F455276

General Info

Members Datasets Scaffolds Average Seq Length
498 300 996 350

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0040199|Ga0501041_0040199_1447_2613
Length 388
Sequence LNSESISRIAKSRGCVHPAAAGIEDKQRRRRLMATTYKILILGASYGSLLATKLLFAGHTLKLVCLPAEAELINKEGARVRLPVKGREGLVEIDTRKLPGKLSADGPGAVNPADYDLIALAMMEPQYRSAGVRELMDAIARAKVPCMSIMNMPPLTYLKRIRGLNTDACRGAYTDPSVWDGFDPRLMTLCSPDPQAFRPPDEKVNVLQVRLATNFKAARFESEAHTAILRRLEADIEAVRFDTGSGKIELPVKLKVHDSIFVPLAKWPMLIAGNYRCVQKDGMRSIKDAVHSNLEASRSVYDWVVKLCVSLGAAEKDLVPFEKYANAALSLGSPSSAARALFGGAPNIERVDRLVKAIAAQKGMRSDVVDETVALVDARLEANRKKAA

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
297 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 1.41
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0040199 3300049577 Bacteria 2838
2 MBSR1b_contig_3467282 2162886012 Bacteria 1520
3 Ga0065707_10213590 3300005295 Bacteria 1255
4 Ga0070676_10024851 3300005328 Bacteria 3380
5 Ga0070683_100019858 3300005329 Bacteria 5973
6 Ga0070683_100230770 3300005329 Bacteria 1760
7 Ga0070690_100061882 3300005330 Bacteria 2412
8 Ga0070670_100027589 3300005331 Bacteria 4884
9 Ga0070670_100033992 3300005331 Bacteria 4389
10 Ga0070670_100050283 3300005331 Bacteria 3582
11 Ga0068869_100000160 3300005334 Bacteria 33574
12 Ga0068869_100145861 3300005334 Bacteria 1832
13 Ga0070666_10110978 3300005335 Bacteria 1896
14 Ga0070666_10216737 3300005335 Bacteria 1349
15 Ga0070680_100119054 3300005336 Bacteria 2203
16 Ga0068868_100014921 3300005338 Bacteria 5736
17 Ga0068868_100113707 3300005338 Bacteria 2201
18 Ga0070660_100016015 3300005339 Bacteria 5431
19 Ga0070689_100072365 3300005340 Bacteria 2694
20 Ga0070687_100004543 3300005343 Bacteria 5544
21 Ga0070661_100000620 3300005344 Bacteria 26406
22 Ga0070669_100011878 3300005353 Bacteria 6179
23 Ga0070669_100031053 3300005353 Bacteria 3857
24 Ga0070669_100083135 3300005353 Bacteria 2387
25 Ga0070675_100029112 3300005354 Bacteria 4451
26 Ga0070675_100060594 3300005354 Bacteria 3124
27 Ga0070675_100065732 3300005354 Bacteria 2999
28 Ga0070675_100115292 3300005354 Bacteria 2277
29 Ga0070675_100209625 3300005354 Bacteria 1693
30 Ga0070671_100044932 3300005355 Bacteria 3671
31 Ga0070673_100048813 3300005364 Bacteria 3302
32 Ga0070673_100060663 3300005364 Bacteria 2998
33 Ga0070688_100018714 3300005365 Bacteria 4002
34 Ga0070688_100161747 3300005365 Bacteria 1539
35 Ga0070659_100102397 3300005366 Bacteria 2305
36 Ga0070667_100015642 3300005367 Bacteria 6273
37 Ga0070667_100260164 3300005367 Bacteria 1553
38 Ga0070709_10012776 3300005434 Bacteria 4706
39 Ga0070714_100002858 3300005435 Bacteria 12764
40 Ga0070714_100066309 3300005435 Bacteria 3111
41 Ga0070713_100002510 3300005436 Bacteria 11999
42 Ga0070710_10022267 3300005437 Bacteria 3312
43 Ga0070701_10040097 3300005438 Bacteria 2379
44 Ga0070705_100104155 3300005440 Bacteria 1798
45 Ga0070700_100045274 3300005441 Bacteria 2714
46 Ga0070694_100041782 3300005444 Bacteria 3060
47 Ga0070708_100103017 3300005445 Bacteria 2616
48 Ga0070681_10025486 3300005458 Bacteria 5949
49 Ga0070681_10026284 3300005458 Bacteria 5851
50 Ga0068867_100006924 3300005459 Bacteria 8025
51 Ga0068867_100007220 3300005459 Bacteria 7856
52 Ga0070685_10084102 3300005466 Bacteria 1913
53 Ga0070706_100126961 3300005467 Bacteria 2379
54 Ga0070707_100154860 3300005468 Bacteria 2232
55 Ga0070698_100019996 3300005471 Bacteria 7019
56 Ga0070684_100009360 3300005535 Bacteria 7712
57 Ga0070684_100032420 3300005535 Bacteria 4453
58 Ga0070697_100121823 3300005536 Bacteria 2182
59 Ga0068853_100026587 3300005539 Bacteria 4860
60 Ga0070672_100021376 3300005543 Bacteria 4733
61 Ga0070672_100093417 3300005543 Bacteria 2430
62 Ga0070686_100038807 3300005544 Bacteria 2963
63 Ga0070695_100051247 3300005545 Bacteria 2648
64 Ga0070696_100000665 3300005546 Bacteria 22042
65 Ga0070696_100090148 3300005546 Bacteria 2181
66 Ga0070693_100013949 3300005547 Bacteria 4104
67 Ga0070665_100080002 3300005548 Bacteria 3273
68 Ga0070704_100002331 3300005549 Bacteria 10641
69 Ga0070704_100002392 3300005549 Bacteria 10532
70 Ga0070704_100005685 3300005549 Bacteria 7284
71 Ga0070704_100059794 3300005549 Bacteria 2720
72 Ga0070664_100037070 3300005564 Bacteria 4097
73 Ga0070664_100060500 3300005564 Bacteria 3225
74 Ga0070664_100083104 3300005564 Bacteria 2762
75 Ga0070664_100235648 3300005564 Bacteria 1642
76 Ga0068857_100003360 3300005577 Bacteria 13320
77 Ga0068857_100017599 3300005577 Bacteria 6266
78 Ga0068854_100001488 3300005578 Bacteria 14183
79 Ga0068854_100221530 3300005578 Bacteria 1497
80 Ga0068856_100019529 3300005614 Bacteria 6578
81 Ga0070702_100017930 3300005615 Bacteria 3662
82 Ga0070702_100056568 3300005615 Bacteria 2266
