F455292

General Info

Members Datasets Scaffolds Average Seq Length
498 290 996 193

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919443155|2919443587
Length 227
Sequence LFIIDVQNDFTEGGALGVEGGAAVAAGISELLAQHKDRYGVVVASRDWHDADNDNGGHFATDGAPDYVTTWPVHCVAGTVGAAYHPALDVDAIDVHLLKGQGVPAYSIFEAVDEGGRAIGEVLDEYGVTDVDVVGIATDYCVRASGLDAVEHGRHVRVFTDLVAGVAPETSEAALAELGHAGAAIAESSVLDAEAQADAAGETAAGEGEAADRGDAADADAEPGAPA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
79 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
141 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
239 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
244 2643221549 Agromyces sp. Root1464 Isolate Unclassified
245 2643221572 Leifsonia sp. Root60 Isolate Unclassified
246 2643221575 Microbacterium sp. Root61 Isolate Unclassified
247 2643221616 Leifsonia sp. Root227 Isolate Unclassified
248 2643221619 Agromyces sp. Root81 Isolate Unclassified
249 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
250 2643221649 Leifsonia sp. Root4 Isolate Unclassified
251 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
252 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
253 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
254 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
255 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
256 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
257 2808606372 Agromyces sp. 23-23 Isolate Unclassified
258 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
259 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
260 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
261 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
262 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
263 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
264 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
265 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
266 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
267 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
268 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
269 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
270 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
271 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
272 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
273 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
274 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
275 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
276 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
277 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
278 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
279 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
280 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
281 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
282 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
283 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
284 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
285 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
286 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
287 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
288 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
289 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
290 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.16
Metatranscriptomes 1.2
Isolates 9.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 17.67
Nodule 0
Rhizoplane 5.22
Rhizosphere 60.24
Stem 0
Stem Tuber 0.2
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10005700 3300001990 Bacteria 4287
2 JGI24735J21928_10002750 3300002067 Bacteria 6066
3 JGI25164J39214_1001452 3300002772 Bacteria 5459
4 JGI25165J46597_1000148 3300003214 Bacteria 116003
5 Ga0006562J51391_1048046 3300003578 Bacteria 6230
6 Ga0006562J51391_1048047 3300003578 Bacteria 4750
7 Ga0055539_1000103 3300003752 Bacteria 96081
8 Ga0055533_1000020 3300003756 Bacteria 353998
9 Ga0055525_1000312 3300003759 Bacteria 39548
10 Ga0055525_1001738 3300003759 Bacteria 3168
11 Ga0055527_1000003 3300003760 Bacteria 705001
12 Ga0055542_1000066 3300003762 Bacteria 154802
13 Ga0055529_1000006 3300003763 Bacteria 416978
14 Ga0065714_10294543 3300005288 Bacteria 703
15 Ga0070658_10000044 3300005327 Bacteria 131465
16 Ga0070658_10011424 3300005327 Bacteria 7121
17 Ga0070658_10011433 3300005327 Bacteria 7119
18 Ga0070658_10124379 3300005327 Bacteria 2146
19 Ga0070670_101291618 3300005331 Bacteria 668
20 Ga0070666_10175946 3300005335 Bacteria 1500
21 Ga0068868_100062932 3300005338 Bacteria 2942
22 Ga0070660_100084868 3300005339 Bacteria 2490
23 Ga0070660_100106648 3300005339 Bacteria 2225
24 Ga0070660_100385165 3300005339 Bacteria 1158
25 Ga0070661_100216243 3300005344 Bacteria 1468
26 Ga0070668_100013500 3300005347 Bacteria 6097
27 Ga0070688_100678534 3300005365 Bacteria 796
28 Ga0070659_100000308 3300005366 Bacteria 38002
