F455291

General Info

Members Datasets Scaffolds Average Seq Length
498 271 996 160

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2902330777|2902332239
Length 153
Sequence PEPGRRIVADNRAARYHYTIEDTLEAGIALTGTEVKSLRGGKATIGESYAGPSGNDLMLFNAYIPEYLEANRFNHDTKRPRRLLLHRRQIDKLIGATQRQGYTVIPLKIYFNDKGRAKVELGLGKGKQAHDKREAAKERDWQRDRARLLRDRG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
240 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
241 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
242 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2902330777 Methylobacterium sp. 2A Isolate Unclassified
252 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
253 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
254 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
255 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
256 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
257 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
258 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
259 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
260 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
261 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
262 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
263 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
264 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
265 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
266 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
267 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
268 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
269 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
270 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
271 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.2
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.48
Nodule 0.2
Rhizoplane 11.85
Rhizosphere 57.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006449 3300000546 Bacteria 1272
2 JGI24746J21847_1002274 3300001977 Bacteria 3074
3 JGI24737J22298_10032470 3300001990 Bacteria 1625
4 JGI24743J22301_10012623 3300001991 Bacteria 1540
5 JGI24735J21928_10053630 3300002067 Bacteria 1162
6 JGI24745J21846_1000815 3300002073 Bacteria 2872
7 JGI24744J21845_10020489 3300002077 Bacteria 1304
8 JGI24034J26672_10064038 3300002239 Bacteria 650
9 JGI24751J29686_10015364 3300002459 Bacteria 1579
10 Ga0055540_1002250 3300003792 Bacteria 10427
11 Ga0055540_1002955 3300003792 Bacteria 8535
12 Ga0055540_1012788 3300003792 Bacteria 2611
13 Ga0070670_100215771 3300005331 Bacteria 1669
14 Ga0068869_100144254 3300005334 Bacteria 1841
15 Ga0070666_10153731 3300005335 Bacteria 1606
16 Ga0070682_100076905 3300005337 Bacteria 2149
17 Ga0070682_100626396 3300005337 Bacteria 853
18 Ga0070682_101040131 3300005337 Bacteria 682
19 Ga0070682_101318076 3300005337 Bacteria 614
20 Ga0068868_101894370 3300005338 Bacteria 565
21 Ga0070660_100115147 3300005339 Bacteria 2143
22 Ga0070660_100599383 3300005339 Bacteria 921
23 Ga0070668_100001081 3300005347 Bacteria 19165
24 Ga0070668_100121486 3300005347 Bacteria 2088
25 Ga0070668_100814907 3300005347 Bacteria 830
26 Ga0070669_100001788 3300005353 Bacteria 15458
27 Ga0070671_100013909 3300005355 Bacteria 6493
28 Ga0070671_100142201 3300005355 Bacteria 2025
29 Ga0070674_100618204 3300005356 Bacteria 918
30 Ga0070667_100000056 3300005367 Bacteria 150952
31 Ga0070667_100082865 3300005367 Bacteria 2746
32 Ga0070667_100121812 3300005367 Bacteria 2269
33 Ga0070709_10519191 3300005434 Bacteria 907
34 Ga0070714_100010602 3300005435 Bacteria 7291
35 Ga0070714_100561429 3300005435 Bacteria 1093
36 Ga0070713_100017155 3300005436 Bacteria 5467
37 Ga0070713_100076805 3300005436 Bacteria 2838
38 Ga0070713_100513203 3300005436 Bacteria 1132
39 Ga0070710_10512331 3300005437 Bacteria 823
40 Ga0070701_10138169 3300005438 Bacteria 1391
41 Ga0070711_101021506 3300005439 Bacteria 710
42 Ga0070663_100013261 3300005455 Bacteria 5247
43 Ga0070663_100055366 3300005455 Bacteria 2839
44 Ga0070678_100361782 3300005456 Bacteria 1250
45 Ga0070678_100628388 3300005456 Bacteria 961
46 Ga0070681_11065420 3300005458 Bacteria 729
47 Ga0068867_100580036 3300005459 Bacteria 975
48 Ga0070685_10291049 3300005466 Bacteria 1097
49 Ga0070685_10901755 3300005466 Bacteria 658
50 Ga0070706_101008106 3300005467 Bacteria 768
51 Ga0070698_100150912 3300005471 Bacteria 2271
52 Ga0070698_100856106 3300005471 Bacteria 854
53 Ga0068853_100059885 3300005539 Bacteria 3290
54 Ga0068853_100148699 3300005539 Bacteria 2107
55 Ga0070672_100091029 3300005543 Bacteria 2461
56 Ga0070665_100004355 3300005548 Bacteria 14893
57 Ga0070665_100009291 3300005548 Bacteria 9951
58 Ga0070665_100535851 3300005548 Bacteria 1183
59 Ga0070665_100804631 3300005548 Bacteria 953
60 Ga0070704_100122688 3300005549 Bacteria 1999