83 Ga0068859_100002394 3300005617 Bacteria 19095
84 Ga0068864_100000395 3300005618 Bacteria 37880
85 Ga0068864_100041019 3300005618 Bacteria 3959
86 Ga0068864_100104294 3300005618 Bacteria 2518
87 Ga0068864_100159062 3300005618 Bacteria 2052
88 Ga0068864_100351120 3300005618 Bacteria 1391
89 Ga0068866_10020734 3300005718 Bacteria 3017
90 Ga0068861_100003084 3300005719 Bacteria 11007
91 Ga0068861_100213841 3300005719 Bacteria 1625
92 Ga0068851_10055598 3300005834 Bacteria 2016
93 Ga0068870_10003450 3300005840 Bacteria 6698
94 Ga0068863_100005560 3300005841 Bacteria 12392
95 Ga0068863_100079538 3300005841 Bacteria 3104
96 Ga0068863_100083864 3300005841 Bacteria 3020
97 Ga0068863_100087535 3300005841 Bacteria 2951
98 Ga0068863_100100664 3300005841 Bacteria 2747
99 Ga0068858_100022939 3300005842 Bacteria 5821
100 Ga0068860_100015795 3300005843 Bacteria 7372
101 Ga0068860_100075949 3300005843 Bacteria 3195
102 Ga0068862_100096637 3300005844 Bacteria 2579
103 Ga0081455_10004832 3300005937 Bacteria 14960
104 Ga0081538_10001845 3300005981 Bacteria 21365
105 Ga0081538_10049794 3300005981 Bacteria 2538
106 Ga0075365_10162406 3300006038 Bacteria 1557
107 Ga0070715_10032185 3300006163 Bacteria 2134
108 Ga0075367_10134375 3300006178 Bacteria 1530
109 Ga0075369_10089691 3300006186 Bacteria 1371
110 Ga0075366_10025324 3300006195 Bacteria 3464
111 Ga0097621_100029643 3300006237 Bacteria 4324
112 Ga0097621_100083200 3300006237 Bacteria 2666
113 Ga0068871_100020011 3300006358 Bacteria 5120
114 Ga0068871_100049355 3300006358 Bacteria 3401
115 Ga0075428_100000638 3300006844 Bacteria 35958
116 Ga0075428_100049674 3300006844 Bacteria 4602
117 Ga0075428_100129532 3300006844 Bacteria 2745
118 Ga0075430_100021232 3300006846 Bacteria 5520
119 Ga0075430_100029137 3300006846 Bacteria 4686
120 Ga0075431_100000307 3300006847 Bacteria 38506
121 Ga0075431_100065250 3300006847 Bacteria 3759
122 Ga0075431_100093908 3300006847 Bacteria 3096
123 Ga0075431_100386998 3300006847 Bacteria 1402
124 Ga0075433_10062535 3300006852 Bacteria 3260
125 Ga0075433_10093495 3300006852 Bacteria 2660
126 Ga0075429_100011701 3300006880 Bacteria 7609
127 Ga0075429_100155755 3300006880 Bacteria 2001
128 Ga0068865_100001154 3300006881 Bacteria 15331
129 Ga0075436_100110908 3300006914 Bacteria 1915
130 Ga0097620_100002394 3300006931 Bacteria 19095
131 Ga0075435_100010857 3300007076 Bacteria 6670
132 Ga0075435_100129221 3300007076 Bacteria 2113
133 Ga0099794_10021420 3300007265 Bacteria 2937
134 Ga0099794_10077562 3300007265 Bacteria 1635
135 Ga0099795_10022112 3300007788 Bacteria 2095
136 Ga0105240_10000780 3300009093 Bacteria 57653
137 Ga0105240_10001181 3300009093 Bacteria 45705
138 Ga0111539_10004193 3300009094 Bacteria 18910
139 Ga0105245_10165719 3300009098 Bacteria 2100
140 Ga0114129_10186839 3300009147 Bacteria 2816
141 Ga0105243_10022371 3300009148 Bacteria 4804
142 Ga0105243_10100544 3300009148 Bacteria 2399
143 Ga0105243_10206130 3300009148 Bacteria 1728
144 Ga0105242_10001652 3300009176 Bacteria 17627
145 Ga0105242_10020100 3300009176 Bacteria 5233
146 Ga0105242_10020636 3300009176 Bacteria 5169
147 Ga0105242_10036038 3300009176 Bacteria 3967
148 Ga0105248_10002497 3300009177 Bacteria 20453
149 Ga0105248_10030740 3300009177 Bacteria 5999
150 Ga0105248_10047007 3300009177 Bacteria 4839
151 Ga0105248_10176321 3300009177 Bacteria 2409
152 Ga0105237_10012555 3300009545 Bacteria 8924
153 Ga0105238_10039131 3300009551 Bacteria 4810
154 Ga0105249_10155903 3300009553 Bacteria 2202
155 Ga0105249_10255269 3300009553 Bacteria 1740
156 Ga0105249_10521545 3300009553 Bacteria 1236
157 Ga0099796_10019895 3300010159 Bacteria 2042
158 Ga0105239_10032279 3300010375 Bacteria 5755
159 Ga0105246_10142919 3300011119 Bacteria 1802
160 Ga0157373_10031559 3300013100 Bacteria 3814
161 Ga0157373_10065965 3300013100 Bacteria 2561
162 Ga0157370_10014726 3300013104 Bacteria 7986
163 Ga0157369_10140409 3300013105 Bacteria 2557
164 Ga0157374_10084500 3300013296 Bacteria 3017
165 Ga0157378_10029647 3300013297 Bacteria 4832
166 Ga0157378_10047322 3300013297 Bacteria 3824
167 Ga0157378_10113521 3300013297 Bacteria 2487
168 Ga0163162_10198498 3300013306 Bacteria 2135
169 Ga0157372_10000854 3300013307 Bacteria 33050
170 Ga0157372_10409253 3300013307 Bacteria 1581
171 Ga0157375_10126126 3300013308 Bacteria 2675
172 Ga0157375_10349952 3300013308 Bacteria 1643
173 Ga0163163_10002115 3300014325 Bacteria 16762
174 Ga0163163_10345885 3300014325 Bacteria 1543
175 Ga0163163_10549662 3300014325 Bacteria 1217
176 Ga0157380_10093664 3300014326 Bacteria 2484
177 Ga0157380_10103126 3300014326 Bacteria 2380
178 Ga0157380_10198046 3300014326 Bacteria 1780
179 Ga0157380_10273328 3300014326 Bacteria 1542
