F455341

General Info

Members Datasets Scaffolds Average Seq Length
499 223 499 177

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_101349390|Ga0068852_1013493902
Length 186
Sequence MPHALTPPMVAIIGRKHHGKTTLTVRLAAELHRRGYRVMTIKHGTHTFEIDPETTDTYRHYHEGLAEKVAMSAPDKFALIERWTDPLDPEDIARRYMADADIVLCEGFKQSALPKIEVFRASATDGERVPLYDPASPQASKYLAIVTDTPGVAPGVPAISMATPEWVERVADLVERRVMRRGSESK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
214 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.4
Rhizosphere 99.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10563864 3300005290 Unclassified 610
2 Ga0065707_10147158 3300005295 Bacteria 1699
3 Ga0070658_10435873 3300005327 Bacteria 1128
4 Ga0070676_10005634 3300005328 Bacteria 6670
5 Ga0070683_100008345 3300005329 Bacteria 8798
6 Ga0070683_100053914 3300005329 Bacteria 3727
7 Ga0070683_100072579 3300005329 Bacteria 3213
8 Ga0070683_100704387 3300005329 Bacteria 967
9 Ga0070683_101038638 3300005329 Bacteria 787
10 Ga0070670_100011811 3300005331 Bacteria 7467
11 Ga0070670_100018228 3300005331 Bacteria 6024
12 Ga0070666_10199000 3300005335 Bacteria 1409
13 Ga0070680_100020415 3300005336 Bacteria 5258
14 Ga0070680_100022590 3300005336 Bacteria 5012
15 Ga0070680_100050857 3300005336 Bacteria 3381
16 Ga0070680_100081408 3300005336 Bacteria 2671
17 Ga0070680_100171664 3300005336 Unclassified 1825
18 Ga0070680_100511891 3300005336 Bacteria 1027
19 Ga0070682_100137362 3300005337 Bacteria 1662
20 Ga0070682_100217315 3300005337 Bacteria 1358
21 Ga0070682_100465981 3300005337 Bacteria 971
22 Ga0068868_100039229 3300005338 Bacteria 3679
23 Ga0070660_100139370 3300005339 Bacteria 1945
24 Ga0070660_100385058 3300005339 Bacteria 1158
25 Ga0070660_100568169 3300005339 Bacteria 947
26 Ga0070689_100003984 3300005340 Bacteria 9923
27 Ga0070691_10038446 3300005341 Unclassified 2259
28 Ga0070691_10154250 3300005341 Bacteria 1179
29 Ga0070687_100001122 3300005343 Bacteria 9236
30 Ga0070661_100003423 3300005344 Bacteria 10954
31 Ga0070661_100010585 3300005344 Bacteria 6414
32 Ga0070661_100030291 3300005344 Bacteria 3909
33 Ga0070661_100067841 3300005344 Bacteria 2622
34 Ga0070661_100158781 3300005344 Bacteria 1712
35 Ga0070668_100019321 3300005347 Bacteria 5128
36 Ga0070668_100282718 3300005347 Bacteria 1386
37 Ga0070669_100011228 3300005353 Bacteria 6358
38 Ga0070669_100015757 3300005353 Bacteria 5389
39 Ga0070675_100002862 3300005354 Bacteria 13002
40 Ga0070675_100010690 3300005354 Bacteria 7177
41 Ga0070675_100192116 3300005354 Bacteria 1769
42 Ga0070671_100104534 3300005355 Bacteria 2376
43 Ga0070671_100293950 3300005355 Bacteria 1382
44 Ga0070671_101248278 3300005355 Bacteria 655
45 Ga0070673_100073970 3300005364 Bacteria 2744
46 Ga0070673_100195393 3300005364 Bacteria 1740
47 Ga0070688_100004597 3300005365 Bacteria 7200
48 Ga0070688_100079414 3300005365 Bacteria 2120
49 Ga0070659_100000927 3300005366 Bacteria 21513
50 Ga0070659_100063194 3300005366 Bacteria 2929
51 Ga0070659_100205561 3300005366 Bacteria 1622
52 Ga0070667_100035311 3300005367 Bacteria 4187
53 Ga0070667_100127869 3300005367 Bacteria 2216
54 Ga0070709_10178915 3300005434 Bacteria 1488
55 Ga0070714_100000922 3300005435 Bacteria 20838
56 Ga0070714_100022844 3300005435 Bacteria 5133
57 Ga0070701_10028626 3300005438 Bacteria 2740
58 Ga0070701_10036358 3300005438 Bacteria 2481
59 Ga0070711_100089598 3300005439 Unclassified 2213
60 Ga0070700_100031854 3300005441 Bacteria 3164
61 Ga0070694_100070440 3300005444 Bacteria 2408
62 Ga0070694_100213186 3300005444 Unclassified 1445
63 Ga0070663_100095608 3300005455 Bacteria 2209
64 Ga0070662_100028793 3300005457 Bacteria 3869
65 Ga0070662_100082741 3300005457 Unclassified 2394
66 Ga0070681_10001558 3300005458 Bacteria 20324
67 Ga0070681_10025472 3300005458 Bacteria 5950
68 Ga0070681_10040102 3300005458 Bacteria 4695
69 Ga0070681_10422242 3300005458 Unclassified 1245
70 Ga0068867_100017557 3300005459 Bacteria 5081
71 Ga0068867_100211289 3300005459 Unclassified 1559
72 Ga0070698_100176445 3300005471 Unclassified 2076
73 Ga0070699_100201171 3300005518 Unclassified 1771
74 Ga0070679_100002296 3300005530 Bacteria 17285
75 Ga0070679_100009136 3300005530 Bacteria 9356
76 Ga0070679_100016949 3300005530 Bacteria 7042
77 Ga0070679_100020623 3300005530 Bacteria 6427
78 Ga0070679_100280036 3300005530 Bacteria 1620
79 Ga0070684_100004027 3300005535 Bacteria 11119
80 Ga0070684_100108808 3300005535 Bacteria 2483
81 Ga0070684_100168214 3300005535 Unclassified 1990
82 Ga0068853_100001865 3300005539 Bacteria 15492
83 Ga0068853_100011922 3300005539 Bacteria 7068
84 Ga0068853_100141034 3300005539 Unclassified 2163
85 Ga0068853_100467568 3300005539 Bacteria 1188
86 Ga0070672_100008863 3300005543 Bacteria 6909
87 Ga0070672_100013147 3300005543 Bacteria 5835
88 Ga0070672_100028188 3300005543 Bacteria 4197
89 Ga0070686_100045683 3300005544 Bacteria 2760
90 Ga0070695_100324793 3300005545 Bacteria 1145
91 Ga0070696_100032639 3300005546 Bacteria 3572
92 Ga0070665_100066822 3300005548 Bacteria 3607
93 Ga0070665_100187524 3300005548 Bacteria 2069
94 Ga0070665_100358195 3300005548 Bacteria 1465
95 Ga0070704_100020808 3300005549 Bacteria 4239
96 Ga0070704_100604849 3300005549 Bacteria 964
97 Ga0068855_100169322 3300005563 Bacteria 2474
98 Ga0068855_100320695 3300005563 Unclassified 1713
99 Ga0068855_100526606 3300005563 Bacteria 1282
100 Ga0070664_100000995 3300005564 Bacteria 22203
101 Ga0070664_100044755 3300005564 Unclassified 3738
102 Ga0070664_100105444 3300005564 Bacteria 2455
103 Ga0070664_100371939 3300005564 Unclassified 1303
104 Ga0068857_100053484 3300005577 Bacteria 3582
105 Ga0068857_100257923 3300005577 Bacteria 1600
106 Ga0068857_100906438 3300005577 Unclassified 845
107 Ga0068854_100030973 3300005578 Bacteria 3714
108 Ga0068854_100033244 3300005578 Bacteria 3595
109 Ga0068854_100924091 3300005578 Bacteria 768
110 Ga0068856_100040252 3300005614 Bacteria 4589
111 Ga0068856_100196607 3300005614 Unclassified 2030
112 Ga0068856_100763779 3300005614 Bacteria 987
113 Ga0068852_100030960 3300005616 Bacteria 4409
114 Ga0068852_100118815 3300005616 Bacteria 2416
115 Ga0068852_100137298 3300005616 Bacteria 2258
116 Ga0068852_100158171 3300005616 Unclassified 2113
117 Ga0068852_100494932 3300005616 Bacteria 1217
118 Ga0068852_101349390 3300005616 Unclassified 735
119 Ga0068859_100111829 3300005617 Bacteria 2794
120 Ga0068859_100209294 3300005617 Bacteria 2036
121 Ga0068864_100437185 3300005618 Unclassified 1249
122 Ga0068866_11090485 3300005718 Bacteria 571
123 Ga0068861_100000159 3300005719 Bacteria 35347
124 Ga0068851_10010117 3300005834 Bacteria 4396
125 Ga0068851_10027514 3300005834 Bacteria 2803
126 Ga0068870_10010166 3300005840 Bacteria 4309
127 Ga0068863_100736502 3300005841 Unclassified 981
128 Ga0068858_100008100 3300005842 Bacteria 10113