61 Ga0068857_100531076 3300005577 Bacteria 1107
62 Ga0068854_100229823 3300005578 Bacteria 1472
63 Ga0068854_100342483 3300005578 Bacteria 1221
64 Ga0070702_100080025 3300005615 Bacteria 1954
65 Ga0068859_100001154 3300005617 Bacteria 26979
66 Ga0068859_100402697 3300005617 Bacteria 1464
67 Ga0068859_100462047 3300005617 Bacteria 1365
68 Ga0068864_100237345 3300005618 Bacteria 1688
69 Ga0068863_100000200 3300005841 Bacteria 63948
70 Ga0068863_100016741 3300005841 Bacteria 7033
71 Ga0068863_100164995 3300005841 Bacteria 2123
72 Ga0068863_100313199 3300005841 Bacteria 1524
73 Ga0068863_100556478 3300005841 Bacteria 1133
74 Ga0068858_100039249 3300005842 Bacteria 4391
75 Ga0068858_100150740 3300005842 Bacteria 2186
76 Ga0068860_100000092 3300005843 Bacteria 150190
77 Ga0068860_100027400 3300005843 Bacteria 5489
78 Ga0068860_101836098 3300005843 Bacteria 628
79 Ga0068862_100000035 3300005844 Bacteria 174953
80 Ga0068862_101172217 3300005844 Bacteria 766
81 Ga0081455_10075314 3300005937 Bacteria 2785
82 Ga0081455_10212402 3300005937 Bacteria 1441
83 Ga0075365_10009027 3300006038 Bacteria 5702
84 Ga0075365_10037358 3300006038 Bacteria 3153
85 Ga0075365_10040559 3300006038 Bacteria 3037
86 Ga0075365_10064998 3300006038 Bacteria 2445
87 Ga0075365_10157144 3300006038 Bacteria 1583
88 Ga0075365_10224698 3300006038 Bacteria 1317
89 Ga0075365_10263846 3300006038 Bacteria 1211
90 Ga0075365_10442359 3300006038 Bacteria 918
91 Ga0075363_100001517 3300006048 Bacteria 8875
92 Ga0075363_100004151 3300006048 Bacteria 6289
93 Ga0075363_100008357 3300006048 Bacteria 4815
94 Ga0075363_100008819 3300006048 Bacteria 4716
95 Ga0075363_100010987 3300006048 Bacteria 4321
96 Ga0075363_100227287 3300006048 Bacteria 1070
97 Ga0075363_100274239 3300006048 Bacteria 975
98 Ga0075364_10001382 3300006051 Bacteria 13096
99 Ga0075364_10014182 3300006051 Bacteria 4919
100 Ga0075364_10063133 3300006051 Bacteria 2432
101 Ga0075364_10080479 3300006051 Bacteria 2153
102 Ga0075364_10118756 3300006051 Bacteria 1769
103 Ga0075364_10135287 3300006051 Bacteria 1655
104 Ga0075364_10159243 3300006051 Bacteria 1523
105 Ga0075364_10174739 3300006051 Bacteria 1452
106 Ga0075364_10370926 3300006051 Bacteria 976
107 Ga0075364_10496168 3300006051 Bacteria 835
108 Ga0070716_100152173 3300006173 Bacteria 1489
109 Ga0075362_10236379 3300006177 Bacteria 896
110 Ga0075367_10181893 3300006178 Bacteria 1311
111 Ga0075367_10401587 3300006178 Bacteria 867
112 Ga0075367_10716135 3300006178 Bacteria 637
113 Ga0075369_10036143 3300006186 Bacteria 2101
114 Ga0075369_10060551 3300006186 Bacteria 1652
115 Ga0075369_10088512 3300006186 Bacteria 1380
116 Ga0075369_10121943 3300006186 Bacteria 1181
117 Ga0075369_10167236 3300006186 Bacteria 1009
118 Ga0075369_10203066 3300006186 Bacteria 915
119 Ga0075366_10194190 3300006195 Bacteria 1234
120 Ga0097621_101452724 3300006237 Bacteria 650
121 Ga0075370_10008269 3300006353 Bacteria 5346
122 Ga0075370_10054140 3300006353 Bacteria 2277
123 Ga0075370_10122347 3300006353 Bacteria 1515
124 Ga0075370_10140232 3300006353 Bacteria 1413
125 Ga0075428_100073721 3300006844 Bacteria 3728
126 Ga0075431_100066463 3300006847 Bacteria 3723
127 Ga0097620_100001154 3300006931 Bacteria 26979
128 Ga0097620_100402675 3300006931 Bacteria 1464
129 Ga0097620_100462066 3300006931 Bacteria 1365
130 Ga0105250_10156355 3300009092 Bacteria 950
131 Ga0105240_10620782 3300009093 Bacteria 1188
132 Ga0105245_10451873 3300009098 Bacteria 1293
133 Ga0105245_10750513 3300009098 Bacteria 1012
134 Ga0105247_10000328 3300009101 Bacteria 41940
135 Ga0105247_10166196 3300009101 Bacteria 1464
136 Ga0114129_10124389 3300009147 Bacteria 3547
137 Ga0105243_10981402 3300009148 Bacteria 846
138 Ga0105241_10160413 3300009174 Bacteria 1848
139 Ga0105248_10000036 3300009177 Bacteria 187421
140 Ga0105248_10761452 3300009177 Bacteria 1093
141 Ga0105248_10913095 3300009177 Bacteria 992
142 Ga0105248_11790155 3300009177 Bacteria 696
143 Ga0105237_10003512 3300009545 Bacteria 18603
144 Ga0105237_10274928 3300009545 Bacteria 1687
145 Ga0105237_10409140 3300009545 Bacteria 1361
146 Ga0105238_10401407 3300009551 Bacteria 1364
147 Ga0105238_10838123 3300009551 Bacteria 936
148 Ga0105238_11517374 3300009551 Bacteria 699
149 Ga0105249_10000046 3300009553 Bacteria 176363
150 Ga0105249_10047102 3300009553 Bacteria 3927
151 Ga0105028_129373 3300009993 Bacteria 611
152 Ga0105239_10002837 3300010375 Bacteria 21680
153 Ga0105239_10439373 3300010375 Bacteria 1479
154 Ga0105239_10698137 3300010375 Bacteria 1160
155 Ga0157369_10307410 3300013105 Bacteria 1649
156 Ga0157369_10863302 3300013105 Bacteria 929
157 Ga0157374_10008427 3300013296 Bacteria 8808
158 Ga0163162_10102851 3300013306 Bacteria 2950
159 Ga0163162_10533933 3300013306 Bacteria 1302