180 Ga0157377_10135912 3300014745 Bacteria 1506
181 Ga0157379_10000271 3300014968 Bacteria 40851
182 Ga0157379_10123706 3300014968 Bacteria 2327
183 Ga0157379_10280751 3300014968 Bacteria 1515
184 Ga0157376_10298615 3300014969 Bacteria 1524
185 Ga0206356_11215269 3300020070 Bacteria 1263
186 Ga0213875_10000040 3300021388 Bacteria 156362
187 Ga0213875_10005885 3300021388 Bacteria 6516
188 Ga0213871_10040563 3300021441 Bacteria 1249
189 Ga0207666_1004719 3300025271 Bacteria 1719
190 Ga0207682_10003567 3300025893 Bacteria 6731
191 Ga0207692_10047048 3300025898 Bacteria 2165
192 Ga0207680_10064210 3300025903 Bacteria 2250
193 Ga0207685_10019450 3300025905 Bacteria 2239
194 Ga0207699_10009723 3300025906 Bacteria 4800
195 Ga0207645_10009698 3300025907 Bacteria 6651
196 Ga0207645_10166156 3300025907 Bacteria 1445
197 Ga0207643_10007625 3300025908 Bacteria 5816
198 Ga0207643_10010434 3300025908 Bacteria 5004
199 Ga0207707_10008295 3300025912 Bacteria 9015
200 Ga0207707_10077546 3300025912 Bacteria 2901
201 Ga0207695_10008281 3300025913 Bacteria 13042
202 Ga0207671_10027627 3300025914 Bacteria 4242
203 Ga0207660_10104852 3300025917 Bacteria 2117
204 Ga0207657_10002918 3300025919 Bacteria 18354
205 Ga0207649_10013764 3300025920 Bacteria 4522
206 Ga0207681_10155868 3300025923 Bacteria 1716
207 Ga0207694_10115496 3300025924 Bacteria 2138
208 Ga0207694_10227255 3300025924 Bacteria 1523
209 Ga0207650_10069764 3300025925 Bacteria 2641
210 Ga0207659_10087782 3300025926 Bacteria 2316
211 Ga0207659_10089485 3300025926 Bacteria 2296
212 Ga0207687_10045993 3300025927 Bacteria 3019
213 Ga0207700_10000183 3300025928 Bacteria 37732
214 Ga0207700_10091169 3300025928 Bacteria 2407
215 Ga0207664_10003432 3300025929 Bacteria 10565
216 Ga0207664_10031758 3300025929 Bacteria 4042
217 Ga0207644_10029749 3300025931 Bacteria 3791
218 Ga0207644_10169447 3300025931 Bacteria 1703
219 Ga0207706_10014132 3300025933 Bacteria 7238
220 Ga0207706_10117659 3300025933 Bacteria 2337
221 Ga0207706_10141215 3300025933 Bacteria 2119
222 Ga0207686_10018281 3300025934 Bacteria 3967
223 Ga0207686_10134323 3300025934 Bacteria 1701
224 Ga0207709_10023739 3300025935 Bacteria 3493
225 Ga0207670_10074064 3300025936 Bacteria 2363
226 Ga0207670_10208982 3300025936 Bacteria 1487
227 Ga0207669_10112900 3300025937 Bacteria 1826
228 Ga0207704_10002332 3300025938 Bacteria 8528
229 Ga0207704_10086822 3300025938 Bacteria 2042
230 Ga0207665_10089010 3300025939 Bacteria 2137
231 Ga0207691_10052989 3300025940 Bacteria 3705
232 Ga0207691_10058790 3300025940 Bacteria 3496
233 Ga0207691_10087427 3300025940 Bacteria 2796
234 Ga0207691_10225028 3300025940 Bacteria 1626
235 Ga0207711_10143421 3300025941 Bacteria 2150
236 Ga0207711_10374443 3300025941 Bacteria 1321
237 Ga0207689_10000028 3300025942 Bacteria 100652
238 Ga0207689_10005226 3300025942 Bacteria 11645
239 Ga0207689_10104579 3300025942 Bacteria 2326
240 Ga0207661_10016498 3300025944 Bacteria 5450
241 Ga0207661_10073400 3300025944 Bacteria 2802
242 Ga0207661_10204886 3300025944 Bacteria 1736
243 Ga0207679_10021618 3300025945 Bacteria 4366
244 Ga0207679_10178582 3300025945 Bacteria 1754
245 Ga0207679_10221061 3300025945 Bacteria 1593
246 Ga0207667_10025128 3300025949 Bacteria 6526
247 Ga0207667_10460832 3300025949 Bacteria 1291
248 Ga0207651_10352229 3300025960 Bacteria 1240
249 Ga0207712_10093856 3300025961 Bacteria 2215
250 Ga0207668_10034187 3300025972 Bacteria 3374
251 Ga0207640_10004727 3300025981 Bacteria 7397
252 Ga0207658_10108881 3300025986 Bacteria 2186
253 Ga0207677_10027767 3300026023 Bacteria 3571
254 Ga0207703_10002194 3300026035 Bacteria 17130
255 Ga0207703_10009843 3300026035 Bacteria 7499
256 Ga0207703_10303139 3300026035 Bacteria 1458
257 Ga0207639_10057461 3300026041 Bacteria 2987
258 Ga0207708_10240464 3300026075 Bacteria 1456
259 Ga0207708_10283093 3300026075 Bacteria 1344
260 Ga0207702_10002279 3300026078 Bacteria 18408
261 Ga0207641_10074726 3300026088 Bacteria 2924
262 Ga0207641_10116983 3300026088 Bacteria 2373
263 Ga0207641_10154440 3300026088 Bacteria 2081
264 Ga0207648_10001620 3300026089 Bacteria 24687
265 Ga0207648_10024004 3300026089 Bacteria 5450
266 Ga0207648_10094046 3300026089 Bacteria 2621
267 Ga0207648_10116949 3300026089 Bacteria 2343
268 Ga0207676_10005681 3300026095 Bacteria 8826
269 Ga0207676_10006221 3300026095 Bacteria 8429
270 Ga0207676_10062858 3300026095 Bacteria 2946
271 Ga0207676_10173982 3300026095 Bacteria 1878
272 Ga0207676_10277507 3300026095 Bacteria 1520
273 Ga0207674_10000022 3300026116 Bacteria 161298
274 Ga0207674_10105321 3300026116 Bacteria 2799
275 Ga0207674_10235329 3300026116 Bacteria 1779
276 Ga0207675_100001456 3300026118 Bacteria 23727