29 Ga0070659_100033219 3300005366 Bacteria 4006
30 Ga0070714_100008276 3300005435 Bacteria 8109
31 Ga0070714_100010336 3300005435 Bacteria 7375
32 Ga0070714_100128366 3300005435 Bacteria 2263
33 Ga0070713_100180332 3300005436 Bacteria 1897
34 Ga0070713_100753740 3300005436 Bacteria 932
35 Ga0070710_10012808 3300005437 Bacteria 4176
36 Ga0070711_100095659 3300005439 Bacteria 2150
37 Ga0070663_100002041 3300005455 Bacteria 11291
38 Ga0070681_10071036 3300005458 Bacteria 3446
39 Ga0070706_100000418 3300005467 Bacteria 51047
40 Ga0070684_100463310 3300005535 Bacteria 1172
41 Ga0068853_100004072 3300005539 Bacteria 11256
42 Ga0070672_100113527 3300005543 Bacteria 2211
43 Ga0068855_100005441 3300005563 Bacteria 15527
44 Ga0068855_100124054 3300005563 Bacteria 2954
45 Ga0068855_100434023 3300005563 Bacteria 1435
46 Ga0068855_100527215 3300005563 Bacteria 1281
47 Ga0068857_100000016 3300005577 Bacteria 97647
48 Ga0068857_100313787 3300005577 Bacteria 1447
49 Ga0068856_100057471 3300005614 Bacteria 3840
50 Ga0068856_100085371 3300005614 Bacteria 3136
51 Ga0068852_100004931 3300005616 Bacteria 9476
52 Ga0068852_100071805 3300005616 Bacteria 3040
53 Ga0068859_100128679 3300005617 Bacteria 2603
54 Ga0068864_100555891 3300005618 Bacteria 1110
55 Ga0068864_101066825 3300005618 Bacteria 803
56 Ga0068861_100549363 3300005719 Bacteria 1052
57 Ga0068861_100758334 3300005719 Bacteria 907
58 Ga0068851_10000001 3300005834 Bacteria 495512
59 Ga0068870_10066657 3300005840 Bacteria 1951
60 Ga0068863_100000972 3300005841 Bacteria 28835
61 Ga0068863_100118249 3300005841 Bacteria 2526
62 Ga0068863_100361720 3300005841 Bacteria 1415
63 Ga0068858_100000016 3300005842 Bacteria 193130
64 Ga0081455_10184700 3300005937 Bacteria 1576
65 Ga0070717_10433952 3300006028 Bacteria 1182
66 Ga0070717_10512719 3300006028 Bacteria 1084
67 Ga0075365_10012925 3300006038 Bacteria 4977
68 Ga0075365_10223932 3300006038 Bacteria 1320
69 Ga0075365_10359149 3300006038 Bacteria 1027
70 Ga0075368_10203278 3300006042 Bacteria 838
71 Ga0075363_100075379 3300006048 Bacteria 1838
72 Ga0075364_10032841 3300006051 Bacteria 3338
73 Ga0075364_10038702 3300006051 Bacteria 3090
74 Ga0075364_10075806 3300006051 Bacteria 2219
75 Ga0075364_10127583 3300006051 Bacteria 1706
76 Ga0070716_100652939 3300006173 Bacteria 798
77 Ga0070712_100019228 3300006175 Bacteria 4451
78 Ga0070712_100323961 3300006175 Bacteria 1254
79 Ga0075362_10028294 3300006177 Bacteria 2406
80 Ga0075362_10046977 3300006177 Bacteria 1922
81 Ga0075369_10001151 3300006186 Bacteria 8920
82 Ga0075369_10171043 3300006186 Bacteria 998
83 Ga0097620_100128682 3300006931 Bacteria 2603
84 Ga0105240_10016948 3300009093 Bacteria 9845
85 Ga0105240_10923445 3300009093 Bacteria 938
86 Ga0105245_10004090 3300009098 Bacteria 12950
87 Ga0105245_10281521 3300009098 Bacteria 1625
88 Ga0105247_10249616 3300009101 Bacteria 1212
89 Ga0105243_10036819 3300009148 Bacteria 3800
90 Ga0105243_10224439 3300009148 Bacteria 1663
91 Ga0105243_10234441 3300009148 Bacteria 1630
92 Ga0105243_11050166 3300009148 Bacteria 820
93 Ga0105241_10000027 3300009174 Bacteria 130768
94 Ga0105248_10002772 3300009177 Bacteria 19481
95 Ga0105248_10067636 3300009177 Bacteria 4011
96 Ga0105237_10001088 3300009545 Bacteria 36367
97 Ga0105237_10008010 3300009545 Bacteria 11499
98 Ga0105237_10278455 3300009545 Bacteria 1675
99 Ga0105238_10004404 3300009551 Bacteria 13966
100 Ga0105249_10252114 3300009553 Bacteria 1750
101 Ga0105239_10068288 3300010375 Bacteria 3906
102 Ga0105239_10285879 3300010375 Bacteria 1857
103 Ga0105239_10737104 3300010375 Bacteria 1127
104 Ga0105246_10070144 3300011119 Bacteria 2464
105 Ga0157371_10000514 3300013102 Bacteria 46481
106 Ga0157370_10124770 3300013104 Bacteria 2404
107 Ga0157370_10205011 3300013104 Bacteria 1829
108 Ga0157369_10000686 3300013105 Bacteria 43803
109 Ga0157369_10012174 3300013105 Bacteria 9764
110 Ga0157369_10060283 3300013105 Bacteria 4092
111 Ga0157369_10067712 3300013105 Bacteria 3837
112 Ga0157369_10299182 3300013105 Bacteria 1674
113 Ga0157369_10472014 3300013105 Bacteria 1299
114 Ga0171462_1004 3300013250 Bacteria 678877
115 Ga0157374_10010748 3300013296 Bacteria 7890
116 Ga0157374_10346684 3300013296 Bacteria 1475
117 Ga0157372_11014614 3300013307 Bacteria 961
118 Ga0157375_10944963 3300013308 Bacteria 1004
119 Ga0163163_12129093 3300014325 Bacteria 620
120 Ga0157380_10026128 3300014326 Bacteria 4432
121 Ga0157380_10470865 3300014326 Bacteria 1212
122 Ga0157379_10005454 3300014968 Bacteria 10928
123 Ga0157379_10008918 3300014968 Bacteria 8744
124 Ga0157379_10306210 3300014968 Bacteria 1449
125 Ga0157376_10148414 3300014969 Bacteria 2112
126 Ga0206353_10516314 3300020082 Bacteria 2324
127 Ga0206353_10524314 3300020082 Bacteria 1088
128 Ga0224712_10004883 3300022467 Bacteria 3671
129 Ga0224572_1010804 3300024225 Bacteria 1722
130 Ga0228598_1011040 3300024227 Bacteria 1799
131 Ga0209566_100043 3300025225 Bacteria 266609
132 Ga0209674_100001 3300025226 Bacteria 4013750