129 Ga0068860_100057037 3300005843 Bacteria 3712
130 Ga0068862_100010438 3300005844 Bacteria 7669
131 Ga0068862_100625818 3300005844 Unclassified 1036
132 Ga0075432_10062577 3300006058 Bacteria 1327
133 Ga0070712_100017818 3300006175 Bacteria 4601
134 Ga0075428_100548776 3300006844 Unclassified 1235
135 Ga0075428_101045388 3300006844 Bacteria 864
136 Ga0075428_101120452 3300006844 Unclassified 831
137 Ga0075430_100053262 3300006846 Bacteria 3407
138 Ga0075430_100075645 3300006846 Bacteria 2823
139 Ga0075430_100165202 3300006846 Bacteria 1842
140 Ga0075430_100495873 3300006846 Unclassified 1008
141 Ga0075430_100528573 3300006846 Unclassified 973
142 Ga0075431_100028686 3300006847 Bacteria 5723
143 Ga0075431_100191567 3300006847 Bacteria 2095
144 Ga0075431_100235817 3300006847 Bacteria 1863
145 Ga0075433_10153400 3300006852 Bacteria 2049
146 Ga0075434_100001647 3300006871 Bacteria 19018
147 Ga0075434_100009099 3300006871 Bacteria 9251
148 Ga0075434_100448697 3300006871 Unclassified 1311
149 Ga0075429_100056666 3300006880 Bacteria 3412
150 Ga0075429_100270973 3300006880 Bacteria 1487
151 Ga0075429_100285205 3300006880 Bacteria 1446
152 Ga0068865_101049597 3300006881 Unclassified 716
153 Ga0075436_100014600 3300006914 Bacteria 5384
154 Ga0075436_100032986 3300006914 Bacteria 3568
155 Ga0097620_100111826 3300006931 Bacteria 2794
156 Ga0097620_100209298 3300006931 Bacteria 2036
157 Ga0105240_10005639 3300009093 Bacteria 18584
158 Ga0105240_10092926 3300009093 Unclassified 3683
159 Ga0105240_10148303 3300009093 Bacteria 2796
160 Ga0105240_10158489 3300009093 Bacteria 2690
161 Ga0105240_10551610 3300009093 Bacteria 1275
162 Ga0111539_10012544 3300009094 Bacteria 10619
163 Ga0111539_10023867 3300009094 Bacteria 7512
164 Ga0111539_11378883 3300009094 Unclassified 818
165 Ga0114129_10064192 3300009147 Bacteria 5124
166 Ga0114129_10136256 3300009147 Bacteria 3369
167 Ga0114129_10168959 3300009147 Unclassified 2982
168 Ga0114129_10216460 3300009147 Bacteria 2587
169 Ga0114129_11303035 3300009147 Unclassified 900
170 Ga0105243_10806025 3300009148 Unclassified 926
171 Ga0105243_10968130 3300009148 Bacteria 851
172 Ga0105241_10157152 3300009174 Unclassified 1866
173 Ga0105248_10018227 3300009177 Bacteria 7752
174 Ga0105237_10381466 3300009545 Bacteria 1414
175 Ga0105237_11430859 3300009545 Unclassified 698
176 Ga0105238_10018262 3300009551 Bacteria 7134
177 Ga0105238_10080102 3300009551 Bacteria 3255
178 Ga0105238_10627699 3300009551 Bacteria 1084
179 Ga0105249_10000061 3300009553 Bacteria 153313
180 Ga0105249_10000251 3300009553 Bacteria 59080
181 Ga0105249_10014545 3300009553 Bacteria 6957
182 Ga0105239_10031596 3300010375 Bacteria 5821
183 Ga0157373_10000734 3300013100 Bacteria 25474
184 Ga0157373_10043539 3300013100 Bacteria 3207
185 Ga0157373_10489061 3300013100 Bacteria 888
186 Ga0157371_10003449 3300013102 Bacteria 14344
187 Ga0157370_10010187 3300013104 Bacteria 9927
188 Ga0157370_10028530 3300013104 Bacteria 5488
189 Ga0157370_10030983 3300013104 Bacteria 5237
190 Ga0157370_10052263 3300013104 Bacteria 3901
191 Ga0157370_10402624 3300013104 Bacteria 1260
192 Ga0157369_10017846 3300013105 Bacteria 7966
193 Ga0157369_10306434 3300013105 Bacteria 1652
194 Ga0157369_11687988 3300013105 Unclassified 644
195 Ga0157374_10040159 3300013296 Bacteria 4308
196 Ga0157374_10335559 3300013296 Bacteria 1500
197 Ga0157378_10230037 3300013297 Bacteria 1766
198 Ga0157378_10800986 3300013297 Bacteria 968
199 Ga0163162_10001610 3300013306 Bacteria 21128
200 Ga0157372_10011047 3300013307 Bacteria 9608
201 Ga0157372_10012762 3300013307 Bacteria 8951
202 Ga0157372_10017931 3300013307 Bacteria 7608
203 Ga0157372_10028925 3300013307 Bacteria 6047
204 Ga0157372_10029899 3300013307 Bacteria 5952
205 Ga0157372_10256445 3300013307 Unclassified 2030
206 Ga0157372_10412583 3300013307 Bacteria 1574
207 Ga0157375_10009033 3300013308 Bacteria 8726
208 Ga0157375_10313438 3300013308 Bacteria 1733
209 Ga0163163_10004943 3300014325 Bacteria 11470
210 Ga0157380_10124335 3300014326 Bacteria 2190
211 Ga0157377_10161662 3300014745 Bacteria 1393
212 Ga0157379_10104123 3300014968 Bacteria 2547
213 Ga0157376_10004598 3300014969 Bacteria 9612
214 Ga0207697_10002776 3300025315 Bacteria 8934
215 Ga0207656_10043757 3300025321 Bacteria 1910
216 Ga0207656_10283192 3300025321 Unclassified 818
217 Ga0207642_10580214 3300025899 Bacteria 696
218 Ga0207688_10044075 3300025901 Bacteria 2486
219 Ga0207688_10172109 3300025901 Unclassified 1288
220 Ga0207688_10248970 3300025901 Unclassified 1076
221 Ga0207645_10000126 3300025907 Bacteria 58037
222 Ga0207643_10010631 3300025908 Bacteria 4960
223 Ga0207705_10346640 3300025909 Bacteria 1144
224 Ga0207705_10468388 3300025909 Unclassified 978
225 Ga0207705_10921595 3300025909 Unclassified 676
226 Ga0207654_10367494 3300025911 Unclassified 994
227 Ga0207707_10007146 3300025912 Bacteria 9722
228 Ga0207707_10008041 3300025912 Bacteria 9161
229 Ga0207707_10009247 3300025912 Bacteria 8551
230 Ga0207707_10034842 3300025912 Bacteria 4403
231 Ga0207707_10040365 3300025912 Bacteria 4076
232 Ga0207707_10055895 3300025912 Bacteria 3433
233 Ga0207707_10275184 3300025912 Bacteria 1459
234 Ga0207695_10007739 3300025913 Bacteria 13612
235 Ga0207695_10009332 3300025913 Bacteria 12141
236 Ga0207695_10063916 3300025913 Bacteria 3792
237 Ga0207695_10163233 3300025913 Unclassified 2158
238 Ga0207671_10579985 3300025914 Unclassified 894
239 Ga0207671_11126717 3300025914 Bacteria 616
240 Ga0207693_10078318 3300025915 Bacteria 2587
241 Ga0207663_10159500 3300025916 Unclassified 1591
242 Ga0207660_10011518 3300025917 Bacteria 5761
243 Ga0207660_10072559 3300025917 Unclassified 2507
244 Ga0207660_10244983 3300025917 Bacteria 1413
245 Ga0207660_10247316 3300025917 Unclassified 1407
246 Ga0207660_10282087 3300025917 Bacteria 1318
247 Ga0207660_10399874 3300025917 Unclassified 1106
248 Ga0207662_10001210 3300025918 Bacteria 12337
249 Ga0207657_10021720 3300025919 Bacteria 6033
250 Ga0207657_10099294 3300025919 Unclassified 2418
251 Ga0207657_10166102 3300025919 Bacteria 1790
252 Ga0207649_10006718 3300025920 Bacteria 6249
253 Ga0207649_10083779 3300025920 Bacteria 2071
254 Ga0207649_10092127 3300025920 Bacteria 1986
255 Ga0207649_10117259 3300025920 Bacteria 1789
256 Ga0207649_10582459 3300025920 Bacteria 859
257 Ga0207652_10007288 3300025921 Bacteria 8910
258 Ga0207652_10044154 3300025921 Bacteria 3796
259 Ga0207652_10049821 3300025921 Bacteria 3586
260 Ga0207652_10145163 3300025921 Bacteria 2123
261 Ga0207652_10281226 3300025921 Bacteria 1501
262 Ga0207652_10290334 3300025921 Unclassified 1475
263 Ga0207652_10724747 3300025921 Bacteria 886
264 Ga0207681_10011288 3300025923 Bacteria 5488
265 Ga0207681_10014445 3300025923 Bacteria 4908
266 Ga0207694_10033323 3300025924 Bacteria 3946
267 Ga0207694_10232566 3300025924 Bacteria 1505
