498 8056691524 8056689827 Bacteria 6712655
499 Ga0496123_0001967
500 JGI24741J21665_1002303
501 JGI24740J21852_10003974
502 JGI24737J22298_10016381
503 JGI24749J21850_1001461
504 JGI24751J29686_10000357
505 JGI25153J46596_10013111
506 rootH1_10130120
507 rootH2_10014115
508 rootH1_10283578
509 Ga0055525_1000186
510 Ga0055526_1033145
511 Ga0055537_1001019
512 Ga0055537_1006876
513 Ga0055524_1000539
514 Ga0055536_1009630
515 Ga0055530_10003402
516 Ga0055530_10007609
517 Ga0055540_1006750
518 Ga0055531_10003730
519 Ga0055531_10004059
520 Ga0055543_1011995
521 Ga0065165_1003679
522 Ga0065165_1005379
523 Ga0065165_1037227
524 Ga0065707_10093872
525 Ga0070670_100000178
526 Ga0070660_100102256
527 Ga0070661_100143793
528 Ga0070669_100000119
529 Ga0070675_100242562
530 Ga0070674_100024610
531 Ga0070674_100106425
532 Ga0070673_100184294
533 Ga0070667_100000088
534 Ga0070667_100000407
535 Ga0070667_100202315
536 Ga0070678_100017439
537 Ga0070662_100185244
538 Ga0068853_100023854
539 Ga0070665_100000323
540 Ga0070664_100028482
541 Ga0068857_100347931
542 Ga0068859_100008045
543 Ga0068864_100000183
544 Ga0068861_100000001
545 Ga0068861_100001052
546 Ga0068851_10053336
547 Ga0068858_100000327
548 Ga0068860_100000055
549 Ga0068860_100000220
550 Ga0068862_100000011
551 Ga0068862_100010652
552 Ga0081540_1066166
553 Ga0081539_10011418
554 Ga0075368_10000016
555 Ga0075364_10000807
556 Ga0070712_100145779
557 Ga0075367_10000154
558 Ga0075369_10003090
559 Ga0075366_10023439
560 Ga0075370_10011024
561 Ga0097620_100008045
562 Ga0099822_1020871
563 Ga0105240_10617028
564 Ga0105247_10012729
565 Ga0105243_10000033
566 Ga0105243_10188381
567 Ga0105241_10001031
568 Ga0105248_10000685
569 Ga0105248_10000998
570 Ga0105248_10001758
571 Ga0105248_10002949
572 Ga0105248_10311368
573 Ga0105237_10472577
574 Ga0105239_10065247
575 Ga0105239_10259055
576 Ga0157326_1002414
577 Ga0157371_10000059
578 Ga0157370_10105124
579 Ga0157374_10184987
580 Ga0157378_10045746
581 Ga0163162_10013938
582 Ga0157372_10191971
583 Ga0163163_10011516
584 Ga0157380_10000087
585 Ga0163161_10030181
586 Ga0163161_10052945
587 Ga0213872_10000321
588 Ga0213872_10002552
589 Ga0213872_10036518
590 Ga0213876_10001077
591 Ga0209674_108949
592 Ga0209563_100145
593 Ga0209646_1002642
594 Ga0209565_1000008
595 Ga0209565_1000134
596 Ga0209673_1001779
597 Ga0209673_1007209
598 Ga0209675_1005513
599 Ga0209676_1003684
600 Ga0209564_1000622
601 Ga0209758_1000001
602 Ga0209758_1038954
603 Ga0209050_1000001
604 Ga0209050_1000581
605 Ga0209050_1012997
606 Ga0209050_1016987
607 Ga0209050_1017353
608 Ga0209256_1000009
609 Ga0209256_1000010
610 Ga0209051_1000191
611 Ga0209257_1000577
612 Ga0209257_1000597
613 Ga0209257_1000876
614 Ga0209257_1005749
615 Ga0209257_1015960
616 Ga0209257_1019098
617 Ga0207656_10002881
618 Ga0207705_10000203
619 Ga0207654_10000897
620 Ga0207671_10058290
621 Ga0207693_10080522
622 Ga0207657_10096223
623 Ga0207681_10000001
624 Ga0207650_10000050
625 Ga0207659_10031315
626 Ga0207706_10051503
627 Ga0207709_10000059
628 Ga0207709_10181554
629 Ga0207669_10000341
630 Ga0207669_10105521
631 Ga0207711_10000662
632 Ga0207711_10000852
633 Ga0207711_10004113
634 Ga0207711_10016633
635 Ga0207711_10285677
636 Ga0207679_10060401
637 Ga0207667_10000002
638 Ga0207668_10074535
639 Ga0207640_10000799
640 Ga0207658_10000064
641 Ga0207658_10001936
642 Ga0207703_10000244
643 Ga0207639_10005826
644 Ga0207639_10010643
645 Ga0207702_10003062
646 Ga0207641_10403089
647 Ga0207676_10000004
648 Ga0207676_10003426
649 Ga0207674_10475189
650 Ga0207675_100000159
651 Ga0207683_10002724
652 Ga0207698_10011101
653 Ga0209589_1000007
654 Ga0209489_100008