277 Ga0207675_100007847 3300026118 Bacteria 10070
278 Ga0207683_10007883 3300026121 Bacteria 9109
279 Ga0207683_10014757 3300026121 Bacteria 6650
280 Ga0207698_10012587 3300026142 Bacteria 5543
281 Ga0207698_10199550 3300026142 Bacteria 1790
282 Ga0209967_1000767 3300027364 Bacteria 4109
283 Ga0209981_1000591 3300027378 Bacteria 4574
284 Ga0209996_1003604 3300027395 Bacteria 1953
285 Ga0210000_1000081 3300027462 Bacteria 13652
286 Ga0209995_1000402 3300027471 Bacteria 6745
287 Ga0209968_1000708 3300027526 Bacteria 5129
288 Ga0209999_1000253 3300027543 Bacteria 7734
289 Ga0209974_10010773 3300027876 Bacteria 3081
290 Ga0209974_10013906 3300027876 Bacteria 2681
291 Ga0268265_10299631 3300028380 Bacteria 1447
292 Ga0268264_10001919 3300028381 Bacteria 18762
293 Ga0268264_10053353 3300028381 Bacteria 3372
294 Ga0265318_10002144 3300028577 Bacteria 10723
295 Ga0265338_10117676 3300028800 Bacteria 2126
296 Ga0307511_10000065 3300030521 Bacteria 88859
297 Ga0265330_10002013 3300031235 Bacteria 11281
298 Ga0265332_10000199 3300031238 Bacteria 48650
299 Ga0265332_10015971 3300031238 Bacteria 3313
300 Ga0265325_10022307 3300031241 Bacteria 3470
301 Ga0265329_10000991 3300031242 Bacteria 14171
302 Ga0265339_10140691 3300031249 Bacteria 1228
303 Ga0265331_10001027 3300031250 Bacteria 21785
304 Ga0265331_10009792 3300031250 Bacteria 5345
305 Ga0265327_10003598 3300031251 Bacteria 14622
306 Ga0265316_10010249 3300031344 Bacteria 8554
307 Ga0265316_10019983 3300031344 Bacteria 5713
308 Ga0316575_10012610 3300031665 Bacteria 3147
309 Ga0265314_10012115 3300031711 Bacteria 7063
310 Ga0265342_10006173 3300031712 Bacteria 8962
311 Ga0316578_10016899 3300031728 Unclassified 3959
312 Ga0373926_0012145 3300035083 Bacteria 2909
313 Ga0373934_0018143 3300035086 Bacteria 2691
314 Ga0373923_0065631 3300035111 Bacteria 1550
315 Ga0373936_0008966 3300035113 Bacteria 3771
316 Ga0373936_0073665 3300035113 Bacteria 1412
317 Ga0373953_0006425 3300035117 Bacteria 3871
318 Ga0373954_0002637 3300035118 Bacteria 7547
319 Ga0373954_0006094 3300035118 Bacteria 5247
320 Ga0373954_0009416 3300035118 Bacteria 4296
321 Ga0373954_0012647 3300035118 Bacteria 3755
322 Ga0373956_0000018 3300035119 Bacteria 50671
323 Ga0373957_0007711 3300035120 Bacteria 3455
324 Ga0373957_0069024 3300035120 Bacteria 1380
325 Ga0373946_0012569 3300035171 Bacteria 3171
326 Ga0373955_0001648 3300035172 Bacteria 9553
327 Ga0373955_0002161 3300035172 Bacteria 8506
328 Ga0373955_0007644 3300035172 Bacteria 4980
329 Ga0316574_0037874 3300035398 Bacteria 2959
330 Ga0373924_0001847 3300035410 Bacteria 7006
331 Ga0373935_0098001 3300035692 Bacteria 1929
332 Ga0373933_0000035 3300035724 Bacteria 82702
333 Ga0373933_0000832 3300035724 Bacteria 18866
334 Ga0373947_0191392 3300035725 Bacteria 1335
335 Ga0373937_0001048 3300036401 Bacteria 23373
336 Ga0373937_0002135 3300036401 Bacteria 16540
337 Ga0373937_0024477 3300036401 Bacteria 5446
338 Ga0373937_0377429 3300036401 Bacteria 1344
339 Ga0316582_0152006 3300036647 Bacteria 1565
340 Ga0395905_0411355 3300037471 Bacteria 1248
341 Ga0436364_0374996 3300037853 Bacteria 6606
342 Ga0436364_0576120 3300037853 Bacteria 27783
343 Ga0436364_1209713 3300037853 Bacteria 1066
344 Ga0400483_146919 3300039062 Bacteria 2567
345 Ga0400483_211488 3300039062 Bacteria 1356
346 Ga0436365_0017926 3300039437 Bacteria 5872
347 Ga0436362_0682656 3300039453 Bacteria 1902
348 Ga0439464_0001416 3300042439 Bacteria 5637
349 Ga0439460_0061955 3300042461 Bacteria 1143
350 Ga0451576_0095780 3300045051 Bacteria 3087
351 Ga0495592_0001428 3300046454 Bacteria 16575
352 Ga0495629_0003053 3300046459 Bacteria 12729
353 Ga0495629_0165636 3300046459 Bacteria 1535
354 Ga0495641_0034875 3300046461 Bacteria 2375
355 Ga0495651_0000350 3300046462 Bacteria 35585
356 Ga0495651_0000476 3300046462 Bacteria 30843
357 Ga0495651_0006469 3300046462 Bacteria 8958
358 Ga0495653_0000900 3300046463 Bacteria 23000
359 Ga0495653_0007068 3300046463 Bacteria 9210
360 Ga0495580_0229960 3300046472 Bacteria 1273
361 Ga0495582_0017891 3300046473 Bacteria 3874
362 Ga0495639_0003619 3300046475 Bacteria 6661
363 Ga0495662_0015857 3300046476 Bacteria 3657
364 Ga0495664_0000685 3300046477 Bacteria 17239
365 Ga0495608_0005364 3300046511 Bacteria 9158
366 Ga0495608_0006821 3300046511 Bacteria 8096
367 Ga0495618_0101518 3300046514 Bacteria 1841
368 Ga0495620_0057021 3300046515 Bacteria 1641
369 Ga0495628_0001118 3300046516 Bacteria 24530
370 Ga0495628_0013837 3300046516 Bacteria 6779
371 Ga0495628_0013977 3300046516 Bacteria 6739
372 Ga0495652_0000469 3300046529 Bacteria 47242
373 Ga0495652_0002547 3300046529 Bacteria 18683
374 Ga0495640_0003500 3300046533 Bacteria 12633