268 Ga0207650_10012819 3300025925 Bacteria 5792
269 Ga0207650_10174082 3300025925 Bacteria 1712
270 Ga0207659_10052621 3300025926 Bacteria 2901
271 Ga0207659_10063956 3300025926 Bacteria 2661
272 Ga0207659_10074103 3300025926 Bacteria 2494
273 Ga0207659_10408925 3300025926 Bacteria 1136
274 Ga0207664_10046257 3300025929 Bacteria 3415
275 Ga0207664_10129898 3300025929 Unclassified 2119
276 Ga0207644_10172616 3300025931 Bacteria 1689
277 Ga0207644_10184066 3300025931 Bacteria 1639
278 Ga0207644_10331771 3300025931 Bacteria 1232
279 Ga0207644_10427881 3300025931 Bacteria 1085
280 Ga0207690_10007424 3300025932 Bacteria 6507
281 Ga0207690_10076382 3300025932 Bacteria 2326
282 Ga0207690_10078449 3300025932 Bacteria 2298
283 Ga0207706_10000360 3300025933 Bacteria 49293
284 Ga0207706_10012526 3300025933 Bacteria 7725
285 Ga0207706_10039780 3300025933 Bacteria 4169
286 Ga0207709_10176938 3300025935 Unclassified 1503
287 Ga0207670_10023547 3300025936 Bacteria 3835
288 Ga0207669_10075605 3300025937 Bacteria 2135
289 Ga0207669_10225688 3300025937 Bacteria 1378
290 Ga0207704_10305536 3300025938 Bacteria 1220
291 Ga0207691_10000840 3300025940 Bacteria 30601
292 Ga0207691_10002534 3300025940 Bacteria 17853
293 Ga0207691_10208777 3300025940 Unclassified 1697
294 Ga0207711_10045678 3300025941 Bacteria 3743
295 Ga0207689_10014073 3300025942 Bacteria 6809
296 Ga0207689_10980621 3300025942 Unclassified 713
297 Ga0207661_10076882 3300025944 Bacteria 2743
298 Ga0207661_10361338 3300025944 Bacteria 1311
299 Ga0207661_10377397 3300025944 Bacteria 1283
300 Ga0207661_10466549 3300025944 Bacteria 1151
301 Ga0207661_10521113 3300025944 Bacteria 1087
302 Ga0207661_10869410 3300025944 Bacteria 830
303 Ga0207661_11262756 3300025944 Bacteria 679
304 Ga0207679_10007624 3300025945 Bacteria 6873
305 Ga0207679_10017691 3300025945 Bacteria 4759
306 Ga0207679_10077360 3300025945 Unclassified 2531
307 Ga0207679_10085861 3300025945 Bacteria 2419
308 Ga0207667_10114826 3300025949 Bacteria 2775
309 Ga0207667_10378998 3300025949 Bacteria 1441
310 Ga0207667_10505134 3300025949 Bacteria 1226
311 Ga0207667_10890234 3300025949 Bacteria 882
312 Ga0207651_10068974 3300025960 Bacteria 2495
313 Ga0207651_10907691 3300025960 Unclassified 785
314 Ga0207712_10000144 3300025961 Bacteria 74254
315 Ga0207712_10002205 3300025961 Bacteria 12685
316 Ga0207712_10009221 3300025961 Bacteria 6248
317 Ga0207668_10013894 3300025972 Bacteria 4972
318 Ga0207668_10080060 3300025972 Bacteria 2365
319 Ga0207668_10263959 3300025972 Bacteria 1404
320 Ga0207640_10019803 3300025981 Bacteria 3983
321 Ga0207640_10061158 3300025981 Bacteria 2493
322 Ga0207640_10157937 3300025981 Bacteria 1674
323 Ga0207640_10937212 3300025981 Bacteria 758
324 Ga0207677_10005577 3300026023 Bacteria 6835
325 Ga0207639_10069872 3300026041 Bacteria 2741
326 Ga0207639_10192702 3300026041 Bacteria 1742
327 Ga0207639_10597585 3300026041 Bacteria 1017
328 Ga0207678_10174660 3300026067 Bacteria 1834
329 Ga0207678_10603535 3300026067 Unclassified 962
330 Ga0207708_10003170 3300026075 Bacteria 12111
331 Ga0207702_10427553 3300026078 Bacteria 1282
332 Ga0207648_10004412 3300026089 Bacteria 14454
333 Ga0207648_10132673 3300026089 Bacteria 2192
334 Ga0207676_10444141 3300026095 Unclassified 1221
335 Ga0207674_10002884 3300026116 Bacteria 21373
336 Ga0207674_10005816 3300026116 Bacteria 14630
337 Ga0207674_10268016 3300026116 Bacteria 1655
338 Ga0207675_100004288 3300026118 Bacteria 13789
339 Ga0207698_10022576 3300026142 Bacteria 4376
340 Ga0207698_10163455 3300026142 Bacteria 1950
341 Ga0207698_10386356 3300026142 Bacteria 1333
342 Ga0207698_10828149 3300026142 Bacteria 929
343 Ga0207428_10011495 3300027907 Bacteria 7825
344 Ga0207428_10034372 3300027907 Bacteria 4155
345 Ga0268266_11720456 3300028379 Unclassified 602
346 Ga0268265_10011222 3300028380 Bacteria 6056
347 Ga0268265_10037690 3300028380 Bacteria 3550
348 Ga0268264_10009244 3300028381 Bacteria 8161
349 Ga0307408_100005978 3300031548 Bacteria 8102
350 Ga0307408_100031381 3300031548 Bacteria 3700
351 Ga0307408_100111012 3300031548 Bacteria 2106
352 Ga0307405_10000752 3300031731 Bacteria 12631
353 Ga0307405_10009761 3300031731 Bacteria 4936
354 Ga0307405_10025637 3300031731 Bacteria 3388
355 Ga0307413_10001411 3300031824 Bacteria 9083
356 Ga0307413_10010440 3300031824 Bacteria 4505
357 Ga0307413_10330839 3300031824 Unclassified 1168
358 Ga0307413_10469715 3300031824 Bacteria 1003
359 Ga0307410_10004606 3300031852 Bacteria 7157
360 Ga0307410_10021505 3300031852 Bacteria 3969
361 Ga0307410_10035456 3300031852 Bacteria 3240
362 Ga0307410_10089433 3300031852 Unclassified 2182
363 Ga0307406_10002935 3300031901 Bacteria 9282
364 Ga0307406_10015395 3300031901 Bacteria 4425
365 Ga0307406_10026339 3300031901 Bacteria 3490
366 Ga0307406_10039726 3300031901 Bacteria 2921
367 Ga0307406_10259593 3300031901 Bacteria 1313
368 Ga0307406_10285961 3300031901 Unclassified 1260
369 Ga0307406_10488581 3300031901 Unclassified 996
370 Ga0307407_10014853 3300031903 Bacteria 3827
371 Ga0307407_10042727 3300031903 Bacteria 2544
372 Ga0307407_10077499 3300031903 Bacteria 1999
373 Ga0307407_10136824 3300031903 Bacteria 1575
374 Ga0307407_10430553 3300031903 Bacteria 953
375 Ga0307412_10000867 3300031911 Bacteria 17373
376 Ga0307412_10006680 3300031911 Bacteria 6539
377 Ga0307412_10012833 3300031911 Bacteria 4893
378 Ga0307412_10260549 3300031911 Bacteria 1351
379 Ga0307412_10965750 3300031911 Bacteria 751
380 Ga0307412_11071465 3300031911 Bacteria 716
381 Ga0307409_100000357 3300031995 Bacteria 19077
382 Ga0307409_100182189 3300031995 Bacteria 1860
383 Ga0307409_100186434 3300031995 Bacteria 1842
384 Ga0307416_100003409 3300032002 Bacteria 9326
385 Ga0307416_100009979 3300032002 Bacteria 6249
386 Ga0307416_100014064 3300032002 Bacteria 5465
387 Ga0307416_100023030 3300032002 Bacteria 4510
388 Ga0307416_100043982 3300032002 Bacteria 3502
389 Ga0307416_100047725 3300032002 Bacteria 3392
390 Ga0307416_100783790 3300032002 Bacteria 1048
391 Ga0307416_100808123 3300032002 Bacteria 1034
392 Ga0307416_101049014 3300032002 Unclassified 919
393 Ga0307416_101402536 3300032002 Unclassified 804
394 Ga0307416_101695743 3300032002 Bacteria 737
395 Ga0307414_10053876 3300032004 Bacteria 2808
396 Ga0307414_10082773 3300032004 Bacteria 2354
397 Ga0307414_10236105 3300032004 Bacteria 1510
398 Ga0307414_11017635 3300032004 Unclassified 763
399 Ga0307414_11213851 3300032004 Unclassified 698
400 Ga0307411_10005565 3300032005 Bacteria 6205
401 Ga0307411_10009766 3300032005 Bacteria 5069
402 Ga0307411_10018040 3300032005 Bacteria 4039
403 Ga0307411_10026246 3300032005 Bacteria 3506
404 Ga0307411_10083384 3300032005 Bacteria 2208
405 Ga0307411_10120112 3300032005 Bacteria 1899
406 Ga0307415_100001197 3300032126 Bacteria 12144
407 Ga0307415_100006368 3300032126 Bacteria 6357
