metagRoot

F455281

General Info

Members	Datasets	Scaffolds	Average Seq Length
498	262	498	198

Family's Representative Sequence

Representative Sequence	3300050514\|nmdc:mga08x19_49111_c1\|nmdc:mga08x19_49111_c1_1595_2191
Length	198
Sequence	MNDNEKVDKTRRNLVVATSVAGGAAGVGVAVPFVASMWPSERARAAGAPVDVDLSRIAPGELNVIEWRGKPVWILKRTKEMLESLKTIEPRLSDPDSKASDQPKYAENEYRSKNPELLVLVGVCTHLGCSPQEKPAEAKAEMGADWPGGFYCPCHGSKFDLAGRVFKGSPAPLNLVVPPYTLADGKLVVGEDEKTKGA

Samples

	Sample ID	Description	Type	Environment
1	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
28	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
29	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
30	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
31	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
32	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
33	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
34	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
35	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
36	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
37	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
38	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
39	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
40	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
43	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
44	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
47	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
48	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
49	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
57	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
58	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
59	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
67	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
69	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
70	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
71	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
72	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
73	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
74	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
75	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
76	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
79	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
82	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
149	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
151	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
152	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
153	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
154	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
155	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
156	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
157	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
158	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
159	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
160	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
161	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
162	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
163	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
164	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
165	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
166	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
167	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
168	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
169	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
170	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
171	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
172	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
173	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
174	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
175	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
176	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
177	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
178	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
179	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
180	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
181	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
182	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
183	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
184	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
185	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
186	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
187	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
188	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
189	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
190	3300042116	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792	Metagenome	Rhizosphere
191	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
192	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
193	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
194	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
195	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
196	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
197	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
198	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
199	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
200	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
201	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
202	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
203	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
204	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
205	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
206	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
207	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
208	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
209	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
210	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
211	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
212	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
213	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
214	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
215	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
216	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
217	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
218	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
219	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
220	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
221	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
222	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
223	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
224	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
225	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
226	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
227	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
228	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
229	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
230	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
231	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
232	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
233	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
234	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
235	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
238	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
241	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
242	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
243	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
244	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
246	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
247	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
250	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
252	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
253	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
254	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
255	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
256	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
257	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
258	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
259	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
260	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
261	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
262	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	0.4
Rhizosphere	99.6
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24749J21850_1023398	3300002076	Bacteria	878
2	JGI25406J46586_10072759	3300003203	Bacteria	1074
3	Ga0065712_10026191	3300005290	Bacteria	1195
4	Ga0065712_10095071	3300005290	Bacteria	2231
5	Ga0065707_10135076	3300005295	Bacteria	1855
6	Ga0070676_10041691	3300005328	Bacteria	2663
7	Ga0070676_10150691	3300005328	Bacteria	1488
8	Ga0070683_100017908	3300005329	Bacteria	6262
9	Ga0070690_100006988	3300005330	Bacteria	6431