133 Ga0209672_100003 3300025228 Bacteria 1560476
134 Ga0209672_108930 3300025228 Bacteria 1447
135 Ga0209147_100287 3300025229 Bacteria 42863
136 Ga0209563_100001 3300025230 Bacteria 4013775
137 Ga0209563_100183 3300025230 Bacteria 37635
138 Ga0207427_100039 3300025231 Bacteria 291576
139 Ga0209437_100315 3300025233 Bacteria 63641
140 Ga0209258_101220 3300025242 Bacteria 10012
141 Ga0209677_100001 3300025253 Bacteria 4013787
142 Ga0209148_1000004 3300025254 Bacteria 1844481
143 Ga0209233_1000014 3300025261 Bacteria 996641
144 Ga0209233_1024574 3300025261 Bacteria 1504
145 Ga0209455_1000046 3300025272 Bacteria 382681
146 Ga0209455_1000504 3300025272 Bacteria 28034
147 Ga0207656_10000002 3300025321 Bacteria 792178
148 Ga0207655_1000478 3300025728 Bacteria 51594
149 Ga0207692_10145146 3300025898 Bacteria 1354
150 Ga0207647_10034947 3300025904 Bacteria 3205
151 Ga0207647_10427175 3300025904 Bacteria 744
152 Ga0207643_10042711 3300025908 Bacteria 2557
153 Ga0207705_10000001 3300025909 Bacteria 2061880
154 Ga0207705_10033354 3300025909 Bacteria 3677
155 Ga0207705_10072467 3300025909 Bacteria 2498
156 Ga0207684_10001169 3300025910 Bacteria 29317
157 Ga0207654_10000001 3300025911 Bacteria 1816198
158 Ga0207695_10005723 3300025913 Bacteria 16379
159 Ga0207695_10009945 3300025913 Bacteria 11690
160 Ga0207695_10164021 3300025913 Bacteria 2151
161 Ga0207671_10000002 3300025914 Bacteria 1144816
162 Ga0207671_10005639 3300025914 Bacteria 11471
163 Ga0207671_10356434 3300025914 Bacteria 1160
164 Ga0207693_10024440 3300025915 Bacteria 4794
165 Ga0207693_10247213 3300025915 Bacteria 1400
166 Ga0207657_10007047 3300025919 Bacteria 11552
167 Ga0207657_10346524 3300025919 Bacteria 1172
168 Ga0207694_10000022 3300025924 Bacteria 288900
169 Ga0207687_10037101 3300025927 Bacteria 3323
170 Ga0207687_10333103 3300025927 Bacteria 1232
171 Ga0207700_10160450 3300025928 Bacteria 1867
172 Ga0207700_10359627 3300025928 Bacteria 1269
173 Ga0207664_10022135 3300025929 Bacteria 4741
174 Ga0207664_10170180 3300025929 Bacteria 1864
175 Ga0207664_10749191 3300025929 Bacteria 878
176 Ga0207690_10006384 3300025932 Bacteria 6988
177 Ga0207690_10020721 3300025932 Bacteria 4067
178 Ga0207709_10086198 3300025935 Bacteria 2038
179 Ga0207709_10416830 3300025935 Bacteria 1030
180 Ga0207691_10122091 3300025940 Bacteria 2308
181 Ga0207711_10002845 3300025941 Bacteria 15187
182 Ga0207711_10039883 3300025941 Bacteria 3995
183 Ga0207667_10000571 3300025949 Bacteria 48073
184 Ga0207667_10007283 3300025949 Bacteria 13338
185 Ga0207667_10013201 3300025949 Bacteria 9471
186 Ga0207667_10072528 3300025949 Bacteria 3579
187 Ga0207667_10128593 3300025949 Bacteria 2609
188 Ga0207667_10448076 3300025949 Bacteria 1312
189 Ga0207667_10735818 3300025949 Bacteria 987
190 Ga0207668_10118489 3300025972 Bacteria 2000
191 Ga0207658_10057022 3300025986 Bacteria 2901
192 Ga0207658_10059458 3300025986 Bacteria 2848
193 Ga0207703_10000075 3300026035 Bacteria 118422
194 Ga0207639_10045953 3300026041 Bacteria 3292
195 Ga0207639_10230311 3300026041 Bacteria 1606
196 Ga0207702_10022519 3300026078 Bacteria 5223
197 Ga0207702_10063023 3300026078 Bacteria 3169
198 Ga0207702_10107861 3300026078 Bacteria 2470
199 Ga0207702_11046561 3300026078 Bacteria 810
200 Ga0207641_10001837 3300026088 Bacteria 20390
201 Ga0207641_10096681 3300026088 Bacteria 2594
202 Ga0207641_10270036 3300026088 Bacteria 1596
203 Ga0207676_10954397 3300026095 Bacteria 843
204 Ga0207674_10009115 3300026116 Bacteria 11389
205 Ga0207683_10209383 3300026121 Bacteria 1774
206 Ga0207698_10000051 3300026142 Bacteria 86859
207 Ga0207698_10004434 3300026142 Bacteria 8553
208 Ga0209813_10005990 3300027866 Bacteria 2985
209 Ga0265336_10013389 3300028666 Bacteria 2736
210 Ga0307515_10176288 3300028794 Bacteria 2107
211 Ga0265338_10001142 3300028800 Bacteria 43907
212 Ga0265338_10004400 3300028800 Bacteria 19060
213 Ga0265773_1007563 3300031018 Bacteria 851
214 Ga0307513_10006002 3300031456 Bacteria 15955
215 Ga0307513_10102772 3300031456 Bacteria 2876
216 Ga0307513_10119312 3300031456 Bacteria 2609
217 Ga0307408_100924924 3300031548 Bacteria 800
218 Ga0307514_10008910 3300031649 Bacteria 8479
219 Ga0307514_10012051 3300031649 Bacteria 7197
220 Ga0307405_10388424 3300031731 Bacteria 1089
221 Ga0307413_10602781 3300031824 Bacteria 899
222 Ga0307410_10322081 3300031852 Bacteria 1227
223 Ga0307410_10336602 3300031852 Bacteria 1202
224 Ga0307406_10001558 3300031901 Bacteria 12653
225 Ga0307406_10373753 3300031901 Bacteria 1121
226 Ga0307412_10323824 3300031911 Bacteria 1227
227 Ga0307409_100326608 3300031995 Bacteria 1438
228 Ga0307409_100462550 3300031995 Bacteria 1227
229 Ga0307416_100169734 3300032002 Bacteria 2029
230 Ga0307416_100266375 3300032002 Bacteria 1679
231 Ga0307416_100386473 3300032002 Bacteria 1432
232 Ga0307416_100766262 3300032002 Bacteria 1059
233 Ga0307415_100162209 3300032126 Bacteria 1734
234 Ga0307415_100511829 3300032126 Bacteria 1052