160 Ga0157375_10996560 3300013308 Bacteria 978
161 Ga0163163_10272578 3300014325 Bacteria 1743
162 Ga0163163_10516323 3300014325 Bacteria 1257
163 Ga0157379_10140490 3300014968 Bacteria 2177
164 Ga0163161_10517616 3300017792 Bacteria 974
165 Ga0213876_10001179 3300021384 Bacteria 16526
166 Ga0213876_10054046 3300021384 Bacteria 2121
167 Ga0213875_10007105 3300021388 Bacteria 5818
168 Ga0213875_10028573 3300021388 Bacteria 2647
169 Ga0224712_10331925 3300022467 Bacteria 716
170 Ga0209051_1001417 3300025303 Bacteria 20592
171 Ga0207696_1037026 3300025711 Bacteria 1446
172 Ga0207696_1075172 3300025711 Bacteria 936
173 Ga0207642_10162307 3300025899 Bacteria 1201
174 Ga0207710_10000060 3300025900 Bacteria 168230
175 Ga0207688_10002912 3300025901 Bacteria 9304
176 Ga0207688_10589257 3300025901 Bacteria 700
177 Ga0207643_10080976 3300025908 Bacteria 1881
178 Ga0207671_10013032 3300025914 Bacteria 6649
179 Ga0207660_10118516 3300025917 Bacteria 2002
180 Ga0207646_11073144 3300025922 Bacteria 709
181 Ga0207694_11090713 3300025924 Bacteria 676
182 Ga0207650_10107458 3300025925 Bacteria 2156
183 Ga0207687_10031737 3300025927 Bacteria 3573
184 Ga0207687_10510336 3300025927 Bacteria 1004
185 Ga0207700_10401464 3300025928 Bacteria 1201
186 Ga0207700_10548063 3300025928 Bacteria 1026
187 Ga0207664_10248595 3300025929 Bacteria 1551
188 Ga0207664_10418505 3300025929 Bacteria 1193
189 Ga0207644_10007836 3300025931 Bacteria 6976
190 Ga0207644_10245718 3300025931 Bacteria 1426
191 Ga0207690_10203560 3300025932 Bacteria 1505
192 Ga0207686_10170337 3300025934 Bacteria 1535
193 Ga0207669_10320270 3300025937 Bacteria 1186
194 Ga0207665_10343878 3300025939 Bacteria 1125
195 Ga0207691_10077171 3300025940 Bacteria 3002
196 Ga0207711_10000073 3300025941 Bacteria 107878
197 Ga0207711_10368714 3300025941 Bacteria 1331
198 Ga0207711_11252236 3300025941 Bacteria 684
199 Ga0207689_10056774 3300025942 Bacteria 3222
200 Ga0207689_10493974 3300025942 Bacteria 1025
201 Ga0207712_10000042 3300025961 Bacteria 176338
202 Ga0207668_10323011 3300025972 Bacteria 1281
203 Ga0207668_10501401 3300025972 Bacteria 1044
204 Ga0207668_10700289 3300025972 Bacteria 890
205 Ga0207640_10201126 3300025981 Bacteria 1510
206 Ga0207640_10663732 3300025981 Bacteria 890
207 Ga0207640_10948285 3300025981 Bacteria 754
208 Ga0207640_11158541 3300025981 Bacteria 686
209 Ga0207658_10000577 3300025986 Bacteria 32954
210 Ga0207658_10123755 3300025986 Bacteria 2066
211 Ga0207658_10195633 3300025986 Bacteria 1684
212 Ga0207658_10804206 3300025986 Bacteria 854
213 Ga0207703_10008462 3300026035 Bacteria 8130
214 Ga0207703_10158705 3300026035 Bacteria 1979
215 Ga0207703_10163986 3300026035 Bacteria 1948
216 Ga0207639_10063558 3300026041 Bacteria 2859
217 Ga0207639_10694192 3300026041 Bacteria 944
218 Ga0207678_10004333 3300026067 Bacteria 12737
219 Ga0207678_10071582 3300026067 Bacteria 2973
220 Ga0207708_10673346 3300026075 Bacteria 882
221 Ga0207641_10000278 3300026088 Bacteria 64322
222 Ga0207641_10020783 3300026088 Bacteria 5395
223 Ga0207641_10191888 3300026088 Bacteria 1878
224 Ga0207674_10056121 3300026116 Bacteria 4001
225 Ga0207675_100285895 3300026118 Bacteria 1603
226 Ga0209813_10009872 3300027866 Bacteria 2455
227 Ga0209813_10140347 3300027866 Bacteria 857
228 Ga0268266_10003957 3300028379 Bacteria 14380
229 Ga0268266_10037807 3300028379 Bacteria 4109
230 Ga0268266_10165643 3300028379 Bacteria 2002
231 Ga0268266_10903748 3300028379 Bacteria 854
232 Ga0268265_10000051 3300028380 Bacteria 174968
233 Ga0268265_10560159 3300028380 Bacteria 1086
234 Ga0268264_10000108 3300028381 Bacteria 208791
235 Ga0268264_10086574 3300028381 Bacteria 2692
236 Ga0268264_11150136 3300028381 Bacteria 785
237 Ga0265327_10000466 3300031251 Bacteria 71897
238 Ga0265327_10040812 3300031251 Bacteria 2506
239 Ga0307509_10325296 3300031507 Bacteria 1272
240 Ga0307405_10716066 3300031731 Bacteria 830
241 Ga0307518_10000634 3300031838 Bacteria 26423
242 Ga0307410_10426963 3300031852 Bacteria 1076
243 Ga0326468_10005318 3300031889 Bacteria 1154
244 Ga0307406_10542319 3300031901 Bacteria 950
245 Ga0307406_10686495 3300031901 Bacteria 853
246 Ga0307409_100038656 3300031995 Bacteria 3532
247 Ga0307416_100046443 3300032002 Bacteria 3427
248 Ga0307415_100302093 3300032126 Bacteria 1326
249 Ga0307415_100728710 3300032126 Bacteria 898
250 Ga0307507_10010997 3300033179 Bacteria 11523
251 Ga0307510_10104379 3300033180 Bacteria 2607
252 Ga0373949_0012956 3300035090 Bacteria 1848
253 Ga0373952_0090888 3300035092 Bacteria 793
254 Ga0373955_0302765 3300035172 Bacteria 964
255 Ga0316574_0123094 3300035398 Bacteria 1666
256 Ga0316582_0713417 3300036647 Bacteria 689
257 Ga0316584_0394812 3300036712 Bacteria 986
258 Ga0395898_0123139 3300037466 Bacteria 2485
259 Ga0436364_0318362 3300037853 Bacteria 9321