375 Ga0495586_0001410 3300046535 Bacteria 13299
376 Ga0495587_0016992 3300046536 Bacteria 4523
377 Ga0495645_0000044 3300046543 Bacteria 90950
378 Ga0495667_0000641 3300046559 Bacteria 22253
379 Ga0495667_0053997 3300046559 Bacteria 2645
380 Ga0495667_0110917 3300046559 Bacteria 1772
381 Ga0495634_0006920 3300046642 Bacteria 8571
382 Ga0495635_0002907 3300046663 Bacteria 11768
383 Ga0495635_0053722 3300046663 Bacteria 2775
384 Ga0495657_0014595 3300046675 Bacteria 5764
385 Ga0495599_0000684 3300046678 Bacteria 19253
386 Ga0495599_0001448 3300046678 Bacteria 13611
387 Ga0495599_0061940 3300046678 Bacteria 2337
388 Ga0495599_0071417 3300046678 Bacteria 2167
389 Ga0495623_0011647 3300046679 Bacteria 5697
390 Ga0495646_0078021 3300046680 Bacteria 1936
391 Ga0495658_0003277 3300046683 Bacteria 8044
392 Ga0495658_0020147 3300046683 Bacteria 3495
393 Ga0495658_0189520 3300046683 Bacteria 1278
394 Ga0495669_0082810 3300046684 Bacteria 1474
395 Ga0495613_0028133 3300046689 Bacteria 4182
396 Ga0495613_0042051 3300046689 Bacteria 3382
397 Ga0495624_0011667 3300046690 Bacteria 6035
398 Ga0495600_0011543 3300046809 Bacteria 5508
399 Ga0495600_0047265 3300046809 Bacteria 2807
400 Ga0495674_0005934 3300047319 Bacteria 11722
401 Ga0495674_0008528 3300047319 Bacteria 9755
402 Ga0495672_0057821 3300047320 Bacteria 2251
403 Ga0495680_0000363 3300047322 Bacteria 50862
404 Ga0495675_0006056 3300047444 Bacteria 7403
405 Ga0495684_0066523 3300047471 Bacteria 2740
406 Ga0495684_0073224 3300047471 Bacteria 2602
407 Ga0495593_0011918 3300047673 Bacteria 4986
408 Ga0496102_0317651 3300048905 Bacteria 1467
409 Ga0496104_0217789 3300048907 Bacteria 1821
410 Ga0496108_0419873 3300048911 Bacteria 1168
411 Ga0496109_0257933 3300048912 Bacteria 1642
412 Ga0496111_0125358 3300048914 Bacteria 1898
413 Ga0496112_0210440 3300048915 Bacteria 1902
414 Ga0496115_0065497 3300048918 Bacteria 2935
415 Ga0501031_0252125 3300049568 Bacteria 1147
416 Ga0501032_0098516 3300049569 Unclassified 1937
417 Ga0501033_0097677 3300049570 Unclassified 2145
418 Ga0501034_0064295 3300049571 Bacteria 3683
419 Ga0501034_0159847 3300049571 Unclassified 2225
420 Ga0501036_0105458 3300049572 Bacteria 2384
421 Ga0501036_0206462 3300049572 Bacteria 1651
422 Ga0501039_0119358 3300049575 Bacteria 2066
423 Ga0501040_0013684 3300049576 Bacteria 5336
424 Ga0501041_0005857 3300049577 Bacteria 7186
425 Ga0501042_0002819 3300049578 Bacteria 10768
426 Ga0501043_0061705 3300049579 Unclassified 2943
427 Ga0501046_0066745 3300049580 Unclassified 2803
428 Ga0501046_0071356 3300049580 Bacteria 2699
429 Ga0501046_0183786 3300049580 Bacteria 1562
430 Ga0501047_0005005 3300049581 Bacteria 12437
431 Ga0501048_0042882 3300049582 Bacteria 3239
432 Ga0501048_0091849 3300049582 Bacteria 2141
433 Ga0501048_0154482 3300049582 Bacteria 1623
434 Ga0501068_0017092 3300049584 Bacteria 4192
435 Ga0501069_0131941 3300049585 Bacteria 1431
436 Ga0501070_0080799 3300049586 Bacteria 2689
437 Ga0501070_0275788 3300049586 Bacteria 1372
438 Ga0501071_0020981 3300049587 Bacteria 4547
439 Ga0501071_0046908 3300049587 Bacteria 3103
440 Ga0501071_0193166 3300049587 Bacteria 1527
441 Ga0501072_0002669 3300049588 Bacteria 13374
442 Ga0501072_0011738 3300049588 Bacteria 6694
443 Ga0501072_0109024 3300049588 Bacteria 2203
444 Ga0501072_0114894 3300049588 Bacteria 2143
445 Ga0501072_0255964 3300049588 Bacteria 1394
446 Ga0501075_0034527 3300049591 Bacteria 3766
447 Ga0501075_0065321 3300049591 Bacteria 2745
448 Ga0501075_0132970 3300049591 Bacteria 1895
449 Ga0501076_0003456 3300049592 Bacteria 11084
450 Ga0501076_0114587 3300049592 Bacteria 2181
451 Ga0501077_0028017 3300049593 Bacteria 3580
452 Ga0501077_0058600 3300049593 Bacteria 2445
453 Ga0501077_0059055 3300049593 Bacteria 2435
454 Ga0501079_0000323 3300049741 Bacteria 30084
455 Ga0501079_0071414 3300049741 Bacteria 2682
456 Ga0501079_0180111 3300049741 Bacteria 1649
457 Ga0501079_0310683 3300049741 Bacteria 1233
458 Ga0501080_0005501 3300049742 Bacteria 11306
459 Ga0501080_0115390 3300049742 Bacteria 2490
460 Ga0501081_0180129 3300049743 Bacteria 1528
461 Ga0501035_0168905 3300049822 Unclassified 1890
462 Ga0501035_0206842 3300049822 Bacteria 1681
463 Ga0501044_0142942 3300049823 Bacteria 2380
464 Ga0501044_0320945 3300049823 Bacteria 1473
465 Ga0501045_0005023 3300049824 Bacteria 9166
466 Ga0501045_0013107 3300049824 Bacteria 5848
467 Ga0501045_0234664 3300049824 Bacteria 1365
468 nmdc:mga00v17_145073_c1 3300050491 Bacteria 1523
469 nmdc:mga05p37_303718_c1 3300050507 Bacteria 1895
470 nmdc:mga09592_106255_c1 3300050508 Bacteria 2407
471 nmdc:mga09592_9460_c1 3300050508 Bacteria 7920
472 nmdc:mga0qj67_23645_c1 3300050509 Bacteria 4728