10	Ga0070690_100037543	3300005330	Bacteria	3054
11	Ga0070690_100110629	3300005330	Bacteria	1833
12	Ga0070670_100000692	3300005331	Bacteria	26190
13	Ga0070670_100054569	3300005331	Bacteria	3431
14	Ga0070670_100069883	3300005331	Bacteria	3014
15	Ga0070677_10023392	3300005333	Bacteria	2287
16	Ga0068869_100242138	3300005334	Bacteria	1437
17	Ga0070666_10005764	3300005335	Bacteria	7609
18	Ga0070666_10064666	3300005335	Bacteria	2481
19	Ga0070680_100014890	3300005336	Bacteria	6084
20	Ga0068868_100000253	3300005338	Bacteria	36425
21	Ga0068868_100000335	3300005338	Bacteria	31712
22	Ga0068868_100078446	3300005338	Bacteria	2644
23	Ga0070689_100058505	3300005340	Bacteria	2993
24	Ga0070689_100101927	3300005340	Bacteria	2273
25	Ga0070689_100119950	3300005340	Bacteria	2100
26	Ga0070689_100427460	3300005340	Bacteria	1124
27	Ga0070687_100007312	3300005343	Bacteria	4594
28	Ga0070687_100045160	3300005343	Bacteria	2248
29	Ga0070687_100241197	3300005343	Bacteria	1118
30	Ga0070661_100260851	3300005344	Bacteria	1340
31	Ga0070692_10052510	3300005345	Bacteria	2123
32	Ga0070692_10083302	3300005345	Bacteria	1726
33	Ga0070692_10104590	3300005345	Bacteria	1557
34	Ga0070692_10281682	3300005345	Bacteria	1008
35	Ga0070668_100013138	3300005347	Bacteria	6173
36	Ga0070668_101082335	3300005347	Unclassified	723
37	Ga0070669_100009032	3300005353	Bacteria	7107
38	Ga0070669_100661548	3300005353	Bacteria	879
39	Ga0070675_100011075	3300005354	Bacteria	7060
40	Ga0070675_100135643	3300005354	Bacteria	2100
41	Ga0070675_100159814	3300005354	Bacteria	1937
42	Ga0070675_100267484	3300005354	Bacteria	1499
43	Ga0070671_100000871	3300005355	Bacteria	22094
44	Ga0070671_100023686	3300005355	Bacteria	5026
45	Ga0070671_100055210	3300005355	Bacteria	3304
46	Ga0070674_100009950	3300005356	Bacteria	5724
47	Ga0070674_100048152	3300005356	Bacteria	2925
48	Ga0070674_100048850	3300005356	Bacteria	2906
49	Ga0070673_100006599	3300005364	Bacteria	7556
50	Ga0070673_100263450	3300005364	Bacteria	1506
51	Ga0070688_100062812	3300005365	Bacteria	2352
52	Ga0070688_100127594	3300005365	Bacteria	1712
53	Ga0070688_100428311	3300005365	Bacteria	985
54	Ga0070659_100188444	3300005366	Bacteria	1695
55	Ga0070667_100012500	3300005367	Bacteria	7021
56	Ga0070667_100026243	3300005367	Bacteria	4845
57	Ga0070709_10626965	3300005434	Bacteria	830
58	Ga0070710_10022381	3300005437	Bacteria	3305
59	Ga0070701_10034459	3300005438	Bacteria	2536
60	Ga0070701_10035562	3300005438	Bacteria	2503
61	Ga0070701_10313846	3300005438	Bacteria	968
62	Ga0070711_100487665	3300005439	Bacteria	1014
63	Ga0070700_100001780	3300005441	Bacteria	10859
64	Ga0070700_100101124	3300005441	Bacteria	1899
65	Ga0070700_100609426	3300005441	Bacteria	856
66	Ga0070694_100004413	3300005444	Bacteria	8458
67	Ga0070694_100102503	3300005444	Bacteria	2026
68	Ga0070694_100164501	3300005444	Bacteria	1631
69	Ga0070694_100301643	3300005444	Bacteria	1227
70	Ga0070694_100619797	3300005444	Bacteria	873
71	Ga0070663_100222637	3300005455	Bacteria	1482
72	Ga0070678_100002100	3300005456	Bacteria	10797
73	Ga0070678_100088868	3300005456	Bacteria	2363
74	Ga0070678_100210720	3300005456	Bacteria	1610
75	Ga0070662_100030797	3300005457	Bacteria	3759
76	Ga0068867_100000755	3300005459	Bacteria	21746
77	Ga0068867_100004732	3300005459	Bacteria	9580
78	Ga0068867_100028734	3300005459	Bacteria	4004
79	Ga0068867_100191895	3300005459	Bacteria	1631
80	Ga0068867_100913622	3300005459	Bacteria	791
81	Ga0068867_100977852	3300005459	Bacteria	766
82	Ga0070685_10071277	3300005466	Bacteria	2060
83	Ga0070685_10077399	3300005466	Bacteria	1986
84	Ga0070698_100004625	3300005471	Bacteria	15121
85	Ga0070699_100008120	3300005518	Bacteria	9115
86	Ga0070684_100143311	3300005535	Bacteria	2162
87	Ga0068853_100216395	3300005539	Bacteria	1748
88	Ga0070672_100000946	3300005543	Bacteria	17466
89	Ga0070672_100071794	3300005543	Bacteria	2755
90	Ga0070672_100409341	3300005543	Bacteria	1163
91	Ga0070672_100542028	3300005543	Bacteria	1009
92	Ga0070686_100004514	3300005544	Bacteria	7674
93	Ga0070686_100047197	3300005544	Bacteria	2722
94	Ga0070686_100053743	3300005544	Bacteria	2573
95	Ga0070686_100059841	3300005544	Bacteria	2455
96	Ga0070686_100120219	3300005544	Bacteria	1802
97	Ga0070686_100175227	3300005544	Bacteria	1520
98	Ga0070686_100427980	3300005544	Bacteria	1013
99	Ga0070686_100513707	3300005544	Bacteria	931
100	Ga0070695_100175784	3300005545	Bacteria	1514
101	Ga0070695_100281770	3300005545	Bacteria	1221
102	Ga0070696_100092181	3300005546	Bacteria	2159
103	Ga0070696_100237649	3300005546	Bacteria	1373
104	Ga0070696_100308844	3300005546	Bacteria	1214
105	Ga0070693_100052778	3300005547	Bacteria	2332
106	Ga0070693_100301178	3300005547	Bacteria	1081
107	Ga0070665_100008313	3300005548	Bacteria	10495
108	Ga0070665_100058930	3300005548	Bacteria	3849
109	Ga0070704_100024253	3300005549	Bacteria	3978
110	Ga0070704_100102998	3300005549	Bacteria	2155
111	Ga0070704_100190680	3300005549	Bacteria	1647
112	Ga0070664_100000920	3300005564	Bacteria	22953
113	Ga0070664_100001215	3300005564	Bacteria	20552
114	Ga0070664_100586678	3300005564	Bacteria	1033
115	Ga0068857_100203299	3300005577	Bacteria	1806
116	Ga0068854_100000716	3300005578	Bacteria	19611
117	Ga0070702_100006708	3300005615	Bacteria	5470
118	Ga0070702_100017647	3300005615	Bacteria	3686
119	Ga0070702_100025144	3300005615	Bacteria	3187
120	Ga0070702_100044907	3300005615	Bacteria	2497
121	Ga0070702_100241271	3300005615	Bacteria	1220
122	Ga0068852_100001420	3300005616	Bacteria	16151
123	Ga0068852_100141785	3300005616	Bacteria	2225
124	Ga0068852_100297555	3300005616	Bacteria	1561
125	Ga0068859_100009581	3300005617	Bacteria	9780
126	Ga0068859_100018332	3300005617	Bacteria	7037
127	Ga0068859_100071697	3300005617	Bacteria	3500
128	Ga0068864_100002487	3300005618	Bacteria	15224
129	Ga0068864_100006138	3300005618	Bacteria	9856
130	Ga0068864_100524385	3300005618	Bacteria	1142
131	Ga0068866_10002262	3300005718	Bacteria	7984
132	Ga0068861_100002389	3300005719	Bacteria	12231
133	Ga0068861_100029682	3300005719	Bacteria	4002
134	Ga0068861_100167656	3300005719	Bacteria	1817
135	Ga0068851_10005262	3300005834	Bacteria	5871
136	Ga0068870_10021724	3300005840	Bacteria	3144
137	Ga0068863_100004098	3300005841	Bacteria	14399
138	Ga0068863_100041524	3300005841	Bacteria	4374
139	Ga0068863_101478478	3300005841	Bacteria	688
140	Ga0068858_100005576	3300005842	Bacteria	12315
141	Ga0068858_100007748	3300005842	Bacteria	10364
142	Ga0068860_100012638	3300005843	Bacteria	8308
143	Ga0068860_100019301	3300005843	Bacteria	6615
144	Ga0068862_100005268	3300005844	Bacteria	10846
145	Ga0068862_100032519	3300005844	Bacteria	4408
146	Ga0068862_100094651	3300005844	Bacteria	2605
147	Ga0068862_100239382	3300005844	Bacteria	1649
148	Ga0068862_100268759	3300005844	Bacteria	1559
149	Ga0068862_100601177	3300005844	Bacteria	1056
150	Ga0081539_10005168	3300005985	Bacteria	13568
151	Ga0070717_10306145	3300006028	Bacteria	1413
152	Ga0070716_100228381	3300006173	Bacteria	1255
153	Ga0097621_100000756	3300006237	Bacteria	22691
154	Ga0097621_100091013	3300006237	Bacteria	2553
155	Ga0097621_100174574	3300006237	Bacteria	1854
156	Ga0068871_100000538	3300006358	Bacteria	25810
157	Ga0068871_100000588	3300006358	Bacteria	24949
158	Ga0068871_100015770	3300006358	Bacteria	5668
159	Ga0068871_100078171	3300006358	Bacteria	2735
160	Ga0075428_100000183	3300006844	Bacteria	58831
161	Ga0075428_100047983	3300006844	Bacteria	4689
162	Ga0075428_100512694	3300006844	Bacteria	1283
163	Ga0075428_100604203	3300006844	Bacteria	1171
164	Ga0075430_100133426	3300006846	Bacteria	2069
165	Ga0075430_100158657	3300006846	Bacteria	1883
166	Ga0075431_100003185	3300006847	Bacteria	15863
167	Ga0075431_100018868	3300006847	Bacteria	7026
168	Ga0075431_100144931	3300006847	Bacteria	2447
169	Ga0075431_100226086	3300006847	Bacteria	1908
170	Ga0075431_100458568	3300006847	Bacteria	1269
171	Ga0075431_100923584	3300006847	Bacteria	842
172	Ga0075433_10020641	3300006852	Bacteria	5513
173	Ga0075434_100000079	3300006871	Bacteria	52051
174	Ga0075434_100047627	3300006871	Bacteria	4254
175	Ga0075434_101733835	3300006871	Bacteria	632
176	Ga0075429_100000100	3300006880	Bacteria	47693
177	Ga0075429_100000891	3300006880	Bacteria	23613
178	Ga0075429_100262391	3300006880	Bacteria	1512
179	Ga0068865_100023283	3300006881	Bacteria	4054
180	Ga0068865_100336057	3300006881	Bacteria	1219
181	Ga0075436_100000529	3300006914	Bacteria	24848
182	Ga0075436_100019207	3300006914	Bacteria	4682
183	Ga0075436_100050994	3300006914	Bacteria	2856
184	Ga0075436_100139906	3300006914	Bacteria	1701
185	Ga0075436_100421151	3300006914	Bacteria	970
186	Ga0097620_100009581	3300006931	Bacteria	9780
187	Ga0097620_100018332	3300006931	Bacteria	7037
188	Ga0097620_100071698	3300006931	Bacteria	3500
189	Ga0075435_100009301	3300007076	Bacteria	7103
190	Ga0075435_100034795	3300007076	Bacteria	3993
191	Ga0075435_100168309	3300007076	Bacteria	1848
192	Ga0111539_10126660	3300009094	Bacteria	2992
193	Ga0111539_10127491	3300009094	Bacteria	2981
194	Ga0111539_10256046	3300009094	Bacteria	2038
195	Ga0111539_10331037	3300009094	Bacteria	1773