408 Ga0307415_100060636 3300032126 Bacteria 2615
409 Ga0307415_100276410 3300032126 Unclassified 1379
410 Ga0307415_101383167 3300032126 Unclassified 669
411 Ga0373946_0124988 3300035171 Unclassified 1178
412 Ga0373927_0574160 3300035695 Unclassified 745
413 Ga0373947_0189081 3300035725 Unclassified 1343
414 Ga0373937_0138839 3300036401 Bacteria 2273
415 Ga0395901_0684748 3300038443 Bacteria 1025
416 Ga0439439_0013584 3300041406 Bacteria 1975
417 Ga0439433_0032133 3300041999 Bacteria 1203
418 Ga0439446_0035521 3300042156 Bacteria 1454
419 Ga0439434_0011608 3300042435 Bacteria 2604
420 Ga0451577_0932048 3300042876 Bacteria 781
421 Ga0466963_0584861 3300044694 Unclassified 788
422 Ga0466958_0053848 3300045836 Bacteria 2440
423 Ga0495592_0124268 3300046454 Bacteria 1812
424 Ga0495629_0590608 3300046459 Unclassified 743
425 Ga0495580_0071982 3300046472 Bacteria 2415
426 Ga0495582_0351131 3300046473 Unclassified 849
427 Ga0495664_0433707 3300046477 Unclassified 788
428 Ga0495584_0298840 3300046491 Unclassified 818
429 Ga0495594_0235963 3300046499 Bacteria 1042
430 Ga0495618_0035132 3300046514 Bacteria 3146
431 Ga0495628_0087750 3300046516 Unclassified 2411
432 Ga0495630_0307002 3300046517 Unclassified 1212
433 Ga0495652_0010050 3300046529 Bacteria 8579
434 Ga0495652_0051759 3300046529 Bacteria 3505
435 Ga0495652_0174538 3300046529 Unclassified 1656
436 Ga0495640_0015887 3300046533 Bacteria 5648
437 Ga0495640_0136299 3300046533 Unclassified 1585
438 Ga0495587_0210442 3300046536 Unclassified 1098
439 Ga0495645_0077446 3300046543 Unclassified 2391
440 Ga0495645_0248823 3300046543 Bacteria 1182
441 Ga0495645_0261822 3300046543 Bacteria 1145
442 Ga0495634_0105083 3300046642 Bacteria 1821
443 Ga0495599_0045366 3300046678 Bacteria 2756
444 Ga0495599_0116606 3300046678 Unclassified 1661
445 Ga0495623_0240108 3300046679 Unclassified 1024
446 Ga0495646_0259119 3300046680 Bacteria 930
447 Ga0495647_0113968 3300046681 Bacteria 1131
448 Ga0495613_0289650 3300046689 Unclassified 1135
449 Ga0495624_0149139 3300046690 Bacteria 1431
450 Ga0495600_0009030 3300046809 Bacteria 6142
451 Ga0495600_0568074 3300046809 Bacteria 692
452 Ga0495604_0118706 3300047317 Unclassified 1917
453 Ga0495674_0059541 3300047319 Bacteria 3335
454 Ga0495680_0024806 3300047322 Bacteria 4967
455 Ga0495675_0140993 3300047444 Bacteria 1494
456 Ga0495675_0411226 3300047444 Unclassified 787
457 Ga0495677_0097735 3300047445 Bacteria 1110
458 Ga0495684_0020213 3300047471 Bacteria 5129
459 Ga0495602_0051950 3300048088 Bacteria 3645
460 Ga0496109_0750454 3300048912 Bacteria 914
461 Ga0496113_1085761 3300048916 Bacteria 628
462 Ga0501298_039585 3300049521 Bacteria 952
463 Ga0501040_0243931 3300049576 Unclassified 1281
464 Ga0501040_0258663 3300049576 Bacteria 1242
465 Ga0501072_0138993 3300049588 Bacteria 1937
466 Ga0501077_0251487 3300049593 Unclassified 1124
467 Ga0501202_119699 3300049652 Unclassified 660
468 Ga0501235_081220 3300049669 Unclassified 775
469 Ga0501225_0173227 3300049705 Unclassified 670
470 Ga0501081_0415875 3300049743 Unclassified 996
471 Ga0501273_048534 3300049770 Bacteria 644
472 Ga0501283_042490 3300049779 Unclassified 790
473 nmdc:mga05p37_253017_c1 3300050507 Bacteria 2112
474 nmdc:mga05p37_347014_c1 3300050507 Unclassified 1748
475 nmdc:mga05p37_347382_c1 3300050507 Bacteria 1747
476 nmdc:mga05p37_451957_c1 3300050507 Bacteria 1487
477 nmdc:mga09592_214340_c1 3300050508 Bacteria 1668
478 nmdc:mga09592_277399_c1 3300050508 Bacteria 1454
479 nmdc:mga0qj67_115403_c1 3300050509 Bacteria 2170
480 nmdc:mga0qj67_137629_c1 3300050509 Bacteria 1979
481 nmdc:mga0qj67_164602_c1 3300050509 Bacteria 1800
482 nmdc:mga0qj67_294616_c1 3300050509 Bacteria 1315
483 nmdc:mga0qj67_778376_c1 3300050509 Unclassified 758
484 nmdc:mga06r32_101025_c1 3300050510 Unclassified 2830
485 nmdc:mga06r32_189330_c1 3300050510 Bacteria 2045
486 nmdc:mga06r32_248034_c1 3300050510 Bacteria 1768
487 nmdc:mga06r32_274008_c1 3300050510 Bacteria 1675
488 nmdc:mga06r32_39006_c1 3300050510 Bacteria 4504
489 nmdc:mga06r32_940807_c1 3300050510 Unclassified 819
490 nmdc:mga08y16_217595_c1 3300050511 Bacteria 1978
491 nmdc:mga08y16_693948_c1 3300050511 Bacteria 1018
492 nmdc:mga0n895_1921_c1 3300050512 Bacteria 15922
493 nmdc:mga0n895_511341_c1 3300050512 Unclassified 1209
494 nmdc:mga0n895_5208_c1 3300050512 Bacteria 10826
495 nmdc:mga08x19_2197_c1 3300050514 Bacteria 11933
496 nmdc:mga08x19_26821_c1 3300050514 Bacteria 3598
497 nmdc:mga0a205_146521_c1 3300050515 Unclassified 2261
498 nmdc:mga0a205_262932_c1 3300050515 Bacteria 1603
499 Ga0495619_0196964 3300053085 Unclassified 1395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0251487 Ga0501077_0251487_177_656 157
2 3300050509 nmdc:mga0qj67_294616_c1 nmdc:mga0qj67_294616_c1_320_799 157
3 3300025942 Ga0207689_10980621 Ga0207689_109806211 162
4 3300013307 Ga0157372_10029899 Ga0157372_100298993 168
5 3300005329 Ga0070683_100072579 Ga0070683_1000725792 169
6 3300005336 Ga0070680_100022590 Ga0070680_1000225906 169
7 3300005354 Ga0070675_100192116 Ga0070675_1001921162 169
8 3300005365 Ga0070688_100079414 Ga0070688_1000794143 169
9 3300005438 Ga0070701_10028626 Ga0070701_100286263 169
10 3300005530 Ga0070679_100009136 Ga0070679_1000091365 169
11 3300005549 Ga0070704_100020808 Ga0070704_1000208082 169
12 3300005617 Ga0068859_100111829 Ga0068859_1001118292 169
13 3300006846 Ga0075430_100075645 Ga0075430_1000756453 169
14 3300006931 Ga0097620_100111826 Ga0097620_1001118262 169
15 3300009093 Ga0105240_10148303 Ga0105240_101483034 169
16 3300009148 Ga0105243_10806025 Ga0105243_108060252 169
17 3300009553 Ga0105249_10000251 Ga0105249_1000025151 169
18 3300013104 Ga0157370_10028530 Ga0157370_100285306 169
19 3300013308 Ga0157375_10009033 Ga0157375_100090337 169
20 3300025912 Ga0207707_10040365 Ga0207707_100403652 169
21 3300025917 Ga0207660_10011518 Ga0207660_100115184 169
22 3300025921 Ga0207652_10044154 Ga0207652_100441546 169
23 3300025926 Ga0207659_10074103 Ga0207659_100741032 169
24 3300025944 Ga0207661_10076882 Ga0207661_100768822 169
25 3300049588 Ga0501072_0138993 Ga0501072_0138993_596_1105 169
26 3300009147 Ga0114129_10136256 Ga0114129_101362565 170
27 3300009177 Ga0105248_10018227 Ga0105248_100182276 170
28 3300010375 Ga0105239_10031596 Ga0105239_100315967 170
29 3300013102 Ga0157371_10003449 Ga0157371_100034495 170
30 3300014326 Ga0157380_10124335 Ga0157380_101243352 170
31 3300014968 Ga0157379_10104123 Ga0157379_101041234 170
32 3300036401 Ga0373937_0138839 Ga0373937_0138839_1375_1890 170
33 3300046477 Ga0495664_0433707 Ga0495664_0433707_89_604 170
34 3300046491 Ga0495584_0298840 Ga0495584_0298840_190_702 170
35 3300046514 Ga0495618_0035132 Ga0495618_0035132_11_526 170
36 3300046516 Ga0495628_0087750 Ga0495628_0087750_1851_2366 170
37 3300046517 Ga0495630_0307002 Ga0495630_0307002_509_1024 170