473 nmdc:mga0qj67_7198_c1 3300050509 Bacteria 8214
474 nmdc:mga06r32_109074_c1 3300050510 Bacteria 2722
475 nmdc:mga06r32_184958_c1 3300050510 Bacteria 2070
476 nmdc:mga06r32_44791_c1 3300050510 Bacteria 4215
477 nmdc:mga06r32_7623_c1 3300050510 Bacteria 9733
478 nmdc:mga08y16_185854_c1 3300050511 Bacteria 2157
479 nmdc:mga08y16_21112_c1 3300050511 Bacteria 6875
480 nmdc:mga08y16_501678_c1 3300050511 Bacteria 1233
481 nmdc:mga0n895_28770_c1 3300050512 Bacteria 5290
482 nmdc:mga0rr50_152820_c1 3300050513 Bacteria 1867
483 Ga0495601_0003774 3300053077 Bacteria 8721
484 Ga0495601_0006586 3300053077 Bacteria 6793
485 Ga0495601_0094160 3300053077 Bacteria 1930
486 Ga0495612_0065550 3300053078 Bacteria 1508
487 Ga0495595_0000296 3300053084 Bacteria 19337
488 Ga0495619_0003061 3300053085 Bacteria 10857
489 Ga0495619_0006623 3300053085 Bacteria 7330
490 Ga0495619_0012058 3300053085 Bacteria 5445
491 Ga0500646_0000771 3300053090 Bacteria 8997
492 Ga0500604_0000329 3300053151 Bacteria 13186
493 Ga0501084_0213223 3300054114 Bacteria 1629
494 Ga0501082_0035298 3300060353 Bacteria 4310
495 Ga0501082_0095879 3300060353 Bacteria 2564
496 Ga0501082_0155250 3300060353 Bacteria 1988
497 Ga0530510_0000769 3300061734 Bacteria 20843
498 Ga0530510_0006623 3300061734 Bacteria 8077
499 Ga0501041_0040199
500 MBSR1b_contig_3467282
501 Ga0065707_10213590
502 Ga0070676_10024851
503 Ga0070683_100019858
504 Ga0070683_100230770
505 Ga0070690_100061882
506 Ga0070670_100027589
507 Ga0070670_100033992
508 Ga0070670_100050283
509 Ga0068869_100000160
510 Ga0068869_100145861
511 Ga0070666_10110978
512 Ga0070666_10216737
513 Ga0070680_100119054
514 Ga0068868_100014921
515 Ga0068868_100113707
516 Ga0070660_100016015
517 Ga0070689_100072365
518 Ga0070687_100004543
519 Ga0070661_100000620
520 Ga0070669_100011878
521 Ga0070669_100031053
522 Ga0070669_100083135
523 Ga0070675_100029112
524 Ga0070675_100060594
525 Ga0070675_100065732
526 Ga0070675_100115292
527 Ga0070675_100209625
528 Ga0070671_100044932
529 Ga0070673_100048813
530 Ga0070673_100060663
531 Ga0070688_100018714
532 Ga0070688_100161747
533 Ga0070659_100102397
534 Ga0070667_100015642
535 Ga0070667_100260164
536 Ga0070709_10012776
537 Ga0070714_100002858
538 Ga0070714_100066309
539 Ga0070713_100002510
540 Ga0070710_10022267
541 Ga0070701_10040097
542 Ga0070705_100104155
543 Ga0070700_100045274
544 Ga0070694_100041782
545 Ga0070708_100103017
546 Ga0070681_10025486
547 Ga0070681_10026284
548 Ga0068867_100006924
549 Ga0068867_100007220
550 Ga0070685_10084102
551 Ga0070706_100126961
552 Ga0070707_100154860
553 Ga0070698_100019996
554 Ga0070684_100009360
555 Ga0070684_100032420
556 Ga0070697_100121823
557 Ga0068853_100026587
558 Ga0070672_100021376
559 Ga0070672_100093417
560 Ga0070686_100038807
561 Ga0070695_100051247
562 Ga0070696_100000665
563 Ga0070696_100090148
564 Ga0070693_100013949
565 Ga0070665_100080002
566 Ga0070704_100002331
567 Ga0070704_100002392
568 Ga0070704_100005685
569 Ga0070704_100059794
570 Ga0070664_100037070
571 Ga0070664_100060500
572 Ga0070664_100083104
573 Ga0070664_100235648
574 Ga0068857_100003360
575 Ga0068857_100017599
576 Ga0068854_100001488
577 Ga0068854_100221530
578 Ga0068856_100019529
579 Ga0070702_100017930
580 Ga0070702_100056568
581 Ga0068859_100002394
582 Ga0068864_100000395
583 Ga0068864_100041019
584 Ga0068864_100104294
585 Ga0068864_100159062
586 Ga0068864_100351120
587 Ga0068866_10020734
588 Ga0068861_100003084
589 Ga0068861_100213841
590 Ga0068851_10055598
591 Ga0068870_10003450
592 Ga0068863_100005560
593 Ga0068863_100079538
594 Ga0068863_100083864
595 Ga0068863_100087535
596 Ga0068863_100100664
597 Ga0068858_100022939
598 Ga0068860_100015795
599 Ga0068860_100075949
600 Ga0068862_100096637
601 Ga0081455_10004832
602 Ga0081538_10001845
603 Ga0081538_10049794
604 Ga0075365_10162406
605 Ga0070715_10032185
606 Ga0075367_10134375
607 Ga0075369_10089691
608 Ga0075366_10025324
609 Ga0097621_100029643
610 Ga0097621_100083200
611 Ga0068871_100020011
612 Ga0068871_100049355
613 Ga0075428_100000638
614 Ga0075428_100049674
615 Ga0075428_100129532
616 Ga0075430_100021232
617 Ga0075430_100029137
618 Ga0075431_100000307
619 Ga0075431_100065250
620 Ga0075431_100093908
621 Ga0075431_100386998
622 Ga0075433_10062535
623 Ga0075433_10093495
624 Ga0075429_100011701
625 Ga0075429_100155755
626 Ga0068865_100001154
627 Ga0075436_100110908
628 Ga0097620_100002394
629 Ga0075435_100010857
630 Ga0075435_100129221
631 Ga0099794_10021420
632 Ga0099794_10077562
633 Ga0099795_10022112
634 Ga0105240_10000780
635 Ga0105240_10001181
636 Ga0111539_10004193
637 Ga0105245_10165719
638 Ga0114129_10186839
639 Ga0105243_10022371
640 Ga0105243_10100544
641 Ga0105243_10206130