260 Ga0436364_1062752 3300037853 Bacteria 5918
261 Ga0436365_0131159 3300039437 Bacteria 1116
262 Ga0436365_0242996 3300039437 Bacteria 10958
263 Ga0436365_1358234 3300039437 Bacteria 7267
264 Ga0439461_0014013 3300041410 Bacteria 1518
265 Ga0439461_0020150 3300041410 Bacteria 1318
266 Ga0439461_0041142 3300041410 Bacteria 999
267 Ga0439466_0016588 3300041411 Bacteria 2659
268 Ga0439465_0001434 3300041413 Bacteria 7714
269 Ga0439465_0010843 3300041413 Bacteria 2859
270 Ga0439465_0149502 3300041413 Bacteria 833
271 Ga0451791_0654316 3300041451 Bacteria 1297
272 Ga0451793_0211108 3300041452 Bacteria 654
273 Ga0451802_1214260 3300041460 Bacteria 606
274 Ga0451802_1614210 3300041460 Bacteria 797
275 Ga0451807_0229588 3300041486 Bacteria 1299
276 Ga0451833_1005414 3300041491 Bacteria 631
277 Ga0451843_1086538 3300041509 Bacteria 788
278 Ga0451855_2037737 3300041511 Bacteria 644
279 Ga0451853_3295469 3300041512 Bacteria 983
280 Ga0451853_3972690 3300041512 Bacteria 629
281 Ga0439431_0002367 3300041997 Bacteria 4168
282 Ga0439442_024369 3300042002 Bacteria 1259
283 Ga0439445_0021754 3300042004 Bacteria 1613
284 Ga0439434_0006543 3300042435 Bacteria 3405
285 Ga0439460_0042855 3300042461 Bacteria 1335
286 Ga0466972_0001717 3300044658 Bacteria 10749
287 Ga0466972_0029387 3300044658 Bacteria 2706
288 Ga0466972_0073576 3300044658 Bacteria 1628
289 Ga0466972_0073864 3300044658 Bacteria 1625
290 Ga0466965_0033744 3300044683 Bacteria 2502
291 Ga0466966_0074898 3300044684 Bacteria 2115
292 Ga0466961_0029010 3300044693 Bacteria 3558
293 Ga0466961_0127405 3300044693 Bacteria 1596
294 Ga0466963_0029670 3300044694 Bacteria 3523
295 Ga0466963_0033815 3300044694 Bacteria 3323
296 Ga0466963_0041120 3300044694 Bacteria 3031
297 Ga0466963_0291360 3300044694 Bacteria 1147
298 Ga0466971_0018314 3300044719 Bacteria 3101
299 Ga0466968_0125061 3300044735 Bacteria 1166
300 Ga0466968_0259050 3300044735 Bacteria 828
301 Ga0466970_0013442 3300044765 Bacteria 4197
302 Ga0466970_0046536 3300044765 Bacteria 2311
303 Ga0466970_0085519 3300044765 Bacteria 1708
304 Ga0466970_0474315 3300044765 Bacteria 719
305 Ga0466957_0012130 3300044842 Bacteria 4985
306 Ga0466960_0161409 3300044901 Bacteria 1204
307 Ga0466959_0064554 3300045049 Bacteria 2658
308 Ga0466958_0414397 3300045836 Bacteria 870
309 Ga0466967_0032983 3300045976 Bacteria 4379
310 Ga0466967_0065898 3300045976 Bacteria 3226
311 Ga0466967_0178065 3300045976 Bacteria 2004
312 Ga0466967_0192848 3300045976 Bacteria 1926
313 Ga0466967_0495130 3300045976 Bacteria 1199
314 Ga0466967_0617574 3300045976 Bacteria 1071
315 Ga0466967_0627838 3300045976 Bacteria 1061
316 Ga0466967_0666389 3300045976 Bacteria 1029
317 Ga0495638_0110236 3300046460 Bacteria 1635
318 Ga0495662_0015775 3300046476 Bacteria 3667
319 Ga0495606_0203448 3300046507 Bacteria 1127
320 Ga0495648_0146274 3300046524 Bacteria 1238
321 Ga0495668_0292784 3300046616 Bacteria 892
322 Ga0495625_0119160 3300046660 Bacteria 1798
323 Ga0495635_0106911 3300046663 Bacteria 1911
324 Ga0495658_0022671 3300046683 Bacteria 3324
325 Ga0495624_0098381 3300046690 Bacteria 1802
326 Ga0495581_0029059 3300047315 Bacteria 3205
327 Ga0495674_0249691 3300047319 Bacteria 1460
328 Ga0495672_0125774 3300047320 Bacteria 1356
329 Ga0495676_0311030 3300047321 Bacteria 1060
330 Ga0495686_0001395 3300047472 Bacteria 26789
331 Ga0495614_0083446 3300048089 Bacteria 1386
332 Ga0496100_0002468 3300048903 Bacteria 9398
333 Ga0496100_0002984 3300048903 Bacteria 8710
334 Ga0496100_0040594 3300048903 Bacteria 2962
335 Ga0496100_0575300 3300048903 Bacteria 873
336 Ga0496101_0000108 3300048904 Bacteria 86290
337 Ga0496101_0008149 3300048904 Bacteria 6840
338 Ga0496101_0035431 3300048904 Bacteria 3530
339 Ga0496101_0087067 3300048904 Bacteria 2318
340 Ga0496101_0240481 3300048904 Bacteria 1409
341 Ga0496102_0000005 3300048905 Bacteria 481937
342 Ga0496102_0000131 3300048905 Bacteria 104032
343 Ga0496102_0093937 3300048905 Bacteria 2779
344 Ga0496102_0692505 3300048905 Bacteria 942
345 Ga0496102_1238653 3300048905 Bacteria 665
346 Ga0496103_0000002 3300048906 Bacteria 605387
347 Ga0496103_0001081 3300048906 Bacteria 19034
348 Ga0496104_0079615 3300048907 Bacteria 3123
349 Ga0496104_0106800 3300048907 Bacteria 2683
350 Ga0496104_1557885 3300048907 Bacteria 564
351 Ga0496105_0201428 3300048908 Bacteria 1625
352 Ga0496105_0520720 3300048908 Bacteria 931
353 Ga0496106_0070827 3300048909 Bacteria 2663
354 Ga0496106_0071311 3300048909 Bacteria 2655
355 Ga0496106_0197047 3300048909 Bacteria 1602
356 Ga0496106_0965564 3300048909 Bacteria 671
357 Ga0496107_0058368 3300048910 Bacteria 2790
358 Ga0496107_0084340 3300048910 Bacteria 2318
359 Ga0496107_0345676 3300048910 Bacteria 1107
360 Ga0496108_0006032 3300048911 Bacteria 9807