38 3300046529 Ga0495652_0174538 Ga0495652_0174538_786_1301 170
39 3300046533 Ga0495640_0136299 Ga0495640_0136299_683_1198 170
40 3300046536 Ga0495587_0210442 Ga0495587_0210442_42_557 170
41 3300046543 Ga0495645_0077446 Ga0495645_0077446_1606_2121 170
42 3300046678 Ga0495599_0116606 Ga0495599_0116606_398_913 170
43 3300046689 Ga0495613_0289650 Ga0495613_0289650_531_1046 170
44 3300046809 Ga0495600_0009030 Ga0495600_0009030_165_680 170
45 3300047317 Ga0495604_0118706 Ga0495604_0118706_956_1471 170
46 3300047322 Ga0495680_0024806 Ga0495680_0024806_511_1026 170
47 3300047444 Ga0495675_0411226 Ga0495675_0411226_44_559 170
48 3300048088 Ga0495602_0051950 Ga0495602_0051950_527_1042 170
49 3300050508 nmdc:mga09592_214340_c1 nmdc:mga09592_214340_c1_154_666 170
50 3300050509 nmdc:mga0qj67_137629_c1 nmdc:mga0qj67_137629_c1_943_1455 170
51 3300050510 nmdc:mga06r32_248034_c1 nmdc:mga06r32_248034_c1_275_787 170
52 3300053085 Ga0495619_0196964 Ga0495619_0196964_500_1015 170
53 3300005530 Ga0070679_100002296 Ga0070679_10000229614 171
54 3300009093 Ga0105240_10005639 Ga0105240_1000563918 171
55 3300009174 Ga0105241_10157152 Ga0105241_101571522 171
56 3300013100 Ga0157373_10000734 Ga0157373_1000073412 171
57 3300013104 Ga0157370_10030983 Ga0157370_100309836 171
58 3300013307 Ga0157372_10028925 Ga0157372_100289256 171
59 3300013307 Ga0157372_10412583 Ga0157372_104125832 171
60 3300041999 Ga0439433_0032133 Ga0439433_0032133_577_1092 171
61 3300042156 Ga0439446_0035521 Ga0439446_0035521_63_578 171
62 3300042435 Ga0439434_0011608 Ga0439434_0011608_86_601 171
63 3300045836 Ga0466958_0053848 Ga0466958_0053848_263_778 171
64 3300046454 Ga0495592_0124268 Ga0495592_0124268_275_793 171
65 3300046529 Ga0495652_0051759 Ga0495652_0051759_2644_3162 171
66 3300046543 Ga0495645_0248823 Ga0495645_0248823_303_821 171
67 3300046678 Ga0495599_0045366 Ga0495599_0045366_1342_1860 171
68 3300049576 Ga0501040_0243931 Ga0501040_0243931_728_1243 171
69 3300049652 Ga0501202_119699 Ga0501202_119699_122_637 171
70 3300049669 Ga0501235_081220 Ga0501235_081220_223_741 171
71 3300049743 Ga0501081_0415875 Ga0501081_0415875_238_753 171
72 3300050510 nmdc:mga06r32_101025_c1 nmdc:mga06r32_101025_c1_427_942 171
73 3300006846 Ga0075430_100165202 Ga0075430_1001652022 172
74 3300006847 Ga0075431_100235817 Ga0075431_1002358172 172
75 3300009147 Ga0114129_10064192 Ga0114129_100641923 172
76 3300009147 Ga0114129_10216460 Ga0114129_102164602 172
77 3300027907 Ga0207428_10011495 Ga0207428_100114955 172
78 3300031731 Ga0307405_10025637 Ga0307405_100256372 172
79 3300031901 Ga0307406_10285961 Ga0307406_102859612 172
80 3300031903 Ga0307407_10430553 Ga0307407_104305532 172
81 3300031911 Ga0307412_10000867 Ga0307412_100008679 172
82 3300032002 Ga0307416_100014064 Ga0307416_1000140642 172
83 3300032005 Ga0307411_10083384 Ga0307411_100833843 172
84 3300049576 Ga0501040_0258663 Ga0501040_0258663_544_1071 172
85 3300049770 Ga0501273_048534 Ga0501273_048534_47_595 172
86 3300050507 nmdc:mga05p37_253017_c1 nmdc:mga05p37_253017_c1_1034_1552 172
87 3300050510 nmdc:mga06r32_274008_c1 nmdc:mga06r32_274008_c1_535_1098 172
88 3300050515 nmdc:mga0a205_146521_c1 nmdc:mga0a205_146521_c1_1108_1626 172
89 3300005329 Ga0070683_100704387 Ga0070683_1007043871 173
90 3300005331 Ga0070670_100011811 Ga0070670_1000118116 173
91 3300005354 Ga0070675_100010690 Ga0070675_1000106907 173
92 3300005367 Ga0070667_100127869 Ga0070667_1001278692 173
93 3300005518 Ga0070699_100201171 Ga0070699_1002011712 173
94 3300005530 Ga0070679_100020623 Ga0070679_1000206233 173
95 3300005530 Ga0070679_100280036 Ga0070679_1002800362 173
96 3300006847 Ga0075431_100191567 Ga0075431_1001915671 173
97 3300009093 Ga0105240_10092926 Ga0105240_100929262 173
98 3300009093 Ga0105240_10158489 Ga0105240_101584893 173
99 3300009093 Ga0105240_10551610 Ga0105240_105516102 173
100 3300009094 Ga0111539_10012544 Ga0111539_100125445 173
101 3300009094 Ga0111539_10023867 Ga0111539_100238674 173
102 3300009094 Ga0111539_11378883 Ga0111539_113788832 173
103 3300009147 Ga0114129_10168959 Ga0114129_101689592 173
104 3300009147 Ga0114129_11303035 Ga0114129_113030351 173
105 3300009148 Ga0105243_10968130 Ga0105243_109681302 173
106 3300009545 Ga0105237_10381466 Ga0105237_103814661 173
107 3300009545 Ga0105237_11430859 Ga0105237_114308591 173
108 3300009551 Ga0105238_10080102 Ga0105238_100801022 173
109 3300009551 Ga0105238_10627699 Ga0105238_106276992 173
110 3300009553 Ga0105249_10014545 Ga0105249_100145455 173
111 3300013100 Ga0157373_10489061 Ga0157373_104890612 173
112 3300013104 Ga0157370_10010187 Ga0157370_100101878 173
113 3300013104 Ga0157370_10052263 Ga0157370_100522632 173
114 3300013104 Ga0157370_10402624 Ga0157370_104026241 173
115 3300013105 Ga0157369_10017846 Ga0157369_100178465 173
116 3300013105 Ga0157369_11687988 Ga0157369_116879881 173
117 3300013296 Ga0157374_10040159 Ga0157374_100401593 173
118 3300013296 Ga0157374_10335559 Ga0157374_103355592 173
119 3300013297 Ga0157378_10230037 Ga0157378_102300371 173
120 3300013297 Ga0157378_10800986 Ga0157378_108009862 173
121 3300013306 Ga0163162_10001610 Ga0163162_1000161017 173
122 3300013307 Ga0157372_10011047 Ga0157372_100110476 173
123 3300013307 Ga0157372_10017931 Ga0157372_100179317 173
124 3300013307 Ga0157372_10256445 Ga0157372_102564451 173
125 3300013308 Ga0157375_10313438 Ga0157375_103134382 173
126 3300014325 Ga0163163_10004943 Ga0163163_100049437 173
127 3300014745 Ga0157377_10161662 Ga0157377_101616621 173
128 3300025913 Ga0207695_10009332 Ga0207695_100093326 173
129 3300025914 Ga0207671_11126717 Ga0207671_111267171 173
130 3300025917 Ga0207660_10244983 Ga0207660_102449831 173
131 3300025949 Ga0207667_10890234 Ga0207667_108902342 173
132 3300025981 Ga0207640_10937212 Ga0207640_109372122 173
133 3300031911 Ga0307412_10260549 Ga0307412_102605493 173
134 3300035171 Ga0373946_0124988 Ga0373946_0124988_73_594 173
135 3300035725 Ga0373947_0189081 Ga0373947_0189081_12_533 173
136 3300038443 Ga0395901_0684748 Ga0395901_0684748_43_564 173
137 3300041406 Ga0439439_0013584 Ga0439439_0013584_710_1270 173
138 3300044694 Ga0466963_0584861 Ga0466963_0584861_39_575 173
139 3300046472 Ga0495580_0071982 Ga0495580_0071982_413_934 173
140 3300046473 Ga0495582_0351131 Ga0495582_0351131_37_558 173
141 3300046499 Ga0495594_0235963 Ga0495594_0235963_374_898 173
142 3300046529 Ga0495652_0010050 Ga0495652_0010050_5610_6134 173
143 3300046533 Ga0495640_0015887 Ga0495640_0015887_313_837 173
144 3300046543 Ga0495645_0261822 Ga0495645_0261822_485_1009 173
145 3300046642 Ga0495634_0105083 Ga0495634_0105083_271_795 173
146 3300046679 Ga0495623_0240108 Ga0495623_0240108_59_583 173
147 3300046680 Ga0495646_0259119 Ga0495646_0259119_56_580 173
148 3300046681 Ga0495647_0113968 Ga0495647_0113968_508_1032 173
149 3300046690 Ga0495624_0149139 Ga0495624_0149139_579_1103 173