642 Ga0105242_10001652
643 Ga0105242_10020100
644 Ga0105242_10020636
645 Ga0105242_10036038
646 Ga0105248_10002497
647 Ga0105248_10030740
648 Ga0105248_10047007
649 Ga0105248_10176321
650 Ga0105237_10012555
651 Ga0105238_10039131
652 Ga0105249_10155903
653 Ga0105249_10255269
654 Ga0105249_10521545
655 Ga0099796_10019895
656 Ga0105239_10032279
657 Ga0105246_10142919
658 Ga0157373_10031559
659 Ga0157373_10065965
660 Ga0157370_10014726
661 Ga0157369_10140409
662 Ga0157374_10084500
663 Ga0157378_10029647
664 Ga0157378_10047322
665 Ga0157378_10113521
666 Ga0163162_10198498
667 Ga0157372_10000854
668 Ga0157372_10409253
669 Ga0157375_10126126
670 Ga0157375_10349952
671 Ga0163163_10002115
672 Ga0163163_10345885
673 Ga0163163_10549662
674 Ga0157380_10093664
675 Ga0157380_10103126
676 Ga0157380_10198046
677 Ga0157380_10273328
678 Ga0157377_10135912
679 Ga0157379_10000271
680 Ga0157379_10123706
681 Ga0157379_10280751
682 Ga0157376_10298615
683 Ga0206356_11215269
684 Ga0213875_10000040
685 Ga0213875_10005885
686 Ga0213871_10040563
687 Ga0207666_1004719
688 Ga0207682_10003567
689 Ga0207692_10047048
690 Ga0207680_10064210
691 Ga0207685_10019450
692 Ga0207699_10009723
693 Ga0207645_10009698
694 Ga0207645_10166156
695 Ga0207643_10007625
696 Ga0207643_10010434
697 Ga0207707_10008295
698 Ga0207707_10077546
699 Ga0207695_10008281
700 Ga0207671_10027627
701 Ga0207660_10104852
702 Ga0207657_10002918
703 Ga0207649_10013764
704 Ga0207681_10155868
705 Ga0207694_10115496
706 Ga0207694_10227255
707 Ga0207650_10069764
708 Ga0207659_10087782
709 Ga0207659_10089485
710 Ga0207687_10045993
711 Ga0207700_10000183
712 Ga0207700_10091169
713 Ga0207664_10003432
714 Ga0207664_10031758
715 Ga0207644_10029749
716 Ga0207644_10169447
717 Ga0207706_10014132
718 Ga0207706_10117659
719 Ga0207706_10141215
720 Ga0207686_10018281
721 Ga0207686_10134323
722 Ga0207709_10023739
723 Ga0207670_10074064
724 Ga0207670_10208982
725 Ga0207669_10112900
726 Ga0207704_10002332
727 Ga0207704_10086822
728 Ga0207665_10089010
729 Ga0207691_10052989
730 Ga0207691_10058790
731 Ga0207691_10087427
732 Ga0207691_10225028
733 Ga0207711_10143421
734 Ga0207711_10374443
735 Ga0207689_10000028
736 Ga0207689_10005226
737 Ga0207689_10104579
738 Ga0207661_10016498
739 Ga0207661_10073400
740 Ga0207661_10204886
741 Ga0207679_10021618
742 Ga0207679_10178582
743 Ga0207679_10221061
744 Ga0207667_10025128
745 Ga0207667_10460832
746 Ga0207651_10352229
747 Ga0207712_10093856
748 Ga0207668_10034187
749 Ga0207640_10004727
750 Ga0207658_10108881
751 Ga0207677_10027767
752 Ga0207703_10002194
753 Ga0207703_10009843
754 Ga0207703_10303139
755 Ga0207639_10057461
756 Ga0207708_10240464
757 Ga0207708_10283093
758 Ga0207702_10002279
759 Ga0207641_10074726
760 Ga0207641_10116983
761 Ga0207641_10154440
762 Ga0207648_10001620
763 Ga0207648_10024004
764 Ga0207648_10094046
765 Ga0207648_10116949
766 Ga0207676_10005681
767 Ga0207676_10006221
768 Ga0207676_10062858
769 Ga0207676_10173982
770 Ga0207676_10277507
771 Ga0207674_10000022
772 Ga0207674_10105321
773 Ga0207674_10235329
774 Ga0207675_100001456
775 Ga0207675_100007847
776 Ga0207683_10007883
777 Ga0207683_10014757
778 Ga0207698_10012587
779 Ga0207698_10199550
780 Ga0209967_1000767
781 Ga0209981_1000591
782 Ga0209996_1003604
783 Ga0210000_1000081
784 Ga0209995_1000402
785 Ga0209968_1000708
786 Ga0209999_1000253
787 Ga0209974_10010773
788 Ga0209974_10013906
789 Ga0268265_10299631
790 Ga0268264_10001919
791 Ga0268264_10053353
792 Ga0265318_10002144
793 Ga0265338_10117676
794 Ga0307511_10000065
795 Ga0265330_10002013
796 Ga0265332_10000199
797 Ga0265332_10015971
798 Ga0265325_10022307
799 Ga0265329_10000991
800 Ga0265339_10140691
801 Ga0265331_10001027
802 Ga0265331_10009792
803 Ga0265327_10003598
804 Ga0265316_10010249
805 Ga0265316_10019983
806 Ga0316575_10012610
807 Ga0265314_10012115
808 Ga0265342_10006173
809 Ga0316578_10016899
810 Ga0373926_0012145
811 Ga0373934_0018143
812 Ga0373923_0065631
813 Ga0373936_0008966
814 Ga0373936_0073665
815 Ga0373953_0006425
816 Ga0373954_0002637
817 Ga0373954_0006094
818 Ga0373954_0009416
819 Ga0373954_0012647
820 Ga0373956_0000018
821 Ga0373957_0007711
822 Ga0373957_0069024
823 Ga0373946_0012569
824 Ga0373955_0001648
825 Ga0373955_0002161
826 Ga0373955_0007644
827 Ga0316574_0037874
828 Ga0373924_0001847
829 Ga0373935_0098001
830 Ga0373933_0000035
831 Ga0373933_0000832
832 Ga0373947_0191392
833 Ga0373937_0001048
834 Ga0373937_0002135
835 Ga0373937_0024477
836 Ga0373937_0377429
837 Ga0316582_0152006
838 Ga0395905_0411355
839 Ga0436364_0374996
840 Ga0436364_0576120
841 Ga0436364_1209713
842 Ga0400483_146919
843 Ga0400483_211488
844 Ga0436365_0017926
845 Ga0436362_0682656
846 Ga0439464_0001416
847 Ga0439460_0061955