361 Ga0496108_0009351 3300048911 Bacteria 7936
362 Ga0496108_0074690 3300048911 Bacteria 2863
363 Ga0496108_0732976 3300048911 Bacteria 856
364 Ga0496109_0008079 3300048912 Bacteria 8921
365 Ga0496109_0099559 3300048912 Bacteria 2696
366 Ga0496109_0110081 3300048912 Bacteria 2561
367 Ga0496109_0177456 3300048912 Bacteria 2000
368 Ga0496109_0345064 3300048912 Bacteria 1406
369 Ga0496109_0568497 3300048912 Bacteria 1069
370 Ga0496109_1131762 3300048912 Bacteria 720
371 Ga0496110_0469860 3300048913 Bacteria 1146
372 Ga0496110_0643277 3300048913 Bacteria 960
373 Ga0496111_0348047 3300048914 Bacteria 1097
374 Ga0496111_0624267 3300048914 Bacteria 788
375 Ga0496112_0001496 3300048915 Bacteria 17983
376 Ga0496112_0058889 3300048915 Bacteria 3784
377 Ga0496112_0074313 3300048915 Bacteria 3361
378 Ga0496112_0679623 3300048915 Bacteria 958
379 Ga0496113_0013078 3300048916 Bacteria 5604
380 Ga0496113_0062508 3300048916 Bacteria 2812
381 Ga0496113_0121937 3300048916 Bacteria 2039
382 Ga0496113_0127249 3300048916 Bacteria 1996
383 Ga0496113_0342609 3300048916 Bacteria 1199
384 Ga0496113_1374814 3300048916 Bacteria 547
385 Ga0496114_0130453 3300048917 Bacteria 2170
386 Ga0496116_0000357 3300048919 Bacteria 71971
387 Ga0496116_0079635 3300048919 Bacteria 2037
388 Ga0496117_0000003 3300048920 Bacteria 1881097
389 Ga0496117_0002740 3300048920 Bacteria 21612
390 Ga0496118_0000001 3300048921 Bacteria 1881100
391 Ga0496118_0004654 3300048921 Bacteria 16095
392 Ga0496118_0304463 3300048921 Bacteria 873
393 Ga0496119_0000549 3300048922 Bacteria 51126
394 Ga0496119_0001343 3300048922 Bacteria 30105
395 Ga0496119_0011147 3300048922 Bacteria 7486
396 Ga0496120_0003584 3300048923 Bacteria 13951
397 Ga0496120_0008383 3300048923 Bacteria 7508
398 Ga0496121_0000634 3300048924 Bacteria 65664
399 Ga0496124_0165424 3300048927 Bacteria 1719
400 Ga0496125_0015512 3300048928 Bacteria 7363
401 Ga0496125_0315520 3300048928 Bacteria 950
402 Ga0496126_0000178 3300048929 Bacteria 145079
403 Ga0496126_0012000 3300048929 Bacteria 8905
404 Ga0496126_0157445 3300048929 Bacteria 1943
405 Ga0501032_0115451 3300049569 Bacteria 1775
406 Ga0501033_0505242 3300049570 Bacteria 836
407 Ga0501034_0005605 3300049571 Bacteria 13675
408 Ga0501036_0033864 3300049572 Bacteria 4321
409 Ga0501037_0000196 3300049573 Bacteria 54903
410 Ga0501038_0178024 3300049574 Bacteria 1717
411 Ga0501039_0000774 3300049575 Bacteria 22987
412 Ga0501043_0002205 3300049579 Bacteria 16606
413 Ga0501070_0144321 3300049586 Bacteria 1965
414 Ga0501073_0148233 3300049589 Bacteria 1626
415 Ga0501044_0009915 3300049823 Bacteria 10348
416 Ga0501044_0338000 3300049823 Bacteria 1427
417 nmdc:mga03683_212275_c1 3300050489 Bacteria 891
418 nmdc:mga03n38_114351_c1 3300050490 Bacteria 1319
419 nmdc:mga03n38_361349_c1 3300050490 Bacteria 792
420 nmdc:mga03n38_3754_c1 3300050490 Bacteria 4923
421 nmdc:mga00v17_106467_c1 3300050491 Bacteria 1775
422 nmdc:mga00v17_183341_c1 3300050491 Bacteria 1351
423 nmdc:mga00v17_247933_c1 3300050491 Bacteria 1155
424 nmdc:mga00v17_30313_c1 3300050491 Bacteria 3182
425 nmdc:mga00v17_307964_c1 3300050491 Bacteria 1029
426 nmdc:mga00v17_386459_c1 3300050491 Bacteria 910
427 nmdc:mga00v17_439695_c1 3300050491 Bacteria 847
428 nmdc:mga00v17_7569_c1 3300050491 Bacteria 4573
429 nmdc:mga0yw44_10916_c1 3300050492 Bacteria 4658
430 nmdc:mga0yw44_122379_c1 3300050492 Bacteria 1677
431 nmdc:mga0yw44_43545_c1 3300050492 Bacteria 2680
432 nmdc:mga0yw44_446697_c1 3300050492 Bacteria 876
433 nmdc:mga0yw44_49306_c1 3300050492 Bacteria 2541
434 nmdc:mga0k408_107068_c1 3300050493 Bacteria 1651
435 nmdc:mga06z11_144013_c1 3300050494 Bacteria 1349
436 nmdc:mga06z11_387957_c1 3300050494 Bacteria 840
437 nmdc:mga06z11_525154_c1 3300050494 Bacteria 718
438 nmdc:mga06z11_78704_c1 3300050494 Bacteria 1763
439 nmdc:mga04h51_163974_c1 3300050495 Bacteria 857
440 nmdc:mga04h51_92579_c1 3300050495 Bacteria 1090
441 nmdc:mga07m45_309327_c1 3300050496 Bacteria 919
442 nmdc:mga07m45_35435_c1 3300050496 Bacteria 2134
443 nmdc:mga07m45_374634_c1 3300050496 Bacteria 827
444 nmdc:mga07m45_56777_c1 3300050496 Bacteria 2213
445 nmdc:mga07m45_6269_c1 3300050496 Bacteria 6005
446 nmdc:mga07m45_92137_c1 3300050496 Bacteria 1737
447 nmdc:mga05p37_157185_c1 3300050507 Bacteria 2778
448 nmdc:mga0qj67_266_c1 3300050509 Bacteria 35948
449 nmdc:mga06r32_55115_c1 3300050510 Bacteria 3813
450 nmdc:mga0sz30_138797_c1 3300050516 Bacteria 1073
451 nmdc:mga0sz30_236674_c1 3300050516 Bacteria 813
452 nmdc:mga0sz30_249004_c1 3300050516 Bacteria 791
453 nmdc:mga0sz30_39793_c1 3300050516 Bacteria 1974
454 nmdc:mga0sz30_427878_c1 3300050516 Bacteria 594
455 nmdc:mga0sz30_53899_c1 3300050516 Bacteria 1709
456 nmdc:mga0sz30_64022_c1 3300050516 Bacteria 1574
457 Ga0500635_0016966 3300053080 Bacteria 2174