196	Ga0111539_10359365	3300009094	Bacteria	1695
197	Ga0111539_10384406	3300009094	Bacteria	1634
198	Ga0111539_10501548	3300009094	Bacteria	1414
199	Ga0111539_11059102	3300009094	Bacteria	943
200	Ga0105245_10084550	3300009098	Bacteria	2907
201	Ga0105245_10097096	3300009098	Bacteria	2720
202	Ga0105245_10307590	3300009098	Bacteria	1557
203	Ga0105247_10001900	3300009101	Bacteria	14585
204	Ga0105247_10388818	3300009101	Bacteria	991
205	Ga0114129_10000219	3300009147	Bacteria	63579
206	Ga0114129_10046021	3300009147	Bacteria	6133
207	Ga0114129_10126614	3300009147	Bacteria	3512
208	Ga0114129_10452528	3300009147	Bacteria	1683
209	Ga0114129_10523218	3300009147	Bacteria	1546
210	Ga0114129_10986958	3300009147	Bacteria	1061
211	Ga0105243_10019980	3300009148	Bacteria	5078
212	Ga0105242_10009338	3300009176	Bacteria	7531
213	Ga0105248_10000996	3300009177	Bacteria	31342
214	Ga0105248_10096888	3300009177	Bacteria	3323
215	Ga0105248_10146841	3300009177	Bacteria	2661
216	Ga0105238_10034240	3300009551	Bacteria	5169
217	Ga0105249_10001388	3300009553	Bacteria	21206
218	Ga0105249_10161784	3300009553	Bacteria	2164
219	Ga0105249_10171717	3300009553	Bacteria	2103
220	Ga0105239_10054258	3300010375	Bacteria	4396
221	Ga0105246_10021134	3300011119	Bacteria	4184
222	Ga0105246_10179684	3300011119	Bacteria	1628
223	Ga0157374_10001144	3300013296	Bacteria	22606
224	Ga0157374_10004878	3300013296	Bacteria	11253
225	Ga0157374_10359895	3300013296	Bacteria	1447
226	Ga0157378_10001459	3300013297	Bacteria	21320
227	Ga0157378_10027021	3300013297	Bacteria	5063
228	Ga0163162_10005062	3300013306	Bacteria	12699
229	Ga0163162_10091681	3300013306	Bacteria	3122
230	Ga0163162_10131278	3300013306	Bacteria	2614
231	Ga0157375_10001598	3300013308	Bacteria	19468
232	Ga0157375_10021885	3300013308	Bacteria	5876
233	Ga0157375_10285995	3300013308	Bacteria	1812
234	Ga0163163_10003469	3300014325	Bacteria	13396
235	Ga0163163_11342836	3300014325	Bacteria	777
236	Ga0157380_10003205	3300014326	Bacteria	11169
237	Ga0157380_10022469	3300014326	Bacteria	4750
238	Ga0157377_10110813	3300014745	Bacteria	1649
239	Ga0157379_10031299	3300014968	Bacteria	4739
240	Ga0157379_10071216	3300014968	Bacteria	3110
241	Ga0157376_10038255	3300014969	Bacteria	3902
242	Ga0157376_10042110	3300014969	Bacteria	3743
243	Ga0157376_10049068	3300014969	Bacteria	3495
244	Ga0157376_10255716	3300014969	Bacteria	1638
245	Ga0163161_10146191	3300017792	Bacteria	1793
246	Ga0207697_10004840	3300025315	Bacteria	6355
247	Ga0207682_10001648	3300025893	Bacteria	10238
248	Ga0207692_10006506	3300025898	Bacteria	4742
249	Ga0207642_10021483	3300025899	Bacteria	2542
250	Ga0207688_10002462	3300025901	Bacteria	9958
251	Ga0207688_10066088	3300025901	Bacteria	2045
252	Ga0207680_10143620	3300025903	Bacteria	1584
253	Ga0207645_10004080	3300025907	Bacteria	10872
254	Ga0207645_10044710	3300025907	Bacteria	2833
255	Ga0207643_10050140	3300025908	Bacteria	2367
256	Ga0207643_10229869	3300025908	Bacteria	1137
257	Ga0207643_10436799	3300025908	Bacteria	831
258	Ga0207660_10004569	3300025917	Bacteria	9015
259	Ga0207662_10002404	3300025918	Bacteria	9390
260	Ga0207662_10016360	3300025918	Bacteria	4186
261	Ga0207662_10101076	3300025918	Bacteria	1786
262	Ga0207662_10160214	3300025918	Bacteria	1437
263	Ga0207662_10415433	3300025918	Bacteria	915
264	Ga0207681_10002384	3300025923	Bacteria	11951
265	Ga0207659_10019737	3300025926	Bacteria	4442
266	Ga0207659_10165079	3300025926	Bacteria	1742
267	Ga0207687_10048289	3300025927	Bacteria	2954
268	Ga0207687_10064458	3300025927	Bacteria	2598
269	Ga0207664_10102364	3300025929	Bacteria	2368
270	Ga0207644_10020554	3300025931	Bacteria	4489
271	Ga0207706_10008535	3300025933	Bacteria	9442
272	Ga0207686_10006580	3300025934	Bacteria	6260
273	Ga0207709_10001769	3300025935	Bacteria	14509
274	Ga0207709_10013788	3300025935	Bacteria	4461
275	Ga0207670_10038700	3300025936	Bacteria	3117
276	Ga0207670_10066166	3300025936	Bacteria	2482
277	Ga0207669_10005096	3300025937	Bacteria	5853
278	Ga0207669_10032266	3300025937	Bacteria	2939
279	Ga0207704_10014501	3300025938	Bacteria	3981
280	Ga0207665_10063934	3300025939	Bacteria	2500
281	Ga0207691_10024247	3300025940	Bacteria	5706
282	Ga0207711_10109623	3300025941	Bacteria	2453
283	Ga0207689_10011799	3300025942	Bacteria	7484
284	Ga0207689_10028985	3300025942	Bacteria	4628
285	Ga0207679_10685301	3300025945	Bacteria	929
286	Ga0207651_10183914	3300025960	Bacteria	1660
287	Ga0207651_10716519	3300025960	Bacteria	882
288	Ga0207712_10001259	3300025961	Bacteria	17480
289	Ga0207712_10232976	3300025961	Bacteria	1479
290	Ga0207640_10009769	3300025981	Bacteria	5380
291	Ga0207658_10008059	3300025986	Bacteria	7178
292	Ga0207677_10233395	3300026023	Bacteria	1483
293	Ga0207703_10005644	3300026035	Bacteria	10049
294	Ga0207678_10069966	3300026067	Bacteria	3009
295	Ga0207708_10003160	3300026075	Bacteria	12129
296	Ga0207708_10006003	3300026075	Bacteria	9000
297	Ga0207641_10126977	3300026088	Bacteria	2284
298	Ga0207648_10002409	3300026089	Bacteria	20139
299	Ga0207648_10006783	3300026089	Bacteria	11353
300	Ga0207648_10325825	3300026089	Bacteria	1381
301	Ga0207676_10039613	3300026095	Bacteria	3605
302	Ga0207676_10241561	3300026095	Bacteria	1620
303	Ga0207674_10089706	3300026116	Bacteria	3067
304	Ga0207674_10159011	3300026116	Bacteria	2214
305	Ga0207674_10253454	3300026116	Bacteria	1707
306	Ga0207675_100000812	3300026118	Bacteria	31052
307	Ga0207675_100005706	3300026118	Bacteria	11914
308	Ga0207675_100981812	3300026118	Bacteria	863
309	Ga0207683_10052956	3300026121	Bacteria	3557
310	Ga0207698_10220197	3300026142	Bacteria	1714
311	Ga0209967_1010089	3300027364	Bacteria	1314
312	Ga0209996_1024773	3300027395	Bacteria	856
313	Ga0209995_1008652	3300027471	Bacteria	1643
314	Ga0209995_1014491	3300027471	Bacteria	1293
315	Ga0209999_1016122	3300027543	Bacteria	1360
316	Ga0209982_1017167	3300027552	Bacteria	1102
317	Ga0209983_1003587	3300027665	Bacteria	3295
318	Ga0209966_1010900	3300027695	Bacteria	1649
319	Ga0207428_10000290	3300027907	Bacteria	67367
320	Ga0207428_10022784	3300027907	Bacteria	5279
321	Ga0207428_10168357	3300027907	Bacteria	1660
322	Ga0268265_10001159	3300028380	Bacteria	23174
323	Ga0268265_10428860	3300028380	Bacteria	1229
324	Ga0268265_10623461	3300028380	Bacteria	1033
325	Ga0265318_10004501	3300028577	Bacteria	6744
326	Ga0265338_10313481	3300028800	Bacteria	1137
327	Ga0265332_10006633	3300031238	Bacteria	5244
328	Ga0265320_10144831	3300031240	Bacteria	1074
329	Ga0265329_10005964	3300031242	Bacteria	4877
330	Ga0265331_10001042	3300031250	Bacteria	21611
331	Ga0265327_10099100	3300031251	Bacteria	1409
332	Ga0265316_10017607	3300031344	Bacteria	6167
333	Ga0307408_100368792	3300031548	Bacteria	1224
334	Ga0265314_10000488	3300031711	Bacteria	51640
335	Ga0265342_10016954	3300031712	Bacteria	4746
336	Ga0307406_10255488	3300031901	Bacteria	1323
337	Ga0307416_100632115	3300032002	Bacteria	1153
338	Ga0307411_10237922	3300032005	Bacteria	1423
339	Ga0307411_10414403	3300032005	Bacteria	1117
340	Ga0307415_101195241	3300032126	Bacteria	716
341	Ga0373930_0067973	3300034816	Bacteria	805
342	Ga0373948_0032267	3300034817	Bacteria	1061
343	Ga0373928_0039404	3300035084	Bacteria	1079
344	Ga0373929_0016652	3300035085	Bacteria	1442
345	Ga0373929_0090369	3300035085	Bacteria	759
346	Ga0373940_0003492	3300035088	Bacteria	3216
347	Ga0373940_0204976	3300035088	Bacteria	650
348	Ga0373951_0006160	3300035091	Bacteria	2753
349	Ga0373952_0005542	3300035092	Bacteria	2311
350	Ga0373932_0013057	3300035112	Bacteria	2058
351	Ga0373939_0016174	3300035114	Bacteria	1963
352	Ga0373939_0028964	3300035114	Bacteria	1580
353	Ga0373939_0038608	3300035114	Bacteria	1425
354	Ga0373941_0059200	3300035115	Bacteria	1241
355	Ga0373941_0059758	3300035115	Bacteria	1237
356	Ga0373953_0179777	3300035117	Bacteria	912
357	Ga0373956_0010842	3300035119	Bacteria	3745
358	Ga0373960_0021781	3300035121	Bacteria	1709
359	Ga0373960_0116199	3300035121	Bacteria	883
360	Ga0373955_0075760	3300035172	Bacteria	1891
361	Ga0373942_0016813	3300035207	Bacteria	1798
362	Ga0373961_0182075	3300035241	Bacteria	732
363	Ga0373962_0005071	3300035242	Bacteria	3181
364	Ga0373931_0001802	3300035691	Bacteria	9317
365	Ga0373931_0005360	3300035691	Bacteria	5920
366	Ga0373931_0057668	3300035691	Bacteria	2083
367	Ga0373927_0473963	3300035695	Bacteria	827
368	Ga0373933_0006341	3300035724	Bacteria	6436
369	Ga0373933_0217492	3300035724	Bacteria	1225
370	Ga0373937_0058441	3300036401	Bacteria	3543
371	Ga0439439_0124337	3300041406	Bacteria	721
372	Ga0439453_0043531	3300041408	Bacteria	887
373	Ga0439441_004260	3300042001	Bacteria	2157
374	Ga0439441_005186	3300042001	Bacteria	2010
375	Ga0439443_032446	3300042003	Bacteria	866
376	Ga0450912_011132	3300042116	Bacteria	779
377	Ga0439446_0046435	3300042156	Bacteria	1290
378	Ga0439446_0048707	3300042156	Bacteria	1262
379	Ga0439434_0021316	3300042435	Bacteria	1947
380	Ga0439435_0000637	3300042436	Bacteria	5748
381	Ga0439435_0024538	3300042436	Bacteria	1591
382	Ga0439460_0000557	3300042461	Bacteria	8158
383	Ga0439460_0020445	3300042461	Bacteria	1799
384	Ga0466964_0250336	3300044706	Bacteria	873