848 Ga0451576_0095780
849 Ga0495592_0001428
850 Ga0495629_0003053
851 Ga0495629_0165636
852 Ga0495641_0034875
853 Ga0495651_0000350
854 Ga0495651_0000476
855 Ga0495651_0006469
856 Ga0495653_0000900
857 Ga0495653_0007068
858 Ga0495580_0229960
859 Ga0495582_0017891
860 Ga0495639_0003619
861 Ga0495662_0015857
862 Ga0495664_0000685
863 Ga0495608_0005364
864 Ga0495608_0006821
865 Ga0495618_0101518
866 Ga0495620_0057021
867 Ga0495628_0001118
868 Ga0495628_0013837
869 Ga0495628_0013977
870 Ga0495652_0000469
871 Ga0495652_0002547
872 Ga0495640_0003500
873 Ga0495586_0001410
874 Ga0495587_0016992
875 Ga0495645_0000044
876 Ga0495667_0000641
877 Ga0495667_0053997
878 Ga0495667_0110917
879 Ga0495634_0006920
880 Ga0495635_0002907
881 Ga0495635_0053722
882 Ga0495657_0014595
883 Ga0495599_0000684
884 Ga0495599_0001448
885 Ga0495599_0061940
886 Ga0495599_0071417
887 Ga0495623_0011647
888 Ga0495646_0078021
889 Ga0495658_0003277
890 Ga0495658_0020147
891 Ga0495658_0189520
892 Ga0495669_0082810
893 Ga0495613_0028133
894 Ga0495613_0042051
895 Ga0495624_0011667
896 Ga0495600_0011543
897 Ga0495600_0047265
898 Ga0495674_0005934
899 Ga0495674_0008528
900 Ga0495672_0057821
901 Ga0495680_0000363
902 Ga0495675_0006056
903 Ga0495684_0066523
904 Ga0495684_0073224
905 Ga0495593_0011918
906 Ga0496102_0317651
907 Ga0496104_0217789
908 Ga0496108_0419873
909 Ga0496109_0257933
910 Ga0496111_0125358
911 Ga0496112_0210440
912 Ga0496115_0065497
913 Ga0501031_0252125
914 Ga0501032_0098516
915 Ga0501033_0097677
916 Ga0501034_0064295
917 Ga0501034_0159847
918 Ga0501036_0105458
919 Ga0501036_0206462
920 Ga0501039_0119358
921 Ga0501040_0013684
922 Ga0501041_0005857
923 Ga0501042_0002819
924 Ga0501043_0061705
925 Ga0501046_0066745
926 Ga0501046_0071356
927 Ga0501046_0183786
928 Ga0501047_0005005
929 Ga0501048_0042882
930 Ga0501048_0091849
931 Ga0501048_0154482
932 Ga0501068_0017092
933 Ga0501069_0131941
934 Ga0501070_0080799
935 Ga0501070_0275788
936 Ga0501071_0020981
937 Ga0501071_0046908
938 Ga0501071_0193166
939 Ga0501072_0002669
940 Ga0501072_0011738
941 Ga0501072_0109024
942 Ga0501072_0114894
943 Ga0501072_0255964
944 Ga0501075_0034527
945 Ga0501075_0065321
946 Ga0501075_0132970
947 Ga0501076_0003456
948 Ga0501076_0114587
949 Ga0501077_0028017
950 Ga0501077_0058600
951 Ga0501077_0059055
952 Ga0501079_0000323
953 Ga0501079_0071414
954 Ga0501079_0180111
955 Ga0501079_0310683
956 Ga0501080_0005501
957 Ga0501080_0115390
958 Ga0501081_0180129
959 Ga0501035_0168905
960 Ga0501035_0206842
961 Ga0501044_0142942
962 Ga0501044_0320945
963 Ga0501045_0005023
964 Ga0501045_0013107
965 Ga0501045_0234664
966 nmdc:mga00v17_145073_c1
967 nmdc:mga05p37_303718_c1
968 nmdc:mga09592_106255_c1
969 nmdc:mga09592_9460_c1
970 nmdc:mga0qj67_23645_c1
971 nmdc:mga0qj67_7198_c1
972 nmdc:mga06r32_109074_c1
973 nmdc:mga06r32_184958_c1
974 nmdc:mga06r32_44791_c1
975 nmdc:mga06r32_7623_c1
976 nmdc:mga08y16_185854_c1
977 nmdc:mga08y16_21112_c1
978 nmdc:mga08y16_501678_c1
979 nmdc:mga0n895_28770_c1
980 nmdc:mga0rr50_152820_c1
981 Ga0495601_0003774
982 Ga0495601_0006586
983 Ga0495601_0094160
984 Ga0495612_0065550
985 Ga0495595_0000296
986 Ga0495619_0003061
987 Ga0495619_0006623
988 Ga0495619_0012058
989 Ga0500646_0000771
990 Ga0500604_0000329
991 Ga0501084_0213223
992 Ga0501082_0035298
993 Ga0501082_0095879
994 Ga0501082_0155250
995 Ga0530510_0000769
996 Ga0530510_0006623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zix-assembly2.cif.gz_B crystal structure of ketopantoate reductase from pseudomonas aeruginosa bound to nadp+ 0.7707 4 349
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.7683 1 350
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.7637 1 350
3i83-assembly1.cif.gz_A crystal structure of 2-dehydropantoate 2-reductase from methylococcus capsulatus 0.7624 4 353
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.7561 1 347
ID Description Score Start End Superfamily
5zikA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7891 225 346 1.10.1040.10
5zikA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7778 225 346 1.10.1040.10
5hwsD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7601 232 346 1.10.1040.10
3egoB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.7575 227 345 1.10.1040.10
3ghyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7401 1 221 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537CP80-F1-model_v4 Uncharacterized protein 0.9945 242 352
AF-A0A381Q2U3-F1-model_v4 Uncharacterized protein 0.9944 23 353
AF-A0A537NZE7-F1-model_v4 Uncharacterized protein 0.9916 241 352
AF-A0A536ZVG5-F1-model_v4 Uncharacterized protein 0.9915 240 352
AF-A0A381Q2U3-F1-model_v4 Uncharacterized protein 0.9884 23 353

Map