458 Ga0500635_0129382 3300053080 Bacteria 950
459 Ga0495619_0947310 3300053085 Bacteria 578
460 Ga0500578_0287773 3300053086 Bacteria 978
461 Ga0500578_0372808 3300053086 Bacteria 829
462 Ga0500643_017132 3300053087 Bacteria 2434
463 Ga0500643_037893 3300053087 Bacteria 1433
464 Ga0500641_0052357 3300053096 Bacteria 1682
465 Ga0500641_0196963 3300053096 Bacteria 861
466 Ga0500594_0081429 3300053118 Bacteria 969
467 Ga0500608_206816 3300053122 Bacteria 806
468 Ga0500621_217635 3300053126 Bacteria 664
469 Ga0500628_020542 3300053129 Bacteria 1329
470 Ga0500652_000657 3300053131 Bacteria 11776
471 Ga0500559_0050907 3300053136 Bacteria 1828
472 Ga0500588_0026571 3300053146 Bacteria 1621
473 Ga0500616_0069172 3300053153 Bacteria 1806
474 Ga0500620_075323 3300053155 Bacteria 1165
475 Ga0500627_0014006 3300053158 Bacteria 3061
476 Ga0500645_000032 3300053730 Bacteria 119506
477 Ga0466962_0016621 3300061719 Bacteria 3548
478 2902332239 2902330777 Bacteria 6395352
479 2586063951 2585427649 Bacteria 9053857
480 2644636208 2643221715 Bacteria 6671032
481 2676480449 2675903059 Bacteria 8644972
482 2738708620 2738541274 Bacteria 6909446
483 2739335140 2738543028 Bacteria 6917070
484 2753075323 2751185734 Bacteria 8863695
485 2776369789 2775506925 Bacteria 7237746
486 2809586798 2808606522 Bacteria 9488490
487 2842138750 2842134933 Bacteria 5847019
488 2863068839 2863067949 Bacteria 8541735
489 2866553140 2866552031 Bacteria 5824618
490 2870729303 2870721527 Bacteria 9689237
491 2899361033 2899359706 Bacteria 10940472
492 2902804341 2902799365 Bacteria 5419524
493 2902815726 2902810491 Bacteria 6794147
494 2902842170 2902837492 Bacteria 6697721
495 2929214452 2929212328 Bacteria 7708288
496 2939586308 2939582691 Bacteria 7088898
497 8003316555 8003314358 Bacteria 10575343
498 8056215448 8056207758 Bacteria 8639239
499 LJNas_1006449
500 JGI24746J21847_1002274
501 JGI24737J22298_10032470
502 JGI24743J22301_10012623
503 JGI24735J21928_10053630
504 JGI24745J21846_1000815
505 JGI24744J21845_10020489
506 JGI24034J26672_10064038
507 JGI24751J29686_10015364
508 Ga0055540_1002250
509 Ga0055540_1002955
510 Ga0055540_1012788
511 Ga0070670_100215771
512 Ga0068869_100144254
513 Ga0070666_10153731
514 Ga0070682_100076905
515 Ga0070682_100626396
516 Ga0070682_101040131
517 Ga0070682_101318076
518 Ga0068868_101894370
519 Ga0070660_100115147
520 Ga0070660_100599383
521 Ga0070668_100001081
522 Ga0070668_100121486
523 Ga0070668_100814907
524 Ga0070669_100001788
525 Ga0070671_100013909
526 Ga0070671_100142201
527 Ga0070674_100618204
528 Ga0070667_100000056
529 Ga0070667_100082865
530 Ga0070667_100121812
531 Ga0070709_10519191
532 Ga0070714_100010602
533 Ga0070714_100561429
534 Ga0070713_100017155
535 Ga0070713_100076805
536 Ga0070713_100513203
537 Ga0070710_10512331
538 Ga0070701_10138169
539 Ga0070711_101021506
540 Ga0070663_100013261
541 Ga0070663_100055366
542 Ga0070678_100361782
543 Ga0070678_100628388
544 Ga0070681_11065420
545 Ga0068867_100580036
546 Ga0070685_10291049
547 Ga0070685_10901755
548 Ga0070706_101008106
549 Ga0070698_100150912
550 Ga0070698_100856106
551 Ga0068853_100059885
552 Ga0068853_100148699
553 Ga0070672_100091029
554 Ga0070665_100004355
555 Ga0070665_100009291
556 Ga0070665_100535851
557 Ga0070665_100804631
558 Ga0070704_100122688
559 Ga0068857_100531076
560 Ga0068854_100229823
561 Ga0068854_100342483
562 Ga0070702_100080025
563 Ga0068859_100001154
564 Ga0068859_100402697
565 Ga0068859_100462047
566 Ga0068864_100237345
567 Ga0068863_100000200
568 Ga0068863_100016741
569 Ga0068863_100164995
570 Ga0068863_100313199
571 Ga0068863_100556478
572 Ga0068858_100039249
573 Ga0068858_100150740
574 Ga0068860_100000092
575 Ga0068860_100027400
576 Ga0068860_101836098
577 Ga0068862_100000035
578 Ga0068862_101172217
579 Ga0081455_10075314
580 Ga0081455_10212402
581 Ga0075365_10009027
582 Ga0075365_10037358
583 Ga0075365_10040559
584 Ga0075365_10064998
585 Ga0075365_10157144
586 Ga0075365_10224698
587 Ga0075365_10263846
588 Ga0075365_10442359
589 Ga0075363_100001517
590 Ga0075363_100004151
591 Ga0075363_100008357
592 Ga0075363_100008819
593 Ga0075363_100010987
594 Ga0075363_100227287
595 Ga0075363_100274239
596 Ga0075364_10001382
597 Ga0075364_10014182
598 Ga0075364_10063133
599 Ga0075364_10080479
600 Ga0075364_10118756
601 Ga0075364_10135287
602 Ga0075364_10159243
603 Ga0075364_10174739
604 Ga0075364_10370926
605 Ga0075364_10496168
606 Ga0070716_100152173
607 Ga0075362_10236379
608 Ga0075367_10181893
609 Ga0075367_10401587
610 Ga0075367_10716135
611 Ga0075369_10036143
612 Ga0075369_10060551
613 Ga0075369_10088512
614 Ga0075369_10121943
615 Ga0075369_10167236
616 Ga0075369_10203066
617 Ga0075366_10194190
618 Ga0097621_101452724
619 Ga0075370_10008269
620 Ga0075370_10054140
621 Ga0075370_10122347
622 Ga0075370_10140232