150 3300046809 Ga0495600_0568074 Ga0495600_0568074_156_680 173
151 3300047319 Ga0495674_0059541 Ga0495674_0059541_2227_2751 173
152 3300047444 Ga0495675_0140993 Ga0495675_0140993_448_972 173
153 3300047445 Ga0495677_0097735 Ga0495677_0097735_471_992 173
154 3300047471 Ga0495684_0020213 Ga0495684_0020213_4022_4546 173
155 3300048912 Ga0496109_0750454 Ga0496109_0750454_313_834 173
156 3300048916 Ga0496113_1085761 Ga0496113_1085761_71_592 173
157 3300049521 Ga0501298_039585 Ga0501298_039585_72_593 173
158 3300050507 nmdc:mga05p37_347014_c1 nmdc:mga05p37_347014_c1_121_642 173
159 3300050507 nmdc:mga05p37_347382_c1 nmdc:mga05p37_347382_c1_732_1253 173
160 3300050507 nmdc:mga05p37_451957_c1 nmdc:mga05p37_451957_c1_744_1265 173
161 3300050508 nmdc:mga09592_277399_c1 nmdc:mga09592_277399_c1_408_971 173
162 3300050509 nmdc:mga0qj67_115403_c1 nmdc:mga0qj67_115403_c1_146_679 173
163 3300050509 nmdc:mga0qj67_164602_c1 nmdc:mga0qj67_164602_c1_1169_1699 173
164 3300050509 nmdc:mga0qj67_778376_c1 nmdc:mga0qj67_778376_c1_71_598 173
165 3300050510 nmdc:mga06r32_189330_c1 nmdc:mga06r32_189330_c1_1376_1897 173
166 3300050510 nmdc:mga06r32_39006_c1 nmdc:mga06r32_39006_c1_3938_4468 173
167 3300050510 nmdc:mga06r32_940807_c1 nmdc:mga06r32_940807_c1_197_724 173
168 3300050511 nmdc:mga08y16_217595_c1 nmdc:mga08y16_217595_c1_315_845 173
169 3300050511 nmdc:mga08y16_693948_c1 nmdc:mga08y16_693948_c1_269_790 173
170 3300050512 nmdc:mga0n895_5208_c1 nmdc:mga0n895_5208_c1_4891_5412 173
171 3300050514 nmdc:mga08x19_2197_c1 nmdc:mga08x19_2197_c1_3640_4176 173
172 3300050514 nmdc:mga08x19_26821_c1 nmdc:mga08x19_26821_c1_2099_2635 173
173 3300050515 nmdc:mga0a205_262932_c1 nmdc:mga0a205_262932_c1_863_1384 173
174 3300005329 Ga0070683_101038638 Ga0070683_1010386382 174
175 3300005337 Ga0070682_100465981 Ga0070682_1004659812 174
176 3300005614 Ga0068856_100763779 Ga0068856_1007637792 174
177 3300013100 Ga0157373_10043539 Ga0157373_100435393 174
178 3300025944 Ga0207661_11262756 Ga0207661_112627562 174
179 3300005347 Ga0070668_100282718 Ga0070668_1002827182 175
180 3300005435 Ga0070714_100000922 Ga0070714_10000092216 175
181 3300005458 Ga0070681_10040102 Ga0070681_100401027 175
182 3300005458 Ga0070681_10422242 Ga0070681_104222422 175
183 3300005539 Ga0068853_100001865 Ga0068853_1000018657 175
184 3300005548 Ga0070665_100187524 Ga0070665_1001875242 175
185 3300005563 Ga0068855_100169322 Ga0068855_1001693222 175
186 3300005563 Ga0068855_100526606 Ga0068855_1005266062 175
187 3300005614 Ga0068856_100040252 Ga0068856_1000402523 175
188 3300005616 Ga0068852_100118815 Ga0068852_1001188151 175
189 3300006844 Ga0075428_101045388 Ga0075428_1010453882 175
190 3300006846 Ga0075430_100053262 Ga0075430_1000532624 175
191 3300006880 Ga0075429_100056666 Ga0075429_1000566663 175
192 3300009551 Ga0105238_10018262 Ga0105238_100182623 175
193 3300009553 Ga0105249_10000061 Ga0105249_1000006131 175
194 3300013105 Ga0157369_10306434 Ga0157369_103064342 175
195 3300013307 Ga0157372_10012762 Ga0157372_100127624 175
196 3300014969 Ga0157376_10004598 Ga0157376_100045982 175
197 3300025912 Ga0207707_10275184 Ga0207707_102751842 175
198 3300025917 Ga0207660_10399874 Ga0207660_103998742 175
199 3300025920 Ga0207649_10092127 Ga0207649_100921274 175
200 3300025921 Ga0207652_10145163 Ga0207652_101451632 175
201 3300025924 Ga0207694_10033323 Ga0207694_100333234 175
202 3300025929 Ga0207664_10046257 Ga0207664_100462572 175
203 3300025932 Ga0207690_10076382 Ga0207690_100763823 175
204 3300025949 Ga0207667_10114826 Ga0207667_101148262 175
205 3300025961 Ga0207712_10000144 Ga0207712_1000014455 175
206 3300025972 Ga0207668_10263959 Ga0207668_102639592 175
207 3300025981 Ga0207640_10019803 Ga0207640_100198033 175
208 3300026041 Ga0207639_10069872 Ga0207639_100698723 175
209 3300026067 Ga0207678_10174660 Ga0207678_101746603 175
210 3300026142 Ga0207698_10022576 Ga0207698_100225763 175
211 3300032126 Ga0307415_100276410 Ga0307415_1002764102 175
212 3300032126 Ga0307415_101383167 Ga0307415_1013831672 175
213 3300005327 Ga0070658_10435873 Ga0070658_104358731 176
214 3300005329 Ga0070683_100053914 Ga0070683_1000539144 176
215 3300005336 Ga0070680_100020415 Ga0070680_1000204152 176
216 3300005336 Ga0070680_100511891 Ga0070680_1005118911 176
217 3300005337 Ga0070682_100217315 Ga0070682_1002173151 176
218 3300005339 Ga0070660_100568169 Ga0070660_1005681691 176
219 3300005341 Ga0070691_10038446 Ga0070691_100384463 176
220 3300005344 Ga0070661_100010585 Ga0070661_1000105855 176
221 3300005458 Ga0070681_10025472 Ga0070681_100254724 176
222 3300005535 Ga0070684_100108808 Ga0070684_1001088082 176
223 3300005535 Ga0070684_100168214 Ga0070684_1001682142 176
224 3300005539 Ga0068853_100467568 Ga0068853_1004675682 176
225 3300005546 Ga0070696_100032639 Ga0070696_1000326393 176
226 3300005548 Ga0070665_100066822 Ga0070665_1000668223 176
227 3300005563 Ga0068855_100320695 Ga0068855_1003206953 176
228 3300005578 Ga0068854_100033244 Ga0068854_1000332442 176
229 3300005578 Ga0068854_100924091 Ga0068854_1009240911 176
230 3300005616 Ga0068852_100158171 Ga0068852_1001581713 176
231 3300025901 Ga0207688_10248970 Ga0207688_102489702 176
232 3300025909 Ga0207705_10346640 Ga0207705_103466402 176
233 3300025911 Ga0207654_10367494 Ga0207654_103674942 176
234 3300025912 Ga0207707_10009247 Ga0207707_100092476 176
235 3300025912 Ga0207707_10055895 Ga0207707_100558953 176
236 3300025913 Ga0207695_10007739 Ga0207695_1000773915 176
237 3300025913 Ga0207695_10063916 Ga0207695_100639164 176
238 3300025917 Ga0207660_10072559 Ga0207660_100725594 176
239 3300025919 Ga0207657_10099294 Ga0207657_100992943 176
240 3300025920 Ga0207649_10582459 Ga0207649_105824591 176
241 3300025921 Ga0207652_10007288 Ga0207652_100072884 176
242 3300025921 Ga0207652_10049821 Ga0207652_100498212 176
243 3300025926 Ga0207659_10408925 Ga0207659_104089252 176
244 3300025938 Ga0207704_10305536 Ga0207704_103055362 176
245 3300025949 Ga0207667_10378998 Ga0207667_103789983 176
246 3300025960 Ga0207651_10907691 Ga0207651_109076912 176
247 3300026041 Ga0207639_10192702 Ga0207639_101927022 176
248 3300031903 Ga0307407_10042727 Ga0307407_100427274 176
249 3300031911 Ga0307412_10965750 Ga0307412_109657502 176
250 3300031911 Ga0307412_11071465 Ga0307412_110714651 176
251 3300032002 Ga0307416_100783790 Ga0307416_1007837902 176
252 3300032002 Ga0307416_100808123 Ga0307416_1008081232 176
253 3300032002 Ga0307416_101049014 Ga0307416_1010490142 176
254 3300032002 Ga0307416_101402536 Ga0307416_1014025362 176
255 3300032004 Ga0307414_11213851 Ga0307414_112138512 176
256 3300032005 Ga0307411_10026246 Ga0307411_100262465 176
257 3300042876 Ga0451577_0932048 Ga0451577_0932048_48_578 176
258 3300049705 Ga0501225_0173227 Ga0501225_0173227_29_559 176
259 3300049779 Ga0501283_042490 Ga0501283_042490_197_727 176