655 Ga0209700_100009
656 Ga0209813_10000014
657 Ga0268266_10000002
658 Ga0268266_10088054
659 Ga0268265_10000002
660 Ga0268265_10005540
661 Ga0268264_10000035
662 Ga0268264_10000112
663 Ga0268264_10000384
664 Ga0307517_10024293
665 Ga0307517_10024453
666 Ga0307509_10184800
667 Ga0307408_100061064
668 Ga0307508_10000114
669 Ga0307514_10153227
670 Ga0307516_10045233
671 Ga0307516_10083452
672 Ga0307405_10073578
673 Ga0307413_10044048
674 Ga0307413_10111086
675 Ga0307410_10010880
676 Ga0307410_10051603
677 Ga0307410_10162999
678 Ga0307407_10003482
679 Ga0307412_10016403
680 Ga0307412_10066138
681 Ga0307409_100035606
682 Ga0307409_100060415
683 Ga0307409_100224891
684 Ga0307409_100270990
685 Ga0307416_100029785
686 Ga0307416_100234678
687 Ga0307414_10016784
688 Ga0307414_10244851
689 Ga0307411_10004666
690 Ga0307415_100033228
691 Ga0307415_100493194
692 Ga0307507_10020656
693 Ga0307510_10038576
694 Ga0307510_10045195
695 Ga0373927_0015379
696 Ga0373927_0043498
697 Ga0373947_0156097
698 Ga0395899_0034460
699 Ga0395899_0105526
700 Ga0395899_0157624
701 Ga0395899_0253187
702 Ga0395899_0280228
703 Ga0395900_0002029
704 Ga0395900_0201500
705 Ga0395900_0206130
706 Ga0395905_0000365
707 Ga0395905_0411564
708 Ga0395901_0000898
709 Ga0395901_0111905
710 Ga0395901_0251611
711 Ga0400483_105072
712 Ga0436365_1117045
713 Ga0436361_0118740
714 Ga0436361_0422717
715 Ga0436361_0567500
716 Ga0436361_0684862
717 Ga0436361_0800986
718 Ga0436361_0986572
719 Ga0436361_0991627
720 Ga0436361_1110176
721 Ga0439436_0014239
722 Ga0439461_0002997
723 Ga0439465_0008796
724 Ga0439431_0001353
725 Ga0439431_0020543
726 Ga0439445_0028786
727 Ga0439448_0046189
728 Ga0439432_013213
729 Ga0439455_0001522
730 Ga0439462_0016380
731 Ga0439446_0010759
732 Ga0450909_003791
733 Ga0439434_0001561
734 Ga0466969_0017985
735 Ga0466972_0000466
736 Ga0466972_0029370
737 Ga0466965_0012486
738 Ga0466965_0036275
739 Ga0466966_0011486
740 Ga0466966_0014692
741 Ga0466966_0045368
742 Ga0466961_0027986
743 Ga0466961_0033773
744 Ga0466968_0002809
745 Ga0466968_0034456
746 Ga0466970_0091423
747 Ga0466957_0002374
748 Ga0466957_0044507
749 Ga0466959_0003025
750 Ga0466959_0062594
751 Ga0466959_0191634
752 Ga0466959_0193771
753 Ga0466958_0046743
754 Ga0466967_0040917
755 Ga0495650_0000440
756 Ga0495605_0000555
757 Ga0495605_0018642
758 Ga0495664_0223013
759 Ga0495584_0001058
760 Ga0495584_0025293
761 Ga0495585_0079473
762 Ga0495594_0126095
763 Ga0495607_0000317
764 Ga0495607_0001250
765 Ga0495607_0113130
766 Ga0495583_0000212
767 Ga0495583_0033420
768 Ga0495583_0074301
769 Ga0495583_0083066
770 Ga0495606_0007068
771 Ga0495606_0009337
772 Ga0495616_0014271
773 Ga0495616_0014626
774 Ga0495631_0041989
775 Ga0495637_0010987
776 Ga0495643_0003463
777 Ga0495643_0018864
778 Ga0495643_0073096
779 Ga0495648_0000459
780 Ga0495648_0026583
781 Ga0495648_0043060
782 Ga0495648_0157980
783 Ga0495663_0003362
784 Ga0495642_0000210
785 Ga0495642_0009054
786 Ga0495654_0052374
787 Ga0495609_0000009
788 Ga0495609_0013033
789 Ga0495609_0097092
790 Ga0495622_0012589
791 Ga0495622_0082176
792 Ga0495633_0000391
793 Ga0495656_0009580
794 Ga0495656_0064526
795 Ga0495668_0172145
796 Ga0495611_0039751
797 Ga0495625_0000106
798 Ga0495625_0020905
799 Ga0495625_0034464
800 Ga0495625_0042326
801 Ga0495625_0202671
802 Ga0495661_0000113
803 Ga0495661_0004134
804 Ga0495661_0014294
805 Ga0495661_0033369
806 Ga0495661_0082032
807 Ga0495661_0137855
808 Ga0495588_0000118
809 Ga0495669_0000148
810 Ga0495670_0000002
811 Ga0495649_0072392
812 Ga0495649_0084774
813 Ga0495589_0000037
814 Ga0495589_0028378
815 Ga0495600_0028612
816 Ga0495660_0000050
817 Ga0495660_0039347
818 Ga0495672_0152649