235 Ga0307507_10014905 3300033179 Bacteria 9209
236 Ga0316212_1001451 3300033547 Bacteria 3224
237 Ga0316216_1003309 3300033548 Bacteria 1157
238 Ga0373931_0442611 3300035691 Bacteria 830
239 Ga0373933_0431183 3300035724 Bacteria 861
240 Ga0373937_0619668 3300036401 Bacteria 1027
241 Ga0373937_0812392 3300036401 Bacteria 883
242 Ga0395899_0401520 3300037312 Bacteria 907
243 Ga0395900_0005157 3300037418 Bacteria 13723
244 Ga0395900_0080659 3300037418 Bacteria 3344
245 Ga0395900_0090189 3300037418 Bacteria 3151
246 Ga0395898_0001347 3300037466 Bacteria 35447
247 Ga0395898_0683261 3300037466 Bacteria 969
248 Ga0395898_1222214 3300037466 Bacteria 682
249 Ga0436364_0202989 3300037853 Bacteria 2042
250 Ga0395901_0002044 3300038443 Bacteria 20697
251 Ga0395901_0060822 3300038443 Bacteria 3931
252 Ga0395901_0076363 3300038443 Bacteria 3495
253 Ga0436363_0621718 3300039450 Bacteria 1559
254 Ga0436362_1049721 3300039453 Bacteria 1208
255 Ga0439461_0015030 3300041410 Bacteria 1479
256 Ga0439466_0005104 3300041411 Bacteria 5033
257 Ga0439465_0130361 3300041413 Bacteria 887
258 Ga0439465_0373394 3300041413 Bacteria 541
259 Ga0451787_236560 3300041441 Bacteria 1145
260 Ga0451807_0519205 3300041486 Bacteria 1041
261 Ga0451837_0591211 3300041494 Bacteria 3612
262 Ga0451853_0034856 3300041512 Bacteria 4051
263 Ga0451853_0902052 3300041512 Bacteria 1363
264 Ga0451853_1549727 3300041512 Bacteria 746
265 Ga0439445_0000603 3300042004 Bacteria 7358
266 Ga0439434_0001336 3300042435 Bacteria 7103
267 Ga0439435_0023016 3300042436 Bacteria 1632
268 Ga0439459_0011173 3300042438 Bacteria 1579
269 Ga0466972_0081409 3300044658 Bacteria 1542
270 Ga0466972_0135724 3300044658 Bacteria 1158
271 Ga0466972_0168608 3300044658 Bacteria 1028
272 Ga0466972_0228630 3300044658 Bacteria 870
273 Ga0466965_0058302 3300044683 Bacteria 1925
274 Ga0466961_0120585 3300044693 Bacteria 1647
275 Ga0466968_0016914 3300044735 Bacteria 2908
276 Ga0466968_0055826 3300044735 Bacteria 1696
277 Ga0466970_0013543 3300044765 Bacteria 4183
278 Ga0466970_0095009 3300044765 Bacteria 1620
279 Ga0466970_0106229 3300044765 Bacteria 1531
280 Ga0466957_0009523 3300044842 Bacteria 5548
281 Ga0466957_0069547 3300044842 Bacteria 2175
282 Ga0466957_0346404 3300044842 Bacteria 1007
283 Ga0466960_0110112 3300044901 Bacteria 1430
284 Ga0466960_0129203 3300044901 Bacteria 1332
285 Ga0466960_0144163 3300044901 Bacteria 1267
286 Ga0466960_0206862 3300044901 Bacteria 1074
287 Ga0466959_0026864 3300045049 Bacteria 4269
288 Ga0466959_0402555 3300045049 Bacteria 930
289 Ga0466967_1367828 3300045976 Bacteria 705
290 Ga0495638_0216048 3300046460 Bacteria 1074
291 Ga0495650_0002450 3300046471 Bacteria 14993
292 Ga0495644_0058035 3300046523 Bacteria 1455
293 Ga0495656_0027913 3300046615 Bacteria 2259
294 Ga0495668_0000932 3300046616 Bacteria 32625
295 Ga0495686_0133512 3300047472 Bacteria 1470
296 Ga0496100_0109623 3300048903 Bacteria 1915
297 Ga0496101_0009239 3300048904 Bacteria 6474
298 Ga0496102_0000383 3300048905 Bacteria 52390
299 Ga0496102_0183528 3300048905 Bacteria 1971
300 Ga0496102_0275765 3300048905 Bacteria 1585
301 Ga0496102_0864408 3300048905 Bacteria 826
302 Ga0496103_0000019 3300048906 Bacteria 234311
303 Ga0496103_0586981 3300048906 Bacteria 710
304 Ga0496104_0432467 3300048907 Bacteria 1228
305 Ga0496104_0490830 3300048907 Bacteria 1139
306 Ga0496105_0038211 3300048908 Bacteria 3954
307 Ga0496105_0100748 3300048908 Bacteria 2385
308 Ga0496105_0453616 3300048908 Bacteria 1012
309 Ga0496106_0162431 3300048909 Bacteria 1767
310 Ga0496110_0016676 3300048913 Bacteria 6137
311 Ga0496110_0792021 3300048913 Bacteria 852
312 Ga0496112_0704649 3300048915 Bacteria 937
313 Ga0496113_0093038 3300048916 Bacteria 2326
314 Ga0496113_0162517 3300048916 Bacteria 1766
315 Ga0496113_0323175 3300048916 Bacteria 1237
316 Ga0496114_0823810 3300048917 Bacteria 807
317 Ga0496115_0116611 3300048918 Bacteria 2196
318 Ga0496115_0127669 3300048918 Bacteria 2095
319 Ga0496115_0301278 3300048918 Bacteria 1313
320 Ga0496116_0000269 3300048919 Bacteria 90518
321 Ga0496117_0000101 3300048920 Bacteria 191796
322 Ga0496117_0003876 3300048920 Bacteria 16999
323 Ga0496117_0005446 3300048920 Bacteria 13366
324 Ga0496117_0006740 3300048920 Bacteria 11469
325 Ga0496117_0019658 3300048920 Bacteria 5537
326 Ga0496118_0002407 3300048921 Bacteria 25247
327 Ga0496118_0009087 3300048921 Bacteria 10122
328 Ga0496118_0012292 3300048921 Bacteria 8239
329 Ga0496118_0022185 3300048921 Bacteria 5561
330 Ga0496118_0349308 3300048921 Bacteria 789
331 Ga0496119_0000295 3300048922 Bacteria 69951
332 Ga0496119_0001254 3300048922 Bacteria 31542
333 Ga0496119_0004148 3300048922 Bacteria 14582
334 Ga0496119_0005358 3300048922 Bacteria 12328
335 Ga0496119_0300819 3300048922 Bacteria 791
336 Ga0496120_0000257 3300048923 Bacteria 88760
337 Ga0496120_0004619 3300048923 Bacteria 11414
338 Ga0496120_0006422 3300048923 Bacteria 9036