385	Ga0466968_0200911	3300044735	Bacteria	934
386	Ga0451576_0039620	3300045051	Bacteria	4987
387	Ga0451576_0171903	3300045051	Bacteria	2261
388	Ga0451576_0841132	3300045051	Bacteria	963
389	Ga0466967_0036209	3300045976	Bacteria	4211
390	Ga0495592_0007717	3300046454	Bacteria	8056
391	Ga0495603_0467850	3300046455	Bacteria	722
392	Ga0495653_0140740	3300046463	Bacteria	1697
393	Ga0495662_0031378	3300046476	Bacteria	2567
394	Ga0495584_0126393	3300046491	Bacteria	1296
395	Ga0495608_0000767	3300046511	Bacteria	22475
396	Ga0495618_0375916	3300046514	Bacteria	872
397	Ga0495628_0003354	3300046516	Bacteria	14318
398	Ga0495628_0500877	3300046516	Bacteria	877
399	Ga0495630_0179065	3300046517	Bacteria	1616
400	Ga0495630_0308015	3300046517	Bacteria	1210
401	Ga0495666_0013034	3300046526	Bacteria	4143
402	Ga0495642_0102833	3300046528	Bacteria	1217
403	Ga0495652_0115537	3300046529	Bacteria	2150
404	Ga0495640_0028394	3300046533	Bacteria	4030
405	Ga0495640_0070485	3300046533	Bacteria	2348
406	Ga0495586_0036953	3300046535	Bacteria	2622
407	Ga0495587_0263968	3300046536	Bacteria	967
408	Ga0495598_0021521	3300046537	Bacteria	1716
409	Ga0495598_0095539	3300046537	Bacteria	976
410	Ga0495621_0127553	3300046539	Bacteria	988
411	Ga0495645_0105574	3300046543	Bacteria	1999
412	Ga0495634_0000957	3300046642	Bacteria	27315
413	Ga0495635_0035463	3300046663	Bacteria	3458
414	Ga0495635_0263133	3300046663	Bacteria	1161
415	Ga0495635_0318359	3300046663	Bacteria	1041
416	Ga0495659_0024738	3300046664	Bacteria	2050
417	Ga0495599_0038809	3300046678	Bacteria	2993
418	Ga0495599_0342029	3300046678	Bacteria	898
419	Ga0495669_0039020	3300046684	Bacteria	2102
420	Ga0495669_0164111	3300046684	Bacteria	1055
421	Ga0495613_0005199	3300046689	Bacteria	9772
422	Ga0495624_0044965	3300046690	Bacteria	2813
423	Ga0495624_0157413	3300046690	Bacteria	1388
424	Ga0495670_0171980	3300046691	Bacteria	1141
425	Ga0495600_0170460	3300046809	Bacteria	1405
426	Ga0495604_0007822	3300047317	Bacteria	8463
427	Ga0495636_0107051	3300047318	Bacteria	1227
428	Ga0495636_0298485	3300047318	Bacteria	753
429	Ga0495674_0080391	3300047319	Bacteria	2797
430	Ga0495680_0002465	3300047322	Bacteria	18939
431	Ga0495684_0101522	3300047471	Bacteria	2175
432	Ga0496108_0064169	3300048911	Bacteria	3094
433	Ga0496112_0662318	3300048915	Bacteria	973
434	Ga0501298_052024	3300049521	Bacteria	852
435	Ga0501299_028641	3300049522	Bacteria	1063
436	Ga0501039_0249880	3300049575	Bacteria	1394
437	Ga0501040_0012397	3300049576	Bacteria	5585
438	Ga0501041_0062247	3300049577	Bacteria	2284
439	Ga0501041_0446262	3300049577	Bacteria	821
440	Ga0501048_0092405	3300049582	Bacteria	2134
441	Ga0501048_0118817	3300049582	Bacteria	1868
442	Ga0501048_0370563	3300049582	Bacteria	1022
443	Ga0501048_0474212	3300049582	Bacteria	897
444	Ga0501068_0583649	3300049584	Bacteria	728
445	Ga0501070_0535734	3300049586	Bacteria	938
446	Ga0501071_0242453	3300049587	Bacteria	1359
447	Ga0501072_0106027	3300049588	Bacteria	2235
448	Ga0501072_0405459	3300049588	Bacteria	1081
449	Ga0501075_0303815	3300049591	Bacteria	1216
450	Ga0501075_0756783	3300049591	Bacteria	739
451	Ga0501076_0121796	3300049592	Bacteria	2112
452	Ga0501217_076889	3300049661	Bacteria	918
453	Ga0501233_090109	3300049668	Bacteria	800
454	Ga0501079_0207482	3300049741	Bacteria	1530
455	Ga0501081_0205156	3300049743	Bacteria	1430
456	Ga0501035_0562493	3300049822	Bacteria	933
457	Ga0501045_0129811	3300049824	Bacteria	1873
458	Ga0501045_0369348	3300049824	Bacteria	1068
459	nmdc:mga05p37_1477_c1	3300050507	Bacteria	27323
460	nmdc:mga05p37_389_c1	3300050507	Bacteria	47594
461	nmdc:mga05p37_45015_c1	3300050507	Bacteria	5429
462	nmdc:mga05p37_730304_c1	3300050507	Bacteria	1095
463	nmdc:mga09592_109_c1	3300050508	Bacteria	51482
464	nmdc:mga09592_148366_c1	3300050508	Bacteria	2023
465	nmdc:mga09592_813846_c1	3300050508	Bacteria	790
466	nmdc:mga09592_89726_c1	3300050508	Bacteria	2626
467	nmdc:mga0qj67_150257_c1	3300050509	Bacteria	1890
468	nmdc:mga0qj67_317271_c1	3300050509	Bacteria	1262
469	nmdc:mga06r32_116664_c1	3300050510	Bacteria	2631
470	nmdc:mga06r32_312616_c1	3300050510	Bacteria	1557
471	nmdc:mga06r32_419801_c1	3300050510	Bacteria	1319
472	nmdc:mga06r32_833876_c1	3300050510	Bacteria	881
473	nmdc:mga06r32_916474_c1	3300050510	Bacteria	832
474	nmdc:mga06r32_935_c1	3300050510	Bacteria	25966
475	nmdc:mga08y16_206880_c1	3300050511	Bacteria	2033
476	nmdc:mga08y16_2159_c1	3300050511	Bacteria	20171
477	nmdc:mga08y16_270127_c1	3300050511	Bacteria	1756
478	nmdc:mga08y16_458887_c1	3300050511	Bacteria	1299
479	nmdc:mga08y16_699458_c1	3300050511	Bacteria	1014
480	nmdc:mga08y16_719885_c1	3300050511	Bacteria	996
481	nmdc:mga0n895_1008568_c1	3300050512	Bacteria	813
482	nmdc:mga0n895_734_c1	3300050512	Bacteria	23141
483	nmdc:mga0n895_82802_c1	3300050512	Bacteria	3199
484	nmdc:mga0n895_96659_c1	3300050512	Bacteria	2959
485	nmdc:mga0rr50_19059_c1	3300050513	Bacteria	4622
486	nmdc:mga0rr50_284815_c1	3300050513	Bacteria	1380
487	nmdc:mga0rr50_4968_c1	3300050513	Bacteria	7875
488	nmdc:mga08x19_126002_c1	3300050514	Bacteria	1720
489	nmdc:mga08x19_258_c1	3300050514	Bacteria	28365
490	nmdc:mga08x19_49111_c1	3300050514	Bacteria	2705
491	nmdc:mga0a205_138383_c1	3300050515	Bacteria	2335
492	nmdc:mga0a205_264820_c1	3300050515	Bacteria	1596
493	nmdc:mga0a205_636105_c1	3300050515	Bacteria	918
494	Ga0495601_0190946	3300053077	Bacteria	1338
495	Ga0495619_0145689	3300053085	Bacteria	1633
496	Ga0501084_0106087	3300054114	Bacteria	2360
497	Ga0501084_0514894	3300054114	Bacteria	1011
498	Ga0501084_0535575	3300054114	Bacteria	990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005564	Ga0070664_100586678	Ga0070664_1005866781	193
2	3300005330	Ga0070690_100037543	Ga0070690_1000375432	194
3	3300005331	Ga0070670_100054569	Ga0070670_1000545693	194
4	3300005338	Ga0068868_100000335	Ga0068868_10000033519	194
5	3300005340	Ga0070689_100119950	Ga0070689_1001199502	194
6	3300005343	Ga0070687_100241197	Ga0070687_1002411972	194
7	3300005344	Ga0070661_100260851	Ga0070661_1002608512	194
8	3300005354	Ga0070675_100159814	Ga0070675_1001598142	194
9	3300005355	Ga0070671_100055210	Ga0070671_1000552102	194
10	3300005364	Ga0070673_100263450	Ga0070673_1002634502	194
11	3300005365	Ga0070688_100428311	Ga0070688_1004283112	194
12	3300005366	Ga0070659_100188444	Ga0070659_1001884442	194
13	3300005367	Ga0070667_100012500	Ga0070667_1000125008	194
14	3300005438	Ga0070701_10034459	Ga0070701_100344592	194
15	3300005456	Ga0070678_100210720	Ga0070678_1002107202	194
16	3300005459	Ga0068867_100028734	Ga0068867_1000287343	194
17	3300005466	Ga0070685_10077399	Ga0070685_100773992	194
18	3300005535	Ga0070684_100143311	Ga0070684_1001433112	194
19	3300005543	Ga0070672_100071794	Ga0070672_1000717943	194
20	3300005544	Ga0070686_100047197	Ga0070686_1000471973	194
21	3300005544	Ga0070686_100175227	Ga0070686_1001752272	194
22	3300005545	Ga0070695_100281770	Ga0070695_1002817703	194
23	3300005547	Ga0070693_100301178	Ga0070693_1003011781	194
24	3300005548	Ga0070665_100058930	Ga0070665_1000589302	194
25	3300005564	Ga0070664_100001215	Ga0070664_10000121514	194
26	3300005615	Ga0070702_100044907	Ga0070702_1000449072	194
27	3300005616	Ga0068852_100141785	Ga0068852_1001417852	194
28	3300005617	Ga0068859_100018332	Ga0068859_1000183324	194
29	3300005618	Ga0068864_100002487	Ga0068864_1000024875	194
30	3300005719	Ga0068861_100029682	Ga0068861_1000296825	194
31	3300005841	Ga0068863_100004098	Ga0068863_1000040984	194
32	3300005842	Ga0068858_100007748	Ga0068858_1000077489	194
33	3300005843	Ga0068860_100012638	Ga0068860_10001263810	194
34	3300005844	Ga0068862_100032519	Ga0068862_1000325193	194
35	3300005844	Ga0068862_100601177	Ga0068862_1006011771	194
36	3300006237	Ga0097621_100091013	Ga0097621_1000910132	194
37	3300006358	Ga0068871_100015770	Ga0068871_1000157708	194
38	3300006931	Ga0097620_100018332	Ga0097620_1000183327	194
39	3300009094	Ga0111539_10256046	Ga0111539_102560462	194
40	3300009094	Ga0111539_10331037	Ga0111539_103310371	194
41	3300009098	Ga0105245_10084550	Ga0105245_100845502	194
42	3300009098	Ga0105245_10097096	Ga0105245_100970962	194
43	3300009101	Ga0105247_10001900	Ga0105247_100019002	194
44	3300009177	Ga0105248_10000996	Ga0105248_1000099616	194
45	3300009551	Ga0105238_10034240	Ga0105238_100342403	194
46	3300009553	Ga0105249_10171717	Ga0105249_101717172	194
47	3300010375	Ga0105239_10054258	Ga0105239_100542585	194
48	3300011119	Ga0105246_10021134	Ga0105246_100211344	194
49	3300013296	Ga0157374_10004878	Ga0157374_1000487810	194
50	3300013306	Ga0163162_10005062	Ga0163162_100050622	194
51	3300013308	Ga0157375_10001598	Ga0157375_100015988	194
52	3300014325	Ga0163163_10003469	Ga0163163_100034698	194
53	3300014745	Ga0157377_10110813	Ga0157377_101108132	194
54	3300014968	Ga0157379_10071216	Ga0157379_100712164	194
55	3300014969	Ga0157376_10038255	Ga0157376_100382552	194
56	3300025927	Ga0207687_10064458	Ga0207687_100644582	194
57	3300027907	Ga0207428_10022784	Ga0207428_100227843	194
58	3300049587	Ga0501071_0242453	Ga0501071_0242453_128_721	194
59	3300049588	Ga0501072_0405459	Ga0501072_0405459_249_842	194