260 3300005353 Ga0070669_100011228 Ga0070669_1000112286 177
261 3300005444 Ga0070694_100213186 Ga0070694_1002131862 177
262 3300005457 Ga0070662_100028793 Ga0070662_1000287936 177
263 3300005459 Ga0068867_100211289 Ga0068867_1002112892 177
264 3300005543 Ga0070672_100013147 Ga0070672_1000131473 177
265 3300005564 Ga0070664_100105444 Ga0070664_1001054442 177
266 3300005577 Ga0068857_100906438 Ga0068857_1009064382 177
267 3300005618 Ga0068864_100437185 Ga0068864_1004371852 177
268 3300005840 Ga0068870_10010166 Ga0068870_100101662 177
269 3300005844 Ga0068862_100010438 Ga0068862_1000104386 177
270 3300006844 Ga0075428_100548776 Ga0075428_1005487762 177
271 3300006844 Ga0075428_101120452 Ga0075428_1011204522 177
272 3300006852 Ga0075433_10153400 Ga0075433_101534003 177
273 3300006871 Ga0075434_100448697 Ga0075434_1004486972 177
274 3300025908 Ga0207643_10010631 Ga0207643_100106314 177
275 3300025923 Ga0207681_10011288 Ga0207681_100112884 177
276 3300025933 Ga0207706_10012526 Ga0207706_100125266 177
277 3300025940 Ga0207691_10208777 Ga0207691_102087773 177
278 3300025961 Ga0207712_10009221 Ga0207712_100092216 177
279 3300025972 Ga0207668_10013894 Ga0207668_100138946 177
280 3300026089 Ga0207648_10132673 Ga0207648_101326732 177
281 3300026095 Ga0207676_10444141 Ga0207676_104441412 177
282 3300028380 Ga0268265_10011222 Ga0268265_100112227 177
283 3300031548 Ga0307408_100031381 Ga0307408_1000313812 177
284 3300031548 Ga0307408_100111012 Ga0307408_1001110122 177
285 3300031731 Ga0307405_10000752 Ga0307405_1000075210 177
286 3300031731 Ga0307405_10009761 Ga0307405_100097615 177
287 3300031824 Ga0307413_10001411 Ga0307413_100014113 177
288 3300031824 Ga0307413_10010440 Ga0307413_100104402 177
289 3300031824 Ga0307413_10469715 Ga0307413_104697152 177
290 3300031852 Ga0307410_10004606 Ga0307410_100046066 177
291 3300031852 Ga0307410_10021505 Ga0307410_100215052 177
292 3300031852 Ga0307410_10035456 Ga0307410_100354562 177
293 3300031901 Ga0307406_10015395 Ga0307406_100153956 177
294 3300031901 Ga0307406_10026339 Ga0307406_100263394 177
295 3300031901 Ga0307406_10039726 Ga0307406_100397264 177
296 3300031901 Ga0307406_10259593 Ga0307406_102595933 177
297 3300031903 Ga0307407_10014853 Ga0307407_100148532 177
298 3300031903 Ga0307407_10077499 Ga0307407_100774992 177
299 3300031903 Ga0307407_10136824 Ga0307407_101368242 177
300 3300031911 Ga0307412_10006680 Ga0307412_100066806 177
301 3300031911 Ga0307412_10012833 Ga0307412_100128334 177
302 3300031995 Ga0307409_100000357 Ga0307409_10000035719 177
303 3300031995 Ga0307409_100182189 Ga0307409_1001821891 177
304 3300031995 Ga0307409_100186434 Ga0307409_1001864342 177
305 3300032002 Ga0307416_100003409 Ga0307416_1000034094 177
306 3300032002 Ga0307416_100009979 Ga0307416_1000099792 177
307 3300032002 Ga0307416_100023030 Ga0307416_1000230303 177
308 3300032002 Ga0307416_100043982 Ga0307416_1000439822 177
309 3300032002 Ga0307416_100047725 Ga0307416_1000477252 177
310 3300032004 Ga0307414_10053876 Ga0307414_100538763 177
311 3300032004 Ga0307414_10082773 Ga0307414_100827733 177
312 3300032004 Ga0307414_10236105 Ga0307414_102361052 177
313 3300032005 Ga0307411_10005565 Ga0307411_100055653 177
314 3300032005 Ga0307411_10009766 Ga0307411_100097667 177
315 3300032005 Ga0307411_10018040 Ga0307411_100180404 177
316 3300032005 Ga0307411_10120112 Ga0307411_101201122 177
317 3300032126 Ga0307415_100001197 Ga0307415_10000119711 177
318 3300032126 Ga0307415_100006368 Ga0307415_1000063684 177
319 3300032126 Ga0307415_100060636 Ga0307415_1000606362 177
320 3300050512 nmdc:mga0n895_511341_c1 nmdc:mga0n895_511341_c1_121_654 177
321 3300005290 Ga0065712_10563864 Ga0065712_105638641 178
322 3300005295 Ga0065707_10147158 Ga0065707_101471581 178
323 3300005328 Ga0070676_10005634 Ga0070676_100056345 178
324 3300005329 Ga0070683_100008345 Ga0070683_1000083457 178
325 3300005331 Ga0070670_100018228 Ga0070670_1000182283 178
326 3300005335 Ga0070666_10199000 Ga0070666_101990002 178
327 3300005336 Ga0070680_100050857 Ga0070680_1000508572 178
328 3300005336 Ga0070680_100081408 Ga0070680_1000814085 178
329 3300005336 Ga0070680_100171664 Ga0070680_1001716642 178
330 3300005337 Ga0070682_100137362 Ga0070682_1001373622 178
331 3300005338 Ga0068868_100039229 Ga0068868_1000392293 178
332 3300005339 Ga0070660_100139370 Ga0070660_1001393702 178
333 3300005339 Ga0070660_100385058 Ga0070660_1003850582 178
334 3300005340 Ga0070689_100003984 Ga0070689_1000039849 178
335 3300005341 Ga0070691_10154250 Ga0070691_101542502 178
336 3300005343 Ga0070687_100001122 Ga0070687_1000011224 178
337 3300005344 Ga0070661_100003423 Ga0070661_1000034236 178
338 3300005344 Ga0070661_100030291 Ga0070661_1000302912 178
339 3300005344 Ga0070661_100067841 Ga0070661_1000678413 178
340 3300005344 Ga0070661_100158781 Ga0070661_1001587812 178
341 3300005347 Ga0070668_100019321 Ga0070668_1000193215 178
342 3300005353 Ga0070669_100015757 Ga0070669_1000157576 178
343 3300005354 Ga0070675_100002862 Ga0070675_1000028625 178
344 3300005355 Ga0070671_100104534 Ga0070671_1001045341 178
345 3300005355 Ga0070671_100293950 Ga0070671_1002939502 178
346 3300005355 Ga0070671_101248278 Ga0070671_1012482781 178
347 3300005364 Ga0070673_100073970 Ga0070673_1000739704 178
348 3300005364 Ga0070673_100195393 Ga0070673_1001953932 178
349 3300005365 Ga0070688_100004597 Ga0070688_1000045978 178
350 3300005366 Ga0070659_100000927 Ga0070659_10000092722 178
351 3300005366 Ga0070659_100063194 Ga0070659_1000631942 178
352 3300005366 Ga0070659_100205561 Ga0070659_1002055612 178
353 3300005367 Ga0070667_100035311 Ga0070667_1000353117 178
354 3300005434 Ga0070709_10178915 Ga0070709_101789152 178
355 3300005435 Ga0070714_100022844 Ga0070714_1000228442 178
356 3300005438 Ga0070701_10036358 Ga0070701_100363582 178
357 3300005439 Ga0070711_100089598 Ga0070711_1000895982 178
358 3300005441 Ga0070700_100031854 Ga0070700_1000318543 178
359 3300005444 Ga0070694_100070440 Ga0070694_1000704402 178
360 3300005455 Ga0070663_100095608 Ga0070663_1000956082 178
361 3300005457 Ga0070662_100082741 Ga0070662_1000827411 178
362 3300005458 Ga0070681_10001558 Ga0070681_1000155810 178
363 3300005459 Ga0068867_100017557 Ga0068867_1000175577 178
364 3300005471 Ga0070698_100176445 Ga0070698_1001764453 178
365 3300005530 Ga0070679_100016949 Ga0070679_1000169496 178
366 3300005535 Ga0070684_100004027 Ga0070684_10000402710 178
367 3300005539 Ga0068853_100011922 Ga0068853_1000119223 178
368 3300005539 Ga0068853_100141034 Ga0068853_1001410342 178
369 3300005543 Ga0070672_100008863 Ga0070672_1000088633 178
370 3300005543 Ga0070672_100028188 Ga0070672_1000281885 178
371 3300005544 Ga0070686_100045683 Ga0070686_1000456834 178
372 3300005545 Ga0070695_100324793 Ga0070695_1003247932 178
373 3300005548 Ga0070665_100358195 Ga0070665_1003581951 178