339 Ga0496120_0017158 3300048923 Bacteria 4703
340 Ga0496120_0032801 3300048923 Bacteria 3127
341 Ga0496121_0028468 3300048924 Bacteria 5199
342 Ga0496122_0000460 3300048925 Bacteria 84748
343 Ga0496122_0001552 3300048925 Bacteria 36421
344 Ga0496123_0001151 3300048926 Bacteria 39452
345 Ga0496123_0001253 3300048926 Bacteria 36650
346 Ga0496123_0307475 3300048926 Bacteria 754
347 Ga0496124_0004502 3300048927 Bacteria 16255
348 Ga0496124_0006354 3300048927 Bacteria 12897
349 Ga0496124_0324426 3300048927 Bacteria 1101
350 Ga0496125_0002435 3300048928 Bacteria 24182
351 Ga0496125_0005631 3300048928 Bacteria 13830
352 Ga0496125_0099063 3300048928 Bacteria 2154
353 Ga0496125_0475975 3300048928 Bacteria 709
354 Ga0496126_0000565 3300048929 Bacteria 70942
355 Ga0496126_0002374 3300048929 Bacteria 25630
356 Ga0496126_0061930 3300048929 Bacteria 3359
357 Ga0496126_0076669 3300048929 Bacteria 2965
358 Ga0496126_0111578 3300048929 Bacteria 2381
359 Ga0496126_0246305 3300048929 Bacteria 1491
360 Ga0496126_0678026 3300048929 Bacteria 803
361 Ga0496126_0979114 3300048929 Bacteria 636
362 Ga0501032_0009854 3300049569 Bacteria 6912
363 Ga0501034_0015612 3300049571 Bacteria 7800
364 Ga0501034_0032363 3300049571 Bacteria 5311
365 Ga0501034_0046260 3300049571 Bacteria 4396
366 Ga0501034_0107737 3300049571 Bacteria 2778
367 Ga0501034_0125276 3300049571 Bacteria 2554
368 Ga0501034_0327010 3300049571 Bacteria 1465
369 Ga0501036_0042229 3300049572 Bacteria 3861
370 Ga0501036_0925034 3300049572 Bacteria 715
371 Ga0501037_0013656 3300049573 Bacteria 5983
372 Ga0501037_0211838 3300049573 Bacteria 1366
373 Ga0501037_0264520 3300049573 Bacteria 1201
374 Ga0501039_0005433 3300049575 Bacteria 9635
375 Ga0501043_0010594 3300049579 Bacteria 7218
376 Ga0501043_0291804 3300049579 Bacteria 1248
377 Ga0501043_0515697 3300049579 Bacteria 891
378 Ga0501046_0003371 3300049580 Bacteria 14671
379 Ga0501047_0020463 3300049581 Bacteria 6353
380 Ga0501047_0090398 3300049581 Bacteria 2938
381 Ga0501048_0002206 3300049582 Bacteria 14815
382 Ga0501069_0011244 3300049585 Bacteria 4748
383 Ga0501069_0036798 3300049585 Bacteria 2700
384 Ga0501069_0041254 3300049585 Bacteria 2551
385 Ga0501070_0001769 3300049586 Bacteria 19118
386 Ga0501070_0002527 3300049586 Bacteria 16035
387 Ga0501070_0003916 3300049586 Bacteria 12847
388 Ga0501070_0007672 3300049586 Bacteria 9155
389 Ga0501070_0012339 3300049586 Bacteria 7209
390 Ga0501070_0197070 3300049586 Bacteria 1654
391 Ga0501071_0000215 3300049587 Bacteria 26394
392 Ga0501072_0057160 3300049588 Bacteria 3074
393 Ga0501073_0068296 3300049589 Bacteria 2477
394 Ga0501073_0098287 3300049589 Bacteria 2033
395 Ga0501077_0439846 3300049593 Bacteria 835
396 Ga0501079_0332257 3300049741 Bacteria 1190
397 Ga0501080_0000025 3300049742 Bacteria 89908
398 Ga0501035_0157373 3300049822 Bacteria 1968
399 Ga0501045_0015204 3300049824 Bacteria 5463
400 nmdc:mga03683_47156_c1 3300050489 Bacteria 1787
401 nmdc:mga00v17_108044_c1 3300050491 Bacteria 1763
402 nmdc:mga00v17_178440_c1 3300050491 Bacteria 1370
403 nmdc:mga00v17_289426_c1 3300050491 Bacteria 1064
404 nmdc:mga00v17_42202_c1 3300050491 Bacteria 2742
405 nmdc:mga00v17_508337_c1 3300050491 Bacteria 781
406 nmdc:mga0yw44_303284_c1 3300050492 Bacteria 1070
407 nmdc:mga0yw44_317196_c1 3300050492 Bacteria 1046
408 nmdc:mga0yw44_60639_c1 3300050492 Bacteria 2318
409 nmdc:mga0yw44_66189_c2 3300050492 Bacteria 1380
410 nmdc:mga06z11_102017_c1 3300050494 Bacteria 1576
411 nmdc:mga04h51_22146_c1 3300050495 Bacteria 1920
412 nmdc:mga07m45_268082_c1 3300050496 Bacteria 993
413 nmdc:mga07m45_36170_c1 3300050496 Bacteria 2749
414 nmdc:mga07m45_84481_c2 3300050496 Bacteria 1038
415 nmdc:mga0sz30_24750_c1 3300050516 Bacteria 2451
416 nmdc:mga0sz30_3192_c1 3300050516 Bacteria 5877
417 Ga0500635_0000004 3300053080 Bacteria 210675
418 Ga0500635_0026628 3300053080 Bacteria 1831
419 Ga0500643_000444 3300053087 Bacteria 30955
420 Ga0500651_0348117 3300053093 Bacteria 841
421 Ga0500556_0000001 3300053104 Bacteria 1135060
422 Ga0500556_0001116 3300053104 Bacteria 13319
423 Ga0500593_000714 3300053117 Bacteria 12618
424 Ga0500594_0035229 3300053118 Bacteria 1341
425 Ga0500652_139589 3300053131 Bacteria 1009
426 Ga0500655_009721 3300053133 Bacteria 1735
427 Ga0500559_0000319 3300053136 Bacteria 36445
428 Ga0500559_0002036 3300053136 Bacteria 10820
429 Ga0500559_0060206 3300053136 Bacteria 1691
430 Ga0500568_0000003 3300053139 Bacteria 863587
431 Ga0500568_0000252 3300053139 Bacteria 45616
432 Ga0500568_0010060 3300053139 Bacteria 4456
433 Ga0500568_0018809 3300053139 Bacteria 3013
434 Ga0500573_0000011 3300053140 Bacteria 209484
435 Ga0500573_0003249 3300053140 Bacteria 8373
436 Ga0500573_0006544 3300053140 Bacteria 6316
437 Ga0500573_0024186 3300053140 Bacteria 3492
438 Ga0500573_0033160 3300053140 Bacteria 2981
439 Ga0500573_0051030 3300053140 Bacteria 2379
440 Ga0500573_0101542 3300053140 Bacteria 1618
441 Ga0500573_0136554 3300053140 Bacteria 1354