60	3300049591	Ga0501075_0303815	Ga0501075_0303815_95_688	194
61	3300003203	JGI25406J46586_10072759	JGI25406J46586_100727592	195
62	3300005295	Ga0065707_10135076	Ga0065707_101350762	195
63	3300005330	Ga0070690_100110629	Ga0070690_1001106292	195
64	3300005343	Ga0070687_100007312	Ga0070687_1000073124	195
65	3300005345	Ga0070692_10281682	Ga0070692_102816822	195
66	3300005365	Ga0070688_100062812	Ga0070688_1000628122	195
67	3300005434	Ga0070709_10626965	Ga0070709_106269651	195
68	3300005437	Ga0070710_10022381	Ga0070710_100223812	195
69	3300005438	Ga0070701_10313846	Ga0070701_103138462	195
70	3300005439	Ga0070711_100487665	Ga0070711_1004876651	195
71	3300005444	Ga0070694_100301643	Ga0070694_1003016432	195
72	3300005444	Ga0070694_100619797	Ga0070694_1006197971	195
73	3300005459	Ga0068867_100191895	Ga0068867_1001918952	195
74	3300005459	Ga0068867_100977852	Ga0068867_1009778521	195
75	3300005471	Ga0070698_100004625	Ga0070698_10000462518	195
76	3300005544	Ga0070686_100004514	Ga0070686_1000045142	195
77	3300005544	Ga0070686_100120219	Ga0070686_1001202192	195
78	3300005544	Ga0070686_100427980	Ga0070686_1004279801	195
79	3300005549	Ga0070704_100024253	Ga0070704_1000242534	195
80	3300005615	Ga0070702_100025144	Ga0070702_1000251442	195
81	3300005617	Ga0068859_100009581	Ga0068859_1000095812	195
82	3300005844	Ga0068862_100268759	Ga0068862_1002687592	195
83	3300005985	Ga0081539_10005168	Ga0081539_1000516814	195
84	3300006237	Ga0097621_100000756	Ga0097621_10000075621	195
85	3300006358	Ga0068871_100000588	Ga0068871_10000058823	195
86	3300006844	Ga0075428_100047983	Ga0075428_1000479835	195
87	3300006844	Ga0075428_100512694	Ga0075428_1005126942	195
88	3300006847	Ga0075431_100003185	Ga0075431_10000318510	195
89	3300006847	Ga0075431_100018868	Ga0075431_1000188688	195
90	3300006847	Ga0075431_100226086	Ga0075431_1002260862	195
91	3300006871	Ga0075434_100000079	Ga0075434_10000007942	195
92	3300006880	Ga0075429_100000100	Ga0075429_10000010026	195
93	3300006914	Ga0075436_100050994	Ga0075436_1000509943	195
94	3300006914	Ga0075436_100139906	Ga0075436_1001399062	195
95	3300006914	Ga0075436_100421151	Ga0075436_1004211512	195
96	3300006931	Ga0097620_100009581	Ga0097620_1000095812	195
97	3300007076	Ga0075435_100034795	Ga0075435_1000347954	195
98	3300007076	Ga0075435_100168309	Ga0075435_1001683092	195
99	3300009094	Ga0111539_10501548	Ga0111539_105015482	195
100	3300009147	Ga0114129_10046021	Ga0114129_100460213	195
101	3300009147	Ga0114129_10523218	Ga0114129_105232182	195
102	3300009147	Ga0114129_10986958	Ga0114129_109869582	195
103	3300014969	Ga0157376_10049068	Ga0157376_100490682	195
104	3300025898	Ga0207692_10006506	Ga0207692_100065062	195
105	3300025918	Ga0207662_10016360	Ga0207662_100163602	195
106	3300025918	Ga0207662_10101076	Ga0207662_101010762	195
107	3300025918	Ga0207662_10415433	Ga0207662_104154332	195
108	3300026089	Ga0207648_10325825	Ga0207648_103258252	195
109	3300026118	Ga0207675_100981812	Ga0207675_1009818122	195
110	3300027395	Ga0209996_1024773	Ga0209996_10247732	195
111	3300031901	Ga0307406_10255488	Ga0307406_102554882	195
112	3300032002	Ga0307416_100632115	Ga0307416_1006321152	195
113	3300032005	Ga0307411_10237922	Ga0307411_102379222	195
114	3300035085	Ga0373929_0090369	Ga0373929_0090369_139_735	195
115	3300035114	Ga0373939_0016174	Ga0373939_0016174_837_1433	195
116	3300035114	Ga0373939_0038608	Ga0373939_0038608_120_716	195
117	3300035115	Ga0373941_0059758	Ga0373941_0059758_117_713	195
118	3300035117	Ga0373953_0179777	Ga0373953_0179777_283_879	195
119	3300035119	Ga0373956_0010842	Ga0373956_0010842_941_1537	195
120	3300035121	Ga0373960_0021781	Ga0373960_0021781_657_1253	195
121	3300035172	Ga0373955_0075760	Ga0373955_0075760_1277_1873	195
122	3300035207	Ga0373942_0016813	Ga0373942_0016813_856_1452	195
123	3300035241	Ga0373961_0182075	Ga0373961_0182075_53_649	195
124	3300035691	Ga0373931_0005360	Ga0373931_0005360_2670_3266	195
125	3300035691	Ga0373931_0057668	Ga0373931_0057668_617_1213	195
126	3300035695	Ga0373927_0473963	Ga0373927_0473963_24_620	195
127	3300035724	Ga0373933_0006341	Ga0373933_0006341_5470_6066	195
128	3300041406	Ga0439439_0124337	Ga0439439_0124337_82_678	195
129	3300042156	Ga0439446_0048707	Ga0439446_0048707_506_1102	195
130	3300042435	Ga0439434_0021316	Ga0439434_0021316_323_919	195
131	3300042436	Ga0439435_0024538	Ga0439435_0024538_437_1033	195
132	3300044735	Ga0466968_0200911	Ga0466968_0200911_227_823	195
133	3300046491	Ga0495584_0126393	Ga0495584_0126393_346_942	195
134	3300046663	Ga0495635_0263133	Ga0495635_0263133_285_881	195
135	3300046664	Ga0495659_0024738	Ga0495659_0024738_996_1592	195
136	3300046684	Ga0495669_0039020	Ga0495669_0039020_1367_1963	195
137	3300047318	Ga0495636_0107051	Ga0495636_0107051_168_764	195
138	3300047318	Ga0495636_0298485	Ga0495636_0298485_36_632	195
139	3300049582	Ga0501048_0474212	Ga0501048_0474212_172_768	195
140	3300049661	Ga0501217_076889	Ga0501217_076889_158_754	195
141	3300049668	Ga0501233_090109	Ga0501233_090109_183_779	195
142	3300050507	nmdc:mga05p37_1477_c1	nmdc:mga05p37_1477_c1_22856_23449	195
143	3300050507	nmdc:mga05p37_45015_c1	nmdc:mga05p37_45015_c1_4808_5404	195
144	3300050508	nmdc:mga09592_109_c1	nmdc:mga09592_109_c1_28577_29170	195
145	3300050510	nmdc:mga06r32_312616_c1	nmdc:mga06r32_312616_c1_529_1125	195
146	3300050510	nmdc:mga06r32_419801_c1	nmdc:mga06r32_419801_c1_547_1140	195
147	3300050510	nmdc:mga06r32_935_c1	nmdc:mga06r32_935_c1_22044_22637	195
148	3300050511	nmdc:mga08y16_699458_c1	nmdc:mga08y16_699458_c1_214_810	195
149	3300050512	nmdc:mga0n895_734_c1	nmdc:mga0n895_734_c1_11639_12235	195
150	3300050512	nmdc:mga0n895_96659_c1	nmdc:mga0n895_96659_c1_1422_2018	195
151	3300050513	nmdc:mga0rr50_284815_c1	nmdc:mga0rr50_284815_c1_501_1097	195
152	3300050513	nmdc:mga0rr50_4968_c1	nmdc:mga0rr50_4968_c1_996_1592	195
153	3300050514	nmdc:mga08x19_126002_c1	nmdc:mga08x19_126002_c1_70_666	195
154	3300050514	nmdc:mga08x19_49111_c1	nmdc:mga08x19_49111_c1_1595_2191	195
155	3300050515	nmdc:mga0a205_138383_c1	nmdc:mga0a205_138383_c1_749_1345	195
156	3300050515	nmdc:mga0a205_636105_c1	nmdc:mga0a205_636105_c1_58_651	195
157	3300005290	Ga0065712_10095071	Ga0065712_100950713	196
158	3300005328	Ga0070676_10041691	Ga0070676_100416913	196
159	3300005329	Ga0070683_100017908	Ga0070683_1000179082	196
160	3300005331	Ga0070670_100000692	Ga0070670_10000069225	196
161	3300005335	Ga0070666_10064666	Ga0070666_100646662	196
162	3300005336	Ga0070680_100014890	Ga0070680_1000148902	196
163	3300005338	Ga0068868_100000253	Ga0068868_1000002539	196
164	3300005340	Ga0070689_100101927	Ga0070689_1001019272	196
165	3300005340	Ga0070689_100427460	Ga0070689_1004274601	196
166	3300005345	Ga0070692_10052510	Ga0070692_100525102	196
167	3300005345	Ga0070692_10083302	Ga0070692_100833021	196
168	3300005347	Ga0070668_100013138	Ga0070668_1000131386	196
169	3300005347	Ga0070668_101082335	Ga0070668_1010823351	196
170	3300005353	Ga0070669_100009032	Ga0070669_1000090324	196
171	3300005354	Ga0070675_100011075	Ga0070675_1000110759	196
172	3300005354	Ga0070675_100267484	Ga0070675_1002674842	196
173	3300005355	Ga0070671_100000871	Ga0070671_10000087121	196
174	3300005356	Ga0070674_100048152	Ga0070674_1000481522	196
175	3300005356	Ga0070674_100048850	Ga0070674_1000488502	196
176	3300005364	Ga0070673_100006599	Ga0070673_1000065992	196
177	3300005441	Ga0070700_100001780	Ga0070700_10000178010	196
178	3300005441	Ga0070700_100609426	Ga0070700_1006094261	196
179	3300005444	Ga0070694_100004413	Ga0070694_10000441310	196
180	3300005444	Ga0070694_100102503	Ga0070694_1001025032	196
181	3300005444	Ga0070694_100164501	Ga0070694_1001645012	196
182	3300005455	Ga0070663_100222637	Ga0070663_1002226372	196
183	3300005456	Ga0070678_100002100	Ga0070678_1000021008	196
184	3300005457	Ga0070662_100030797	Ga0070662_1000307972	196
185	3300005459	Ga0068867_100000755	Ga0068867_10000075514	196
186	3300005459	Ga0068867_100913622	Ga0068867_1009136221	196
187	3300005518	Ga0070699_100008120	Ga0070699_1000081202	196
188	3300005539	Ga0068853_100216395	Ga0068853_1002163952	196
189	3300005543	Ga0070672_100000946	Ga0070672_10000094620	196
190	3300005543	Ga0070672_100542028	Ga0070672_1005420281	196
191	3300005544	Ga0070686_100059841	Ga0070686_1000598412	196
192	3300005544	Ga0070686_100513707	Ga0070686_1005137071	196
193	3300005545	Ga0070695_100175784	Ga0070695_1001757842	196
194	3300005546	Ga0070696_100092181	Ga0070696_1000921812	196
195	3300005546	Ga0070696_100237649	Ga0070696_1002376492	196
196	3300005546	Ga0070696_100308844	Ga0070696_1003088441	196
197	3300005547	Ga0070693_100052778	Ga0070693_1000527783	196
198	3300005549	Ga0070704_100102998	Ga0070704_1001029982	196
199	3300005564	Ga0070664_100000920	Ga0070664_1000009202	196
200	3300005577	Ga0068857_100203299	Ga0068857_1002032992	196
201	3300005578	Ga0068854_100000716	Ga0068854_10000071625	196
202	3300005615	Ga0070702_100006708	Ga0070702_1000067083	196
203	3300005615	Ga0070702_100241271	Ga0070702_1002412712	196
204	3300005616	Ga0068852_100001420	Ga0068852_1000014202	196
205	3300005618	Ga0068864_100006138	Ga0068864_1000061382	196