819 Ga0495683_0006914
820 Ga0495687_000068
821 Ga0495687_000097
822 Ga0495687_000168
823 Ga0495687_000563
824 Ga0495687_000654
825 Ga0495687_010878
826 Ga0495677_0000011
827 Ga0495677_0000251
828 Ga0495677_0002971
829 Ga0495677_0020710
830 Ga0495673_0025860
831 Ga0495686_0000619
832 Ga0495686_0016175
833 Ga0495686_0086220
834 Ga0495626_0000081
835 Ga0495626_0000772
836 Ga0495626_0086632
837 Ga0496102_0002779
838 Ga0496102_0089177
839 Ga0496103_0001865
840 Ga0496106_0011029
841 Ga0496106_0034658
842 Ga0496109_0112418
843 Ga0496110_0026296
844 Ga0496111_0116116
845 Ga0496111_0263170
846 Ga0496115_0000269
847 Ga0496115_0001129
848 Ga0496116_0033048
849 Ga0496117_0000887
850 Ga0496117_0013570
851 Ga0496118_0005843
852 Ga0496118_0009618
853 Ga0496118_0029534
854 Ga0496118_0241159
855 Ga0496119_0019694
856 Ga0496120_0026787
857 Ga0496121_0000009
858 Ga0496121_0004850
859 Ga0496121_0040867
860 Ga0496121_0354025
861 Ga0496122_0002487
862 Ga0496122_0047324
863 Ga0496122_0073375
864 Ga0496123_0001567
865 Ga0496123_0058045
866 Ga0496123_0182997
867 Ga0496124_0000874
868 Ga0496124_0000960
869 Ga0496124_0005202
870 Ga0496124_0006631
871 Ga0496124_0012507
872 Ga0496124_0045594
873 Ga0496124_0196942
874 Ga0496125_0000956
875 Ga0496125_0109050
876 Ga0496125_0168675
877 Ga0496126_0000321
878 Ga0496126_0124692
879 Ga0495682_0025992
880 Ga0501032_0000174
881 Ga0501032_0205700
882 Ga0501033_0012210
883 Ga0501034_0001672
884 Ga0501034_0023822
885 Ga0501036_0010134
886 Ga0501036_0154588
887 Ga0501037_0171244
888 Ga0501038_0000906
889 Ga0501039_0019301
890 Ga0501043_0030136
891 Ga0501046_0002375
892 Ga0501046_0069743
893 Ga0501047_0001336
894 Ga0501047_0193738
895 Ga0501048_0309996
896 Ga0501067_0090640
897 Ga0501068_0012788
898 Ga0501069_0136628
899 Ga0501072_0302978
900 Ga0501073_0043700
901 Ga0501080_0002399
902 Ga0501241_013729
903 Ga0501044_0042146
904 Ga0501044_0193935
905 nmdc:mga0k408_61488_c1
906 nmdc:mga0k408_98499_c1
907 nmdc:mga06z11_47_c1
908 nmdc:mga04h51_18_c1
909 nmdc:mga07m45_1071_c1
910 Ga0500610_0000607
911 Ga0500635_0020061
912 Ga0500643_001242
913 Ga0500643_046710
914 Ga0500651_0022471
915 Ga0500566_0006685
916 Ga0500555_000216
917 Ga0500562_003564
918 Ga0500595_001506
919 Ga0500607_000036
920 Ga0500607_004589
921 Ga0500608_000197
922 Ga0500642_0004805
923 Ga0500655_000422
924 Ga0500559_0000751
925 Ga0500559_0004177
926 Ga0500559_0011691
927 Ga0500559_0059915
928 Ga0500564_011201
929 Ga0500573_0000086
930 Ga0500573_0008076
931 Ga0500573_0078953
932 Ga0500590_008524
933 Ga0500590_082605
934 Ga0500616_0026669
935 Ga0500622_0004339
936 Ga0500622_0062020
937 Ga0500636_0072405
938 Ga0500637_0001378
939 Ga0500567_000864
940 Ga0500570_000114
941 Ga0500625_000001
942 Ga0500645_000002
943 Ga0500645_002885
944 Ga0500645_046518
945 Ga0500552_005812
946 Ga0500596_003355
947 Ga0501082_0090397
948 Ga0466962_0014941
949 Ga0466962_0055345
950 2512645114
951 2513671048
952 2513861538
953 2513919779
954 2517895210
955 2524465938
956 2524536337
957 2585259764
958 2600202834
959 2600225506
960 2643800819
961 2644126031
962 2644471049
963 2728752173
964 2739649002
965 2740027475
966 2793069160
967 2819713943
968 2837679896
969 2861694122
970 2885375645
971 2885392354
972 2903754282
973 2903768803
974 2904698272
975 2904699950
976 2906611877
977 2906635850
978 2906665441
979 2908740600
980 2908762872
981 2919140089
982 2922427421
983 2928528506
984 2928970051
985 2929201879
986 2935637170
987 2941513743
988 2941521705
989 2941529635
990 3005477133
991 8006938344
992 8006978421
993 8019560684
994 8047677289
995 8055910869
996 8056691524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