442 Ga0500573_0197094 3300053140 Bacteria 1072
443 Ga0500577_0003173 3300053142 Bacteria 4256
444 Ga0500577_0113036 3300053142 Bacteria 1123
445 Ga0500577_0238044 3300053142 Bacteria 790
446 Ga0500588_0025085 3300053146 Bacteria 1653
447 Ga0500616_0000109 3300053153 Bacteria 152604
448 Ga0500616_0005910 3300053153 Bacteria 8181
449 Ga0501084_0164589 3300054114 Bacteria 1872
450 Ga0501082_0180508 3300060353 Bacteria 1836
451 2919443587 2919443155 Bacteria 4072969
452 2643768293 2643221549 Bacteria 4042819
453 2643877894 2643221572 Bacteria 3614809
454 2643886350 2643221575 Bacteria 4022601
455 2644094953 2643221616 Bacteria 4066575
456 2644111727 2643221619 Bacteria 4158469
457 2644181056 2643221632 Bacteria 3406696
458 2644278702 2643221649 Bacteria 3867359
459 2644384949 2643221669 Bacteria 3611286
460 2644636851 2643221715 Bacteria 6671032
461 2723643032 2721755702 Bacteria 4373124
462 2739366427 2738543034 Bacteria 6084756
463 2774380853 2773857758 Bacteria 3592392
464 2808883462 2808606368 Bacteria 3174172
465 2808903024 2808606372 Bacteria 4649509
466 2812324101 2811994872 Bacteria 4121241
467 2844841430 2844841374 Bacteria 3917147
468 2852634777 2852632344 Bacteria 3463163
469 2852646373 2852643534 Bacteria 3013378
470 2857720617 2857720070 Bacteria 3189373
471 2857732101 2857729791 Bacteria 4040535
472 2857736070 2857733635 Bacteria 3532004
473 2862994559 2862993130 Bacteria 3860849
474 2867315863 2867312974 Bacteria 7058875
475 2867323670 2867319477 Bacteria 7069771
476 2884764332 2884763398 Bacteria 4091164
477 2895662765 2895660088 Bacteria 3782833
478 2902811538 2902810491 Bacteria 6794147
479 2904767697 2904765812 Bacteria 5369154
480 2904774526 2904770941 Bacteria 5580202
481 2908813341 2908811453 Bacteria 5478616
482 2915362056 2915358134 Bacteria 6050864
483 2919057075 2919055335 Bacteria 3875751
484 2919424683 2919420072 Bacteria 5390363
485 2919436936 2919432681 Bacteria 5390474
486 2919527132 2919523602 Bacteria 3788128
487 2928091388 2928090899 Bacteria 3158267
488 2928125003 2928121344 Bacteria 3972376
489 2935412199 2935409751 Bacteria 4179611
490 2939660283 2939657138 Bacteria 3740283
491 2939664242 2939660829 Bacteria 3784848
492 2964327452 2964326757 Bacteria 3290868
493 2966927247 2966924647 Bacteria 3268643
494 2984581866 2984580707 Bacteria 3351387
495 8002813894 8002811521 Bacteria 2942897
496 8004214805 8004212874 Bacteria 2861420
497 8016256809 8016254467 Bacteria 3797036
498 8046355669 8046352972 Bacteria 3613806
499 JGI24737J22298_10005700
500 JGI24735J21928_10002750
501 JGI25164J39214_1001452
502 JGI25165J46597_1000148
503 Ga0006562J51391_1048046
504 Ga0006562J51391_1048047
505 Ga0055539_1000103
506 Ga0055533_1000020
507 Ga0055525_1000312
508 Ga0055525_1001738
509 Ga0055527_1000003
510 Ga0055542_1000066
511 Ga0055529_1000006
512 Ga0065714_10294543
513 Ga0070658_10000044
514 Ga0070658_10011424
515 Ga0070658_10011433
516 Ga0070658_10124379
517 Ga0070670_101291618
518 Ga0070666_10175946
519 Ga0068868_100062932
520 Ga0070660_100084868
521 Ga0070660_100106648
522 Ga0070660_100385165
523 Ga0070661_100216243
524 Ga0070668_100013500
525 Ga0070688_100678534
526 Ga0070659_100000308
527 Ga0070659_100033219
528 Ga0070714_100008276
529 Ga0070714_100010336
530 Ga0070714_100128366
531 Ga0070713_100180332
532 Ga0070713_100753740
533 Ga0070710_10012808
534 Ga0070711_100095659
535 Ga0070663_100002041
536 Ga0070681_10071036
537 Ga0070706_100000418
538 Ga0070684_100463310
539 Ga0068853_100004072
540 Ga0070672_100113527
541 Ga0068855_100005441
542 Ga0068855_100124054
543 Ga0068855_100434023
544 Ga0068855_100527215
545 Ga0068857_100000016
546 Ga0068857_100313787
547 Ga0068856_100057471
548 Ga0068856_100085371
549 Ga0068852_100004931
550 Ga0068852_100071805
551 Ga0068859_100128679
552 Ga0068864_100555891
553 Ga0068864_101066825
554 Ga0068861_100549363
555 Ga0068861_100758334
556 Ga0068851_10000001
557 Ga0068870_10066657
558 Ga0068863_100000972
559 Ga0068863_100118249
560 Ga0068863_100361720
561 Ga0068858_100000016
562 Ga0081455_10184700
563 Ga0070717_10433952
564 Ga0070717_10512719
565 Ga0075365_10012925
566 Ga0075365_10223932
567 Ga0075365_10359149
568 Ga0075368_10203278
569 Ga0075363_100075379
570 Ga0075364_10032841
571 Ga0075364_10038702
572 Ga0075364_10075806
573 Ga0075364_10127583
574 Ga0070716_100652939
575 Ga0070712_100019228
576 Ga0070712_100323961
577 Ga0075362_10028294
578 Ga0075362_10046977
579 Ga0075369_10001151
580 Ga0075369_10171043
581 Ga0097620_100128682
582 Ga0105240_10016948
583 Ga0105240_10923445
584 Ga0105245_10004090
585 Ga0105245_10281521
586 Ga0105247_10249616
587 Ga0105243_10036819
588 Ga0105243_10224439
589 Ga0105243_10234441
590 Ga0105243_11050166
591 Ga0105241_10000027
592 Ga0105248_10002772
593 Ga0105248_10067636
594 Ga0105237_10001088
595 Ga0105237_10008010
596 Ga0105237_10278455
597 Ga0105238_10004404
598 Ga0105249_10252114
599 Ga0105239_10068288
600 Ga0105239_10285879
601 Ga0105239_10737104