206	3300005719	Ga0068861_100002389	Ga0068861_10000238910	196
207	3300005834	Ga0068851_10005262	Ga0068851_100052622	196
208	3300005841	Ga0068863_101478478	Ga0068863_1014784781	196
209	3300005844	Ga0068862_100005268	Ga0068862_1000052682	196
210	3300005844	Ga0068862_100094651	Ga0068862_1000946512	196
211	3300006173	Ga0070716_100228381	Ga0070716_1002283812	196
212	3300006358	Ga0068871_100000538	Ga0068871_1000005389	196
213	3300006844	Ga0075428_100000183	Ga0075428_10000018313	196
214	3300006844	Ga0075428_100604203	Ga0075428_1006042031	196
215	3300006846	Ga0075430_100133426	Ga0075430_1001334262	196
216	3300006846	Ga0075430_100158657	Ga0075430_1001586572	196
217	3300006847	Ga0075431_100144931	Ga0075431_1001449312	196
218	3300006847	Ga0075431_100458568	Ga0075431_1004585682	196
219	3300006847	Ga0075431_100923584	Ga0075431_1009235841	196
220	3300006852	Ga0075433_10020641	Ga0075433_100206412	196
221	3300006871	Ga0075434_100047627	Ga0075434_1000476272	196
222	3300006871	Ga0075434_101733835	Ga0075434_1017338351	196
223	3300006880	Ga0075429_100000891	Ga0075429_10000089125	196
224	3300006880	Ga0075429_100262391	Ga0075429_1002623912	196
225	3300006881	Ga0068865_100336057	Ga0068865_1003360572	196
226	3300006914	Ga0075436_100000529	Ga0075436_10000052920	196
227	3300006914	Ga0075436_100019207	Ga0075436_1000192073	196
228	3300007076	Ga0075435_100009301	Ga0075435_10000930110	196
229	3300009094	Ga0111539_10126660	Ga0111539_101266603	196
230	3300009094	Ga0111539_10127491	Ga0111539_101274913	196
231	3300009094	Ga0111539_10359365	Ga0111539_103593652	196
232	3300009094	Ga0111539_11059102	Ga0111539_110591022	196
233	3300009098	Ga0105245_10307590	Ga0105245_103075901	196
234	3300009147	Ga0114129_10000219	Ga0114129_1000021952	196
235	3300009147	Ga0114129_10126614	Ga0114129_101266144	196
236	3300009147	Ga0114129_10452528	Ga0114129_104525282	196
237	3300009177	Ga0105248_10096888	Ga0105248_100968882	196
238	3300009553	Ga0105249_10001388	Ga0105249_1000138811	196
239	3300013296	Ga0157374_10001144	Ga0157374_1000114425	196
240	3300013297	Ga0157378_10001459	Ga0157378_1000145910	196
241	3300013306	Ga0163162_10091681	Ga0163162_100916812	196
242	3300013306	Ga0163162_10131278	Ga0163162_101312782	196
243	3300013308	Ga0157375_10021885	Ga0157375_100218852	196
244	3300014326	Ga0157380_10003205	Ga0157380_100032052	196
245	3300014969	Ga0157376_10042110	Ga0157376_100421103	196
246	3300025901	Ga0207688_10066088	Ga0207688_100660882	196
247	3300025907	Ga0207645_10044710	Ga0207645_100447103	196
248	3300025908	Ga0207643_10050140	Ga0207643_100501402	196
249	3300025908	Ga0207643_10436799	Ga0207643_104367992	196
250	3300025917	Ga0207660_10004569	Ga0207660_100045699	196
251	3300025918	Ga0207662_10160214	Ga0207662_101602141	196
252	3300025923	Ga0207681_10002384	Ga0207681_100023844	196
253	3300025926	Ga0207659_10165079	Ga0207659_101650792	196
254	3300025929	Ga0207664_10102364	Ga0207664_101023642	196
255	3300025935	Ga0207709_10001769	Ga0207709_1000176913	196
256	3300025936	Ga0207670_10038700	Ga0207670_100387003	196
257	3300025937	Ga0207669_10032266	Ga0207669_100322662	196
258	3300025938	Ga0207704_10014501	Ga0207704_100145015	196
259	3300025939	Ga0207665_10063934	Ga0207665_100639343	196
260	3300025942	Ga0207689_10028985	Ga0207689_100289859	196
261	3300025960	Ga0207651_10716519	Ga0207651_107165192	196
262	3300025961	Ga0207712_10001259	Ga0207712_100012597	196
263	3300026075	Ga0207708_10003160	Ga0207708_1000316010	196
264	3300026089	Ga0207648_10002409	Ga0207648_100024094	196
265	3300026116	Ga0207674_10159011	Ga0207674_101590112	196
266	3300026116	Ga0207674_10253454	Ga0207674_102534542	196
267	3300026118	Ga0207675_100000812	Ga0207675_10000081210	196
268	3300027364	Ga0209967_1010089	Ga0209967_10100892	196
269	3300027471	Ga0209995_1008652	Ga0209995_10086522	196
270	3300027471	Ga0209995_1014491	Ga0209995_10144912	196
271	3300027543	Ga0209999_1016122	Ga0209999_10161222	196
272	3300027552	Ga0209982_1017167	Ga0209982_10171672	196
273	3300027665	Ga0209983_1003587	Ga0209983_10035872	196
274	3300027695	Ga0209966_1010900	Ga0209966_10109002	196
275	3300027907	Ga0207428_10000290	Ga0207428_1000029024	196
276	3300027907	Ga0207428_10168357	Ga0207428_101683572	196
277	3300028380	Ga0268265_10001159	Ga0268265_100011594	196
278	3300028380	Ga0268265_10623461	Ga0268265_106234612	196
279	3300031548	Ga0307408_100368792	Ga0307408_1003687922	196
280	3300032005	Ga0307411_10414403	Ga0307411_104144032	196
281	3300032126	Ga0307415_101195241	Ga0307415_1011952411	196
282	3300034816	Ga0373930_0067973	Ga0373930_0067973_69_668	196
283	3300034817	Ga0373948_0032267	Ga0373948_0032267_157_756	196
284	3300035084	Ga0373928_0039404	Ga0373928_0039404_61_660	196
285	3300035085	Ga0373929_0016652	Ga0373929_0016652_717_1316	196
286	3300035088	Ga0373940_0003492	Ga0373940_0003492_2347_2946	196
287	3300035088	Ga0373940_0204976	Ga0373940_0204976_15_608	196
288	3300035091	Ga0373951_0006160	Ga0373951_0006160_990_1589	196
289	3300035092	Ga0373952_0005542	Ga0373952_0005542_1655_2254	196
290	3300035112	Ga0373932_0013057	Ga0373932_0013057_110_709	196
291	3300035114	Ga0373939_0028964	Ga0373939_0028964_238_906	196
292	3300035115	Ga0373941_0059200	Ga0373941_0059200_258_857	196
293	3300035121	Ga0373960_0116199	Ga0373960_0116199_55_654	196
294	3300035242	Ga0373962_0005071	Ga0373962_0005071_1047_1646	196
295	3300035691	Ga0373931_0001802	Ga0373931_0001802_5722_6321	196
296	3300035724	Ga0373933_0217492	Ga0373933_0217492_388_981	196
297	3300036401	Ga0373937_0058441	Ga0373937_0058441_2041_2640	196
298	3300041408	Ga0439453_0043531	Ga0439453_0043531_53_652	196
299	3300042001	Ga0439441_004260	Ga0439441_004260_1483_2082	196
300	3300042001	Ga0439441_005186	Ga0439441_005186_565_1164	196
301	3300042003	Ga0439443_032446	Ga0439443_032446_126_725	196
302	3300042116	Ga0450912_011132	Ga0450912_011132_115_714	196
303	3300042156	Ga0439446_0046435	Ga0439446_0046435_106_705	196
304	3300042436	Ga0439435_0000637	Ga0439435_0000637_4268_4867	196
305	3300042461	Ga0439460_0000557	Ga0439460_0000557_183_782	196
306	3300042461	Ga0439460_0020445	Ga0439460_0020445_999_1598	196
307	3300044706	Ga0466964_0250336	Ga0466964_0250336_11_610	196
308	3300045051	Ga0451576_0039620	Ga0451576_0039620_1816_2415	196
309	3300045051	Ga0451576_0171903	Ga0451576_0171903_994_1593	196
310	3300045976	Ga0466967_0036209	Ga0466967_0036209_476_1087	196
311	3300046454	Ga0495592_0007717	Ga0495592_0007717_3296_3895	196
312	3300046455	Ga0495603_0467850	Ga0495603_0467850_34_633	196
313	3300046463	Ga0495653_0140740	Ga0495653_0140740_293_892	196
314	3300046476	Ga0495662_0031378	Ga0495662_0031378_893_1492	196
315	3300046511	Ga0495608_0000767	Ga0495608_0000767_10615_11214	196
316	3300046514	Ga0495618_0375916	Ga0495618_0375916_92_691	196
317	3300046516	Ga0495628_0003354	Ga0495628_0003354_352_951	196
318	3300046516	Ga0495628_0500877	Ga0495628_0500877_74_673	196
319	3300046517	Ga0495630_0179065	Ga0495630_0179065_264_863	196
320	3300046517	Ga0495630_0308015	Ga0495630_0308015_465_1064	196
321	3300046526	Ga0495666_0013034	Ga0495666_0013034_231_830	196
322	3300046529	Ga0495652_0115537	Ga0495652_0115537_1073_1672	196
323	3300046533	Ga0495640_0028394	Ga0495640_0028394_27_626	196
324	3300046533	Ga0495640_0070485	Ga0495640_0070485_461_1060	196
325	3300046535	Ga0495586_0036953	Ga0495586_0036953_51_650	196
326	3300046536	Ga0495587_0263968	Ga0495587_0263968_316_915	196
327	3300046537	Ga0495598_0095539	Ga0495598_0095539_136_744	196
328	3300046543	Ga0495645_0105574	Ga0495645_0105574_1164_1763	196
329	3300046642	Ga0495634_0000957	Ga0495634_0000957_1424_2023	196
330	3300046663	Ga0495635_0035463	Ga0495635_0035463_2361_2960	196
331	3300046663	Ga0495635_0318359	Ga0495635_0318359_228_827	196
332	3300046678	Ga0495599_0038809	Ga0495599_0038809_350_949	196
333	3300046678	Ga0495599_0342029	Ga0495599_0342029_287_886	196
334	3300046689	Ga0495613_0005199	Ga0495613_0005199_6840_7439	196
335	3300046690	Ga0495624_0044965	Ga0495624_0044965_934_1533	196
336	3300046690	Ga0495624_0157413	Ga0495624_0157413_336_935	196
337	3300046691	Ga0495670_0171980	Ga0495670_0171980_235_840	196
338	3300046809	Ga0495600_0170460	Ga0495600_0170460_264_863	196
339	3300047317	Ga0495604_0007822	Ga0495604_0007822_6772_7371	196
340	3300047319	Ga0495674_0080391	Ga0495674_0080391_48_647	196
341	3300047322	Ga0495680_0002465	Ga0495680_0002465_1668_2267	196
342	3300047471	Ga0495684_0101522	Ga0495684_0101522_154_753	196
343	3300049521	Ga0501298_052024	Ga0501298_052024_87_695	196
344	3300049522	Ga0501299_028641	Ga0501299_028641_226_825	196
345	3300049575	Ga0501039_0249880	Ga0501039_0249880_767_1366	196
346	3300049576	Ga0501040_0012397	Ga0501040_0012397_1948_2547	196
347	3300049577	Ga0501041_0062247	Ga0501041_0062247_364_963	196
348	3300049577	Ga0501041_0446262	Ga0501041_0446262_183_776	196
349	3300049582	Ga0501048_0092405	Ga0501048_0092405_408_1007	196
350	3300049582	Ga0501048_0118817	Ga0501048_0118817_1136_1735	196
351	3300049582	Ga0501048_0370563	Ga0501048_0370563_75_674	196
352	3300049584	Ga0501068_0583649	Ga0501068_0583649_73_672	196
353	3300049586	Ga0501070_0535734	Ga0501070_0535734_140_751	196