33

114

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

192

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

223

0.81

PF07993

NAD_binding_4

Male sterility protein

46

185

0.79

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

182

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

212

0.73

PF13460

NAD_binding_10

NAD(P)H-binding

7

213

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yrb-assembly3.cif.gz_F mouse tdh mutant r180k with nad+ bound 0.8527 2 225
4yrb-assembly1.cif.gz_A mouse tdh mutant r180k with nad+ bound 0.8412 2 226
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.8217 2 298
1kj9-assembly1.cif.gz_B crystal structure of purt-encoded glycinamide ribonucleotide transformylase complexed with mg-atp 0.82 1 66
4yrb-assembly1.cif.gz_B mouse tdh mutant r180k with nad+ bound 0.8105 2 236
ID Description Score Start End Superfamily
af_Q6MWX3_36_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9457 1 300 3.40.50.720
af_Q6MWX3_36_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 1 300 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8721 1 225 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8708 1 225 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8679 1 225 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A527ZEG2-F1-model_v4 NAD(P)-dependent oxidoreductase 1.001 1 94
AF-A0A4Q3J4J0-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9975 64 314
AF-A0A443GX30-F1-model_v4 deleted 0.9955 1 112
AF-A0A1R3VMN7-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9946 1 100
AF-A0A1L9QL27-F1-model_v4 NAD-dependent epimerase/dehydratase 0.99 2 314

Map