602 Ga0105246_10070144
603 Ga0157371_10000514
604 Ga0157370_10124770
605 Ga0157370_10205011
606 Ga0157369_10000686
607 Ga0157369_10012174
608 Ga0157369_10060283
609 Ga0157369_10067712
610 Ga0157369_10299182
611 Ga0157369_10472014
612 Ga0171462_1004
613 Ga0157374_10010748
614 Ga0157374_10346684
615 Ga0157372_11014614
616 Ga0157375_10944963
617 Ga0163163_12129093
618 Ga0157380_10026128
619 Ga0157380_10470865
620 Ga0157379_10005454
621 Ga0157379_10008918
622 Ga0157379_10306210
623 Ga0157376_10148414
624 Ga0206353_10516314
625 Ga0206353_10524314
626 Ga0224712_10004883
627 Ga0224572_1010804
628 Ga0228598_1011040
629 Ga0209566_100043
630 Ga0209674_100001
631 Ga0209672_100003
632 Ga0209672_108930
633 Ga0209147_100287
634 Ga0209563_100001
635 Ga0209563_100183
636 Ga0207427_100039
637 Ga0209437_100315
638 Ga0209258_101220
639 Ga0209677_100001
640 Ga0209148_1000004
641 Ga0209233_1000014
642 Ga0209233_1024574
643 Ga0209455_1000046
644 Ga0209455_1000504
645 Ga0207656_10000002
646 Ga0207655_1000478
647 Ga0207692_10145146
648 Ga0207647_10034947
649 Ga0207647_10427175
650 Ga0207643_10042711
651 Ga0207705_10000001
652 Ga0207705_10033354
653 Ga0207705_10072467
654 Ga0207684_10001169
655 Ga0207654_10000001
656 Ga0207695_10005723
657 Ga0207695_10009945
658 Ga0207695_10164021
659 Ga0207671_10000002
660 Ga0207671_10005639
661 Ga0207671_10356434
662 Ga0207693_10024440
663 Ga0207693_10247213
664 Ga0207657_10007047
665 Ga0207657_10346524
666 Ga0207694_10000022
667 Ga0207687_10037101
668 Ga0207687_10333103
669 Ga0207700_10160450
670 Ga0207700_10359627
671 Ga0207664_10022135
672 Ga0207664_10170180
673 Ga0207664_10749191
674 Ga0207690_10006384
675 Ga0207690_10020721
676 Ga0207709_10086198
677 Ga0207709_10416830
678 Ga0207691_10122091
679 Ga0207711_10002845
680 Ga0207711_10039883
681 Ga0207667_10000571
682 Ga0207667_10007283
683 Ga0207667_10013201
684 Ga0207667_10072528
685 Ga0207667_10128593
686 Ga0207667_10448076
687 Ga0207667_10735818
688 Ga0207668_10118489
689 Ga0207658_10057022
690 Ga0207658_10059458
691 Ga0207703_10000075
692 Ga0207639_10045953
693 Ga0207639_10230311
694 Ga0207702_10022519
695 Ga0207702_10063023
696 Ga0207702_10107861
697 Ga0207702_11046561
698 Ga0207641_10001837
699 Ga0207641_10096681
700 Ga0207641_10270036
701 Ga0207676_10954397
702 Ga0207674_10009115
703 Ga0207683_10209383
704 Ga0207698_10000051
705 Ga0207698_10004434
706 Ga0209813_10005990
707 Ga0265336_10013389
708 Ga0307515_10176288
709 Ga0265338_10001142
710 Ga0265338_10004400
711 Ga0265773_1007563
712 Ga0307513_10006002
713 Ga0307513_10102772
714 Ga0307513_10119312
715 Ga0307408_100924924
716 Ga0307514_10008910
717 Ga0307514_10012051
718 Ga0307405_10388424
719 Ga0307413_10602781
720 Ga0307410_10322081
721 Ga0307410_10336602
722 Ga0307406_10001558
723 Ga0307406_10373753
724 Ga0307412_10323824
725 Ga0307409_100326608
726 Ga0307409_100462550
727 Ga0307416_100169734
728 Ga0307416_100266375
729 Ga0307416_100386473
730 Ga0307416_100766262
731 Ga0307415_100162209
732 Ga0307415_100511829
733 Ga0307507_10014905
734 Ga0316212_1001451
735 Ga0316216_1003309
736 Ga0373931_0442611
737 Ga0373933_0431183
738 Ga0373937_0619668
739 Ga0373937_0812392
740 Ga0395899_0401520
741 Ga0395900_0005157
742 Ga0395900_0080659
743 Ga0395900_0090189
744 Ga0395898_0001347
745 Ga0395898_0683261
746 Ga0395898_1222214
747 Ga0436364_0202989
748 Ga0395901_0002044
749 Ga0395901_0060822
750 Ga0395901_0076363
751 Ga0436363_0621718
752 Ga0436362_1049721
753 Ga0439461_0015030
754 Ga0439466_0005104
755 Ga0439465_0130361
756 Ga0439465_0373394
757 Ga0451787_236560
758 Ga0451807_0519205
759 Ga0451837_0591211
760 Ga0451853_0034856
761 Ga0451853_0902052
762 Ga0451853_1549727
763 Ga0439445_0000603
764 Ga0439434_0001336
765 Ga0439435_0023016
766 Ga0439459_0011173
767 Ga0466972_0081409
768 Ga0466972_0135724
769 Ga0466972_0168608
770 Ga0466972_0228630
771 Ga0466965_0058302
772 Ga0466961_0120585
773 Ga0466968_0016914
774 Ga0466968_0055826
775 Ga0466970_0013543
776 Ga0466970_0095009
777 Ga0466970_0106229
778 Ga0466957_0009523
779 Ga0466957_0069547
780 Ga0466957_0346404
781 Ga0466960_0110112
782 Ga0466960_0129203
783 Ga0466960_0144163
784 Ga0466960_0206862
785 Ga0466959_0026864
786 Ga0466959_0402555
787 Ga0466967_1367828
788 Ga0495638_0216048
789 Ga0495650_0002450
790 Ga0495644_0058035
791 Ga0495656_0027913
792 Ga0495668_0000932
793 Ga0495686_0133512
794 Ga0496100_0109623
795 Ga0496101_0009239
796 Ga0496102_0000383
797 Ga0496102_0183528
798 Ga0496102_0275765
799 Ga0496102_0864408
800 Ga0496103_0000019
801 Ga0496103_0586981
802 Ga0496104_0432467
803 Ga0496104_0490830
804 Ga0496105_0038211
805 Ga0496105_0100748
806 Ga0496105_0453616
807 Ga0496106_0162431
808 Ga0496110_0016676
809 Ga0496110_0792021
810 Ga0496112_0704649
811 Ga0496113_0093038
812 Ga0496113_0162517
813 Ga0496113_0323175
814 Ga0496114_0823810
815 Ga0496115_0116611
816 Ga0496115_0127669
817 Ga0496115_0301278
818 Ga0496116_0000269
819 Ga0496117_0000101
820 Ga0496117_0003876