354	3300049588	Ga0501072_0106027	Ga0501072_0106027_1134_1733	196
355	3300049591	Ga0501075_0756783	Ga0501075_0756783_124_723	196
356	3300049592	Ga0501076_0121796	Ga0501076_0121796_1340_1939	196
357	3300049741	Ga0501079_0207482	Ga0501079_0207482_682_1281	196
358	3300049743	Ga0501081_0205156	Ga0501081_0205156_293_892	196
359	3300049822	Ga0501035_0562493	Ga0501035_0562493_167_766	196
360	3300049824	Ga0501045_0129811	Ga0501045_0129811_144_743	196
361	3300049824	Ga0501045_0369348	Ga0501045_0369348_90_689	196
362	3300050507	nmdc:mga05p37_389_c1	nmdc:mga05p37_389_c1_29523_30122	196
363	3300050507	nmdc:mga05p37_730304_c1	nmdc:mga05p37_730304_c1_186_785	196
364	3300050508	nmdc:mga09592_148366_c1	nmdc:mga09592_148366_c1_449_1048	196
365	3300050508	nmdc:mga09592_813846_c1	nmdc:mga09592_813846_c1_62_661	196
366	3300050508	nmdc:mga09592_89726_c1	nmdc:mga09592_89726_c1_1974_2573	196
367	3300050509	nmdc:mga0qj67_150257_c1	nmdc:mga0qj67_150257_c1_633_1232	196
368	3300050509	nmdc:mga0qj67_317271_c1	nmdc:mga0qj67_317271_c1_216_815	196
369	3300050510	nmdc:mga06r32_116664_c1	nmdc:mga06r32_116664_c1_1013_1612	196
370	3300050510	nmdc:mga06r32_833876_c1	nmdc:mga06r32_833876_c1_62_661	196
371	3300050510	nmdc:mga06r32_916474_c1	nmdc:mga06r32_916474_c1_54_653	196
372	3300050511	nmdc:mga08y16_2159_c1	nmdc:mga08y16_2159_c1_1793_2392	196
373	3300050511	nmdc:mga08y16_270127_c1	nmdc:mga08y16_270127_c1_240_839	196
374	3300050511	nmdc:mga08y16_458887_c1	nmdc:mga08y16_458887_c1_413_1012	196
375	3300050511	nmdc:mga08y16_719885_c1	nmdc:mga08y16_719885_c1_76_687	196
376	3300050512	nmdc:mga0n895_1008568_c1	nmdc:mga0n895_1008568_c1_105_773	196
377	3300050512	nmdc:mga0n895_82802_c1	nmdc:mga0n895_82802_c1_414_1013	196
378	3300050513	nmdc:mga0rr50_19059_c1	nmdc:mga0rr50_19059_c1_254_853	196
379	3300050514	nmdc:mga08x19_258_c1	nmdc:mga08x19_258_c1_19977_20576	196
380	3300050515	nmdc:mga0a205_264820_c1	nmdc:mga0a205_264820_c1_219_818	196
381	3300053077	Ga0495601_0190946	Ga0495601_0190946_722_1321	196
382	3300053085	Ga0495619_0145689	Ga0495619_0145689_774_1373	196
383	3300054114	Ga0501084_0106087	Ga0501084_0106087_1726_2337	196
384	3300054114	Ga0501084_0514894	Ga0501084_0514894_327_926	196
385	3300054114	Ga0501084_0535575	Ga0501084_0535575_163_762	196
386	3300002076	JGI24749J21850_1023398	JGI24749J21850_10233981	197
387	3300005290	Ga0065712_10026191	Ga0065712_100261912	197
388	3300005328	Ga0070676_10150691	Ga0070676_101506911	197
389	3300005330	Ga0070690_100006988	Ga0070690_1000069886	197
390	3300005331	Ga0070670_100069883	Ga0070670_1000698831	197
391	3300005333	Ga0070677_10023392	Ga0070677_100233922	197
392	3300005334	Ga0068869_100242138	Ga0068869_1002421381	197
393	3300005335	Ga0070666_10005764	Ga0070666_100057647	197
394	3300005338	Ga0068868_100078446	Ga0068868_1000784463	197
395	3300005340	Ga0070689_100058505	Ga0070689_1000585052	197
396	3300005343	Ga0070687_100045160	Ga0070687_1000451602	197
397	3300005345	Ga0070692_10104590	Ga0070692_101045902	197
398	3300005353	Ga0070669_100661548	Ga0070669_1006615482	197
399	3300005354	Ga0070675_100135643	Ga0070675_1001356431	197
400	3300005355	Ga0070671_100023686	Ga0070671_1000236863	197
401	3300005356	Ga0070674_100009950	Ga0070674_1000099504	197
402	3300005365	Ga0070688_100127594	Ga0070688_1001275942	197
403	3300005367	Ga0070667_100026243	Ga0070667_1000262431	197
404	3300005438	Ga0070701_10035562	Ga0070701_100355622	197
405	3300005441	Ga0070700_100101124	Ga0070700_1001011242	197
406	3300005456	Ga0070678_100088868	Ga0070678_1000888683	197
407	3300005459	Ga0068867_100004732	Ga0068867_1000047329	197
408	3300005466	Ga0070685_10071277	Ga0070685_100712772	197
409	3300005543	Ga0070672_100409341	Ga0070672_1004093411	197
410	3300005544	Ga0070686_100053743	Ga0070686_1000537433	197
411	3300005548	Ga0070665_100008313	Ga0070665_1000083136	197
412	3300005549	Ga0070704_100190680	Ga0070704_1001906802	197
413	3300005615	Ga0070702_100017647	Ga0070702_1000176472	197
414	3300005616	Ga0068852_100297555	Ga0068852_1002975552	197
415	3300005617	Ga0068859_100071697	Ga0068859_1000716971	197
416	3300005618	Ga0068864_100524385	Ga0068864_1005243851	197
417	3300005718	Ga0068866_10002262	Ga0068866_100022622	197
418	3300005719	Ga0068861_100167656	Ga0068861_1001676562	197
419	3300005840	Ga0068870_10021724	Ga0068870_100217244	197
420	3300005841	Ga0068863_100041524	Ga0068863_1000415245	197
421	3300005842	Ga0068858_100005576	Ga0068858_1000055767	197
422	3300005843	Ga0068860_100019301	Ga0068860_1000193013	197
423	3300005844	Ga0068862_100239382	Ga0068862_1002393822	197
424	3300006028	Ga0070717_10306145	Ga0070717_103061452	197
425	3300006237	Ga0097621_100174574	Ga0097621_1001745742	197
426	3300006358	Ga0068871_100078171	Ga0068871_1000781713	197
427	3300006881	Ga0068865_100023283	Ga0068865_1000232832	197
428	3300006931	Ga0097620_100071698	Ga0097620_1000716981	197
429	3300009094	Ga0111539_10384406	Ga0111539_103844062	197
430	3300009101	Ga0105247_10388818	Ga0105247_103888181	197
431	3300009148	Ga0105243_10019980	Ga0105243_100199807	197
432	3300009176	Ga0105242_10009338	Ga0105242_100093389	197
433	3300009177	Ga0105248_10146841	Ga0105248_101468412	197
434	3300009553	Ga0105249_10161784	Ga0105249_101617842	197
435	3300011119	Ga0105246_10179684	Ga0105246_101796842	197
436	3300013296	Ga0157374_10359895	Ga0157374_103598952	197
437	3300013297	Ga0157378_10027021	Ga0157378_100270214	197
438	3300013308	Ga0157375_10285995	Ga0157375_102859951	197
439	3300014325	Ga0163163_11342836	Ga0163163_113428361	197
440	3300014326	Ga0157380_10022469	Ga0157380_100224692	197
441	3300014968	Ga0157379_10031299	Ga0157379_100312996	197
442	3300014969	Ga0157376_10255716	Ga0157376_102557162	197
443	3300017792	Ga0163161_10146191	Ga0163161_101461912	197
444	3300025315	Ga0207697_10004840	Ga0207697_100048406	197
445	3300025893	Ga0207682_10001648	Ga0207682_100016486	197
446	3300025899	Ga0207642_10021483	Ga0207642_100214832	197
447	3300025901	Ga0207688_10002462	Ga0207688_100024628	197
448	3300025903	Ga0207680_10143620	Ga0207680_101436202	197
449	3300025907	Ga0207645_10004080	Ga0207645_100040809	197
450	3300025908	Ga0207643_10229869	Ga0207643_102298692	197
451	3300025918	Ga0207662_10002404	Ga0207662_100024047	197
452	3300025926	Ga0207659_10019737	Ga0207659_100197374	197
453	3300025927	Ga0207687_10048289	Ga0207687_100482892	197
454	3300025931	Ga0207644_10020554	Ga0207644_100205545	197
455	3300025933	Ga0207706_10008535	Ga0207706_100085357	197
456	3300025934	Ga0207686_10006580	Ga0207686_100065805	197
457	3300025935	Ga0207709_10013788	Ga0207709_100137885	197
458	3300025936	Ga0207670_10066166	Ga0207670_100661662	197
459	3300025937	Ga0207669_10005096	Ga0207669_100050962	197
460	3300025940	Ga0207691_10024247	Ga0207691_100242474	197
461	3300025941	Ga0207711_10109623	Ga0207711_101096231	197
462	3300025942	Ga0207689_10011799	Ga0207689_100117995	197
463	3300025945	Ga0207679_10685301	Ga0207679_106853012	197
464	3300025960	Ga0207651_10183914	Ga0207651_101839142	197
465	3300025961	Ga0207712_10232976	Ga0207712_102329762	197
466	3300025981	Ga0207640_10009769	Ga0207640_100097693	197
467	3300025986	Ga0207658_10008059	Ga0207658_100080595	197
468	3300026023	Ga0207677_10233395	Ga0207677_102333951	197
469	3300026035	Ga0207703_10005644	Ga0207703_100056447	197
470	3300026067	Ga0207678_10069966	Ga0207678_100699662	197
471	3300026075	Ga0207708_10006003	Ga0207708_100060038	197
472	3300026088	Ga0207641_10126977	Ga0207641_101269772	197
473	3300026089	Ga0207648_10006783	Ga0207648_1000678313	197
474	3300026095	Ga0207676_10039613	Ga0207676_100396133	197
475	3300026095	Ga0207676_10241561	Ga0207676_102415612	197
476	3300026116	Ga0207674_10089706	Ga0207674_100897061	197
477	3300026118	Ga0207675_100005706	Ga0207675_1000057067	197
478	3300026121	Ga0207683_10052956	Ga0207683_100529562	197
479	3300026142	Ga0207698_10220197	Ga0207698_102201972	197
480	3300028380	Ga0268265_10428860	Ga0268265_104288601	197
481	3300028577	Ga0265318_10004501	Ga0265318_100045018	197
482	3300028800	Ga0265338_10313481	Ga0265338_103134812	197
483	3300031238	Ga0265332_10006633	Ga0265332_100066335	197
484	3300031240	Ga0265320_10144831	Ga0265320_101448312	197
485	3300031242	Ga0265329_10005964	Ga0265329_100059646	197
486	3300031250	Ga0265331_10001042	Ga0265331_100010429	197
487	3300031251	Ga0265327_10099100	Ga0265327_100991002	197
488	3300031344	Ga0265316_10017607	Ga0265316_100176073	197
489	3300031711	Ga0265314_10000488	Ga0265314_1000048840	197
490	3300031712	Ga0265342_10016954	Ga0265342_100169542	197
491	3300045051	Ga0451576_0841132	Ga0451576_0841132_260_853	197
492	3300046528	Ga0495642_0102833	Ga0495642_0102833_72_665	197
493	3300046537	Ga0495598_0021521	Ga0495598_0021521_133_726	197
494	3300046539	Ga0495621_0127553	Ga0495621_0127553_250_843	197
495	3300046684	Ga0495669_0164111	Ga0495669_0164111_134_727	197
496	3300048911	Ga0496108_0064169	Ga0496108_0064169_973_1566	197
497	3300048915	Ga0496112_0662318	Ga0496112_0662318_233_826	197
498	3300050511	nmdc:mga08y16_206880_c1	nmdc:mga08y16_206880_c1_713_1306	197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10399