623 Ga0075428_100073721
624 Ga0075431_100066463
625 Ga0097620_100001154
626 Ga0097620_100402675
627 Ga0097620_100462066
628 Ga0105250_10156355
629 Ga0105240_10620782
630 Ga0105245_10451873
631 Ga0105245_10750513
632 Ga0105247_10000328
633 Ga0105247_10166196
634 Ga0114129_10124389
635 Ga0105243_10981402
636 Ga0105241_10160413
637 Ga0105248_10000036
638 Ga0105248_10761452
639 Ga0105248_10913095
640 Ga0105248_11790155
641 Ga0105237_10003512
642 Ga0105237_10274928
643 Ga0105237_10409140
644 Ga0105238_10401407
645 Ga0105238_10838123
646 Ga0105238_11517374
647 Ga0105249_10000046
648 Ga0105249_10047102
649 Ga0105028_129373
650 Ga0105239_10002837
651 Ga0105239_10439373
652 Ga0105239_10698137
653 Ga0157369_10307410
654 Ga0157369_10863302
655 Ga0157374_10008427
656 Ga0163162_10102851
657 Ga0163162_10533933
658 Ga0157375_10996560
659 Ga0163163_10272578
660 Ga0163163_10516323
661 Ga0157379_10140490
662 Ga0163161_10517616
663 Ga0213876_10001179
664 Ga0213876_10054046
665 Ga0213875_10007105
666 Ga0213875_10028573
667 Ga0224712_10331925
668 Ga0209051_1001417
669 Ga0207696_1037026
670 Ga0207696_1075172
671 Ga0207642_10162307
672 Ga0207710_10000060
673 Ga0207688_10002912
674 Ga0207688_10589257
675 Ga0207643_10080976
676 Ga0207671_10013032
677 Ga0207660_10118516
678 Ga0207646_11073144
679 Ga0207694_11090713
680 Ga0207650_10107458
681 Ga0207687_10031737
682 Ga0207687_10510336
683 Ga0207700_10401464
684 Ga0207700_10548063
685 Ga0207664_10248595
686 Ga0207664_10418505
687 Ga0207644_10007836
688 Ga0207644_10245718
689 Ga0207690_10203560
690 Ga0207686_10170337
691 Ga0207669_10320270
692 Ga0207665_10343878
693 Ga0207691_10077171
694 Ga0207711_10000073
695 Ga0207711_10368714
696 Ga0207711_11252236
697 Ga0207689_10056774
698 Ga0207689_10493974
699 Ga0207712_10000042
700 Ga0207668_10323011
701 Ga0207668_10501401
702 Ga0207668_10700289
703 Ga0207640_10201126
704 Ga0207640_10663732
705 Ga0207640_10948285
706 Ga0207640_11158541
707 Ga0207658_10000577
708 Ga0207658_10123755
709 Ga0207658_10195633
710 Ga0207658_10804206
711 Ga0207703_10008462
712 Ga0207703_10158705
713 Ga0207703_10163986
714 Ga0207639_10063558
715 Ga0207639_10694192
716 Ga0207678_10004333
717 Ga0207678_10071582
718 Ga0207708_10673346
719 Ga0207641_10000278
720 Ga0207641_10020783
721 Ga0207641_10191888
722 Ga0207674_10056121
723 Ga0207675_100285895
724 Ga0209813_10009872
725 Ga0209813_10140347
726 Ga0268266_10003957
727 Ga0268266_10037807
728 Ga0268266_10165643
729 Ga0268266_10903748
730 Ga0268265_10000051
731 Ga0268265_10560159
732 Ga0268264_10000108
733 Ga0268264_10086574
734 Ga0268264_11150136
735 Ga0265327_10000466
736 Ga0265327_10040812
737 Ga0307509_10325296
738 Ga0307405_10716066
739 Ga0307518_10000634
740 Ga0307410_10426963
741 Ga0326468_10005318
742 Ga0307406_10542319
743 Ga0307406_10686495
744 Ga0307409_100038656
745 Ga0307416_100046443
746 Ga0307415_100302093
747 Ga0307415_100728710
748 Ga0307507_10010997
749 Ga0307510_10104379
750 Ga0373949_0012956
751 Ga0373952_0090888
752 Ga0373955_0302765
753 Ga0316574_0123094
754 Ga0316582_0713417
755 Ga0316584_0394812
756 Ga0395898_0123139
757 Ga0436364_0318362
758 Ga0436364_1062752
759 Ga0436365_0131159
760 Ga0436365_0242996
761 Ga0436365_1358234
762 Ga0439461_0014013
763 Ga0439461_0020150
764 Ga0439461_0041142
765 Ga0439466_0016588
766 Ga0439465_0001434
767 Ga0439465_0010843
768 Ga0439465_0149502
769 Ga0451791_0654316
770 Ga0451793_0211108
771 Ga0451802_1214260
772 Ga0451802_1614210
773 Ga0451807_0229588
774 Ga0451833_1005414
775 Ga0451843_1086538
776 Ga0451855_2037737
777 Ga0451853_3295469
778 Ga0451853_3972690
779 Ga0439431_0002367
780 Ga0439442_024369
781 Ga0439445_0021754
782 Ga0439434_0006543
783 Ga0439460_0042855
784 Ga0466972_0001717
785 Ga0466972_0029387
786 Ga0466972_0073576
787 Ga0466972_0073864
788 Ga0466965_0033744
789 Ga0466966_0074898
790 Ga0466961_0029010
791 Ga0466961_0127405
792 Ga0466963_0029670
793 Ga0466963_0033815
794 Ga0466963_0041120
795 Ga0466963_0291360
796 Ga0466971_0018314
797 Ga0466968_0125061
798 Ga0466968_0259050
799 Ga0466970_0013442
800 Ga0466970_0046536
801 Ga0466970_0085519
802 Ga0466970_0474315
803 Ga0466957_0012130
804 Ga0466960_0161409
805 Ga0466959_0064554
806 Ga0466958_0414397
807 Ga0466967_0032983
808 Ga0466967_0065898
809 Ga0466967_0178065
810 Ga0466967_0192848
811 Ga0466967_0495130
812 Ga0466967_0617574
813 Ga0466967_0627838
814 Ga0466967_0666389
815 Ga0495638_0110236
816 Ga0495662_0015775
817 Ga0495606_0203448
818 Ga0495648_0146274
819 Ga0495668_0292784
820 Ga0495625_0119160
821 Ga0495635_0106911
822 Ga0495658_0022671
823 Ga0495624_0098381
824 Ga0495581_0029059
825 Ga0495674_0249691
826 Ga0495672_0125774
827 Ga0495676_0311030
828 Ga0495686_0001395
829 Ga0495614_0083446
830 Ga0496100_0002468
831 Ga0496100_0002984
832 Ga0496100_0040594
833 Ga0496100_0575300