821 Ga0496117_0005446
822 Ga0496117_0006740
823 Ga0496117_0019658
824 Ga0496118_0002407
825 Ga0496118_0009087
826 Ga0496118_0012292
827 Ga0496118_0022185
828 Ga0496118_0349308
829 Ga0496119_0000295
830 Ga0496119_0001254
831 Ga0496119_0004148
832 Ga0496119_0005358
833 Ga0496119_0300819
834 Ga0496120_0000257
835 Ga0496120_0004619
836 Ga0496120_0006422
837 Ga0496120_0017158
838 Ga0496120_0032801
839 Ga0496121_0028468
840 Ga0496122_0000460
841 Ga0496122_0001552
842 Ga0496123_0001151
843 Ga0496123_0001253
844 Ga0496123_0307475
845 Ga0496124_0004502
846 Ga0496124_0006354
847 Ga0496124_0324426
848 Ga0496125_0002435
849 Ga0496125_0005631
850 Ga0496125_0099063
851 Ga0496125_0475975
852 Ga0496126_0000565
853 Ga0496126_0002374
854 Ga0496126_0061930
855 Ga0496126_0076669
856 Ga0496126_0111578
857 Ga0496126_0246305
858 Ga0496126_0678026
859 Ga0496126_0979114
860 Ga0501032_0009854
861 Ga0501034_0015612
862 Ga0501034_0032363
863 Ga0501034_0046260
864 Ga0501034_0107737
865 Ga0501034_0125276
866 Ga0501034_0327010
867 Ga0501036_0042229
868 Ga0501036_0925034
869 Ga0501037_0013656
870 Ga0501037_0211838
871 Ga0501037_0264520
872 Ga0501039_0005433
873 Ga0501043_0010594
874 Ga0501043_0291804
875 Ga0501043_0515697
876 Ga0501046_0003371
877 Ga0501047_0020463
878 Ga0501047_0090398
879 Ga0501048_0002206
880 Ga0501069_0011244
881 Ga0501069_0036798
882 Ga0501069_0041254
883 Ga0501070_0001769
884 Ga0501070_0002527
885 Ga0501070_0003916
886 Ga0501070_0007672
887 Ga0501070_0012339
888 Ga0501070_0197070
889 Ga0501071_0000215
890 Ga0501072_0057160
891 Ga0501073_0068296
892 Ga0501073_0098287
893 Ga0501077_0439846
894 Ga0501079_0332257
895 Ga0501080_0000025
896 Ga0501035_0157373
897 Ga0501045_0015204
898 nmdc:mga03683_47156_c1
899 nmdc:mga00v17_108044_c1
900 nmdc:mga00v17_178440_c1
901 nmdc:mga00v17_289426_c1
902 nmdc:mga00v17_42202_c1
903 nmdc:mga00v17_508337_c1
904 nmdc:mga0yw44_303284_c1
905 nmdc:mga0yw44_317196_c1
906 nmdc:mga0yw44_60639_c1
907 nmdc:mga0yw44_66189_c2
908 nmdc:mga06z11_102017_c1
909 nmdc:mga04h51_22146_c1
910 nmdc:mga07m45_268082_c1
911 nmdc:mga07m45_36170_c1
912 nmdc:mga07m45_84481_c2
913 nmdc:mga0sz30_24750_c1
914 nmdc:mga0sz30_3192_c1
915 Ga0500635_0000004
916 Ga0500635_0026628
917 Ga0500643_000444
918 Ga0500651_0348117
919 Ga0500556_0000001
920 Ga0500556_0001116
921 Ga0500593_000714
922 Ga0500594_0035229
923 Ga0500652_139589
924 Ga0500655_009721
925 Ga0500559_0000319
926 Ga0500559_0002036
927 Ga0500559_0060206
928 Ga0500568_0000003
929 Ga0500568_0000252
930 Ga0500568_0010060
931 Ga0500568_0018809
932 Ga0500573_0000011
933 Ga0500573_0003249
934 Ga0500573_0006544
935 Ga0500573_0024186
936 Ga0500573_0033160
937 Ga0500573_0051030
938 Ga0500573_0101542
939 Ga0500573_0136554
940 Ga0500573_0197094
941 Ga0500577_0003173
942 Ga0500577_0113036
943 Ga0500577_0238044
944 Ga0500588_0025085
945 Ga0500616_0000109
946 Ga0500616_0005910
947 Ga0501084_0164589
948 Ga0501082_0180508
949 2919443587
950 2643768293
951 2643877894
952 2643886350
953 2644094953
954 2644111727
955 2644181056
956 2644278702
957 2644384949
958 2644636851
959 2723643032
960 2739366427
961 2774380853
962 2808883462
963 2808903024
964 2812324101
965 2844841430
966 2852634777
967 2852646373
968 2857720617
969 2857732101
970 2857736070
971 2862994559
972 2867315863
973 2867323670
974 2884764332
975 2895662765
976 2902811538
977 2904767697
978 2904774526
979 2908813341
980 2915362056
981 2919057075
982 2919424683
983 2919436936
984 2919527132
985 2928091388
986 2928125003
987 2935412199
988 2939660283
989 2939664242
990 2964327452
991 2966927247
992 2984581866
993 8002813894
994 8004214805
995 8016256809
996 8046355669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

1

189

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.957 3 190
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.9369 3 190
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8776 1 191
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8684 1 191
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.8671 2 191
ID Description Score Start End Superfamily
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.957 3 190 3.40.50.850
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9369 3 190 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8776 1 191 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8732 3 190 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8684 2 191 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A536IXX4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9895 97 190 GO:0016787
GO:0019363
GO:0046872
AF-A0A7K2BL85-F1-model_v4 deleted 0.986 77 190
AF-A0A494SX14-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9802 1 189 GO:0016787
GO:0019363
GO:0046872
AF-D5LFY8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9788 74 190 GO:0016787
GO:0019363
GO:0046872
AF-A0A653RWR2-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9786 1 189 GO:0016787
GO:0019363
GO:0046872

Map