UCR_Fe-S_N

Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

1

40

0.85 PF00355

Rieske

Rieske [2Fe-2S] domain

107

180

0.78 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7yra-assembly1.cif.gz_B	crystal structure of [2fe-2s]-ttpeta	0.9251	50	192
7yra-assembly1.cif.gz_B	crystal structure of [2fe-2s]-ttpeta	0.9006	50	192
8smr-assembly1.cif.gz_C	cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa	0.8642	30	193
8q1b-assembly1.cif.gz_P	iii2-iv1 respiratory supercomplex from s. pombe	0.8572	46	191
3h1i-assembly1.cif.gz_E	stigmatellin and antimycin bound cytochrome bc1 complex from chicken	0.8563	48	191

ID	Description	Score	Start	End	Superfamily
3qitA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.8902	61	74	3.40.50.1820
af_Q4DS82_165_295_2.102.10.10	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.8451	49	191	2.102.10.10
3l71E02	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.8239	49	191	2.102.10.10
af_Q4DS82_165_295_2.102.10.10	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.8029	49	191	2.102.10.10
2yiuC02	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.7981	46	191	2.102.10.10

ID	Description	Score	Start	End	GO Terms
AF-B8GQ89-F1-model_v4	Rieske domain-containing protein	0.9379	48	192	GO:0046872 GO:0051537
AF-A0A2M7Q2N9-F1-model_v4	Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8)	0.9359	49	191	GO:0008121 GO:0016020 GO:0046872 GO:0051537
AF-A0A350QF71-F1-model_v4	Ubiquinol-cytochrome c reductase iron-sulfur subunit	0.9334	47	197	GO:0008121 GO:0016020 GO:0046872 GO:0051537
AF-W0SD62-F1-model_v4	Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8)	0.9308	47	192	GO:0008121 GO:0016020 GO:0046872 GO:0051537
AF-A0A0W0VZJ5-F1-model_v4	Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8)	0.9304	50	197	GO:0008121 GO:0016020 GO:0046872 GO:0051537

Feature Viewer

pLDDT	pTM	Quality
77.92	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455281

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF10399

UCR_Fe-S_N

Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

1

40

0.85

PF00355

Rieske

Rieske [2Fe-2S] domain

107

180

0.78

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map