834 Ga0496101_0000108
835 Ga0496101_0008149
836 Ga0496101_0035431
837 Ga0496101_0087067
838 Ga0496101_0240481
839 Ga0496102_0000005
840 Ga0496102_0000131
841 Ga0496102_0093937
842 Ga0496102_0692505
843 Ga0496102_1238653
844 Ga0496103_0000002
845 Ga0496103_0001081
846 Ga0496104_0079615
847 Ga0496104_0106800
848 Ga0496104_1557885
849 Ga0496105_0201428
850 Ga0496105_0520720
851 Ga0496106_0070827
852 Ga0496106_0071311
853 Ga0496106_0197047
854 Ga0496106_0965564
855 Ga0496107_0058368
856 Ga0496107_0084340
857 Ga0496107_0345676
858 Ga0496108_0006032
859 Ga0496108_0009351
860 Ga0496108_0074690
861 Ga0496108_0732976
862 Ga0496109_0008079
863 Ga0496109_0099559
864 Ga0496109_0110081
865 Ga0496109_0177456
866 Ga0496109_0345064
867 Ga0496109_0568497
868 Ga0496109_1131762
869 Ga0496110_0469860
870 Ga0496110_0643277
871 Ga0496111_0348047
872 Ga0496111_0624267
873 Ga0496112_0001496
874 Ga0496112_0058889
875 Ga0496112_0074313
876 Ga0496112_0679623
877 Ga0496113_0013078
878 Ga0496113_0062508
879 Ga0496113_0121937
880 Ga0496113_0127249
881 Ga0496113_0342609
882 Ga0496113_1374814
883 Ga0496114_0130453
884 Ga0496116_0000357
885 Ga0496116_0079635
886 Ga0496117_0000003
887 Ga0496117_0002740
888 Ga0496118_0000001
889 Ga0496118_0004654
890 Ga0496118_0304463
891 Ga0496119_0000549
892 Ga0496119_0001343
893 Ga0496119_0011147
894 Ga0496120_0003584
895 Ga0496120_0008383
896 Ga0496121_0000634
897 Ga0496124_0165424
898 Ga0496125_0015512
899 Ga0496125_0315520
900 Ga0496126_0000178
901 Ga0496126_0012000
902 Ga0496126_0157445
903 Ga0501032_0115451
904 Ga0501033_0505242
905 Ga0501034_0005605
906 Ga0501036_0033864
907 Ga0501037_0000196
908 Ga0501038_0178024
909 Ga0501039_0000774
910 Ga0501043_0002205
911 Ga0501070_0144321
912 Ga0501073_0148233
913 Ga0501044_0009915
914 Ga0501044_0338000
915 nmdc:mga03683_212275_c1
916 nmdc:mga03n38_114351_c1
917 nmdc:mga03n38_361349_c1
918 nmdc:mga03n38_3754_c1
919 nmdc:mga00v17_106467_c1
920 nmdc:mga00v17_183341_c1
921 nmdc:mga00v17_247933_c1
922 nmdc:mga00v17_30313_c1
923 nmdc:mga00v17_307964_c1
924 nmdc:mga00v17_386459_c1
925 nmdc:mga00v17_439695_c1
926 nmdc:mga00v17_7569_c1
927 nmdc:mga0yw44_10916_c1
928 nmdc:mga0yw44_122379_c1
929 nmdc:mga0yw44_43545_c1
930 nmdc:mga0yw44_446697_c1
931 nmdc:mga0yw44_49306_c1
932 nmdc:mga0k408_107068_c1
933 nmdc:mga06z11_144013_c1
934 nmdc:mga06z11_387957_c1
935 nmdc:mga06z11_525154_c1
936 nmdc:mga06z11_78704_c1
937 nmdc:mga04h51_163974_c1
938 nmdc:mga04h51_92579_c1
939 nmdc:mga07m45_309327_c1
940 nmdc:mga07m45_35435_c1
941 nmdc:mga07m45_374634_c1
942 nmdc:mga07m45_56777_c1
943 nmdc:mga07m45_6269_c1
944 nmdc:mga07m45_92137_c1
945 nmdc:mga05p37_157185_c1
946 nmdc:mga0qj67_266_c1
947 nmdc:mga06r32_55115_c1
948 nmdc:mga0sz30_138797_c1
949 nmdc:mga0sz30_236674_c1
950 nmdc:mga0sz30_249004_c1
951 nmdc:mga0sz30_39793_c1
952 nmdc:mga0sz30_427878_c1
953 nmdc:mga0sz30_53899_c1
954 nmdc:mga0sz30_64022_c1
955 Ga0500635_0016966
956 Ga0500635_0129382
957 Ga0495619_0947310
958 Ga0500578_0287773
959 Ga0500578_0372808
960 Ga0500643_017132
961 Ga0500643_037893
962 Ga0500641_0052357
963 Ga0500641_0196963
964 Ga0500594_0081429
965 Ga0500608_206816
966 Ga0500621_217635
967 Ga0500628_020542
968 Ga0500652_000657
969 Ga0500559_0050907
970 Ga0500588_0026571
971 Ga0500616_0069172
972 Ga0500620_075323
973 Ga0500627_0014006
974 Ga0500645_000032
975 Ga0466962_0016621
976 2902332239
977 2586063951
978 2644636208
979 2676480449
980 2738708620
981 2739335140
982 2753075323
983 2776369789
984 2809586798
985 2842138750
986 2863068839
987 2866553140
988 2870729303
989 2899361033
990 2902804341
991 2902815726
992 2902842170
993 2929214452
994 2939586308
995 8003316555
996 8056215448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

8

151

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.9129 14 135
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8833 14 136
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.8709 14 136
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.868 14 131
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8629 14 136
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9152 14 137 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8786 19 135 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.875 14 137 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8447 19 135 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.6779 16 135 2.40.280.10
ID Description Score Start End GO Terms
AF-A7L9H9-F1-model_v4 SmpB 0.9645 29 131 GO:0003723
GO:0005829
AF-A7L9H9-F1-model_v4 SmpB 0.9555 29 131 GO:0003723
GO:0005829
AF-A0A2E0C8T3-F1-model_v4 deleted 0.9484 15 131
AF-A0A352B2I9-F1-model_v4 SsrA-binding protein 0.9477 14 134 GO:0003723
GO:0005829
AF-A0A519KLB3-F1-model_v4 SsrA-binding protein SmpB 0.9477 14 132 GO:0003723
GO:0005829

Map