374 3300005549 Ga0070704_100604849 Ga0070704_1006048492 178
375 3300005564 Ga0070664_100000995 Ga0070664_10000099513 178
376 3300005564 Ga0070664_100044755 Ga0070664_1000447552 178
377 3300005564 Ga0070664_100371939 Ga0070664_1003719392 178
378 3300005577 Ga0068857_100053484 Ga0068857_1000534845 178
379 3300005577 Ga0068857_100257923 Ga0068857_1002579232 178
380 3300005578 Ga0068854_100030973 Ga0068854_1000309735 178
381 3300005614 Ga0068856_100196607 Ga0068856_1001966072 178
382 3300005616 Ga0068852_100030960 Ga0068852_1000309604 178
383 3300005616 Ga0068852_100137298 Ga0068852_1001372982 178
384 3300005616 Ga0068852_100494932 Ga0068852_1004949322 178
385 3300005616 Ga0068852_101349390 Ga0068852_1013493902 178
386 3300005617 Ga0068859_100209294 Ga0068859_1002092942 178
387 3300005718 Ga0068866_11090485 Ga0068866_110904851 178
388 3300005719 Ga0068861_100000159 Ga0068861_10000015917 178
389 3300005834 Ga0068851_10010117 Ga0068851_100101177 178
390 3300005834 Ga0068851_10027514 Ga0068851_100275142 178
391 3300005841 Ga0068863_100736502 Ga0068863_1007365022 178
392 3300005842 Ga0068858_100008100 Ga0068858_1000081004 178
393 3300005843 Ga0068860_100057037 Ga0068860_1000570373 178
394 3300005844 Ga0068862_100625818 Ga0068862_1006258182 178
395 3300006058 Ga0075432_10062577 Ga0075432_100625772 178
396 3300006175 Ga0070712_100017818 Ga0070712_1000178187 178
397 3300006846 Ga0075430_100495873 Ga0075430_1004958732 178
398 3300006846 Ga0075430_100528573 Ga0075430_1005285732 178
399 3300006847 Ga0075431_100028686 Ga0075431_1000286863 178
400 3300006871 Ga0075434_100001647 Ga0075434_1000016477 178
401 3300006871 Ga0075434_100009099 Ga0075434_1000090995 178
402 3300006880 Ga0075429_100270973 Ga0075429_1002709732 178
403 3300006880 Ga0075429_100285205 Ga0075429_1002852052 178
404 3300006881 Ga0068865_101049597 Ga0068865_1010495972 178
405 3300006914 Ga0075436_100014600 Ga0075436_1000146002 178
406 3300006914 Ga0075436_100032986 Ga0075436_1000329862 178
407 3300006931 Ga0097620_100209298 Ga0097620_1002092982 178
408 3300025315 Ga0207697_10002776 Ga0207697_100027768 178
409 3300025321 Ga0207656_10043757 Ga0207656_100437572 178
410 3300025321 Ga0207656_10283192 Ga0207656_102831922 178
411 3300025899 Ga0207642_10580214 Ga0207642_105802142 178
412 3300025901 Ga0207688_10044075 Ga0207688_100440752 178
413 3300025901 Ga0207688_10172109 Ga0207688_101721092 178
414 3300025907 Ga0207645_10000126 Ga0207645_1000012644 178
415 3300025909 Ga0207705_10468388 Ga0207705_104683882 178
416 3300025909 Ga0207705_10921595 Ga0207705_109215951 178
417 3300025912 Ga0207707_10007146 Ga0207707_100071462 178
418 3300025912 Ga0207707_10008041 Ga0207707_100080413 178
419 3300025912 Ga0207707_10034842 Ga0207707_100348426 178
420 3300025913 Ga0207695_10163233 Ga0207695_101632332 178
421 3300025914 Ga0207671_10579985 Ga0207671_105799852 178
422 3300025915 Ga0207693_10078318 Ga0207693_100783181 178
423 3300025916 Ga0207663_10159500 Ga0207663_101595002 178
424 3300025917 Ga0207660_10247316 Ga0207660_102473162 178
425 3300025917 Ga0207660_10282087 Ga0207660_102820872 178
426 3300025918 Ga0207662_10001210 Ga0207662_1000121010 178
427 3300025919 Ga0207657_10021720 Ga0207657_100217203 178
428 3300025919 Ga0207657_10166102 Ga0207657_101661022 178
429 3300025920 Ga0207649_10006718 Ga0207649_100067187 178
430 3300025920 Ga0207649_10083779 Ga0207649_100837792 178
431 3300025920 Ga0207649_10117259 Ga0207649_101172592 178
432 3300025921 Ga0207652_10281226 Ga0207652_102812262 178
433 3300025921 Ga0207652_10290334 Ga0207652_102903342 178
434 3300025921 Ga0207652_10724747 Ga0207652_107247472 178
435 3300025923 Ga0207681_10014445 Ga0207681_100144452 178
436 3300025924 Ga0207694_10232566 Ga0207694_102325662 178
437 3300025925 Ga0207650_10012819 Ga0207650_100128196 178
438 3300025925 Ga0207650_10174082 Ga0207650_101740822 178
439 3300025926 Ga0207659_10052621 Ga0207659_100526213 178
440 3300025926 Ga0207659_10063956 Ga0207659_100639563 178
441 3300025929 Ga0207664_10129898 Ga0207664_101298983 178
442 3300025931 Ga0207644_10172616 Ga0207644_101726162 178
443 3300025931 Ga0207644_10184066 Ga0207644_101840662 178
444 3300025931 Ga0207644_10331771 Ga0207644_103317712 178
445 3300025931 Ga0207644_10427881 Ga0207644_104278812 178
446 3300025932 Ga0207690_10007424 Ga0207690_100074247 178
447 3300025932 Ga0207690_10078449 Ga0207690_100784492 178
448 3300025933 Ga0207706_10000360 Ga0207706_1000036014 178
449 3300025933 Ga0207706_10039780 Ga0207706_100397802 178
450 3300025935 Ga0207709_10176938 Ga0207709_101769382 178
451 3300025936 Ga0207670_10023547 Ga0207670_100235475 178
452 3300025937 Ga0207669_10075605 Ga0207669_100756053 178
453 3300025937 Ga0207669_10225688 Ga0207669_102256882 178
454 3300025940 Ga0207691_10000840 Ga0207691_100008404 178
455 3300025940 Ga0207691_10002534 Ga0207691_1000253410 178
456 3300025941 Ga0207711_10045678 Ga0207711_100456783 178
457 3300025942 Ga0207689_10014073 Ga0207689_100140732 178
458 3300025944 Ga0207661_10361338 Ga0207661_103613382 178
459 3300025944 Ga0207661_10377397 Ga0207661_103773972 178
460 3300025944 Ga0207661_10466549 Ga0207661_104665492 178
461 3300025944 Ga0207661_10521113 Ga0207661_105211132 178
462 3300025944 Ga0207661_10869410 Ga0207661_108694102 178
463 3300025945 Ga0207679_10007624 Ga0207679_100076241 178
464 3300025945 Ga0207679_10017691 Ga0207679_100176912 178
465 3300025945 Ga0207679_10077360 Ga0207679_100773603 178
466 3300025945 Ga0207679_10085861 Ga0207679_100858612 178
467 3300025949 Ga0207667_10505134 Ga0207667_105051342 178
468 3300025960 Ga0207651_10068974 Ga0207651_100689742 178
469 3300025961 Ga0207712_10002205 Ga0207712_100022059 178
470 3300025972 Ga0207668_10080060 Ga0207668_100800602 178
471 3300025981 Ga0207640_10061158 Ga0207640_100611582 178
472 3300025981 Ga0207640_10157937 Ga0207640_101579372 178
473 3300026023 Ga0207677_10005577 Ga0207677_100055775 178
474 3300026041 Ga0207639_10597585 Ga0207639_105975852 178
475 3300026067 Ga0207678_10603535 Ga0207678_106035352 178
476 3300026075 Ga0207708_10003170 Ga0207708_100031706 178
477 3300026078 Ga0207702_10427553 Ga0207702_104275532 178
478 3300026089 Ga0207648_10004412 Ga0207648_1000441210 178
479 3300026116 Ga0207674_10002884 Ga0207674_1000288414 178
480 3300026116 Ga0207674_10005816 Ga0207674_100058166 178
481 3300026116 Ga0207674_10268016 Ga0207674_102680162 178
482 3300026118 Ga0207675_100004288 Ga0207675_10000428810 178
483 3300026142 Ga0207698_10163455 Ga0207698_101634552 178
484 3300026142 Ga0207698_10386356 Ga0207698_103863561 178
485 3300026142 Ga0207698_10828149 Ga0207698_108281492 178
486 3300027907 Ga0207428_10034372 Ga0207428_100343726 178
487 3300028379 Ga0268266_11720456 Ga0268266_117204562 178
488 3300028380 Ga0268265_10037690 Ga0268265_100376902 178
489 3300028381 Ga0268264_10009244 Ga0268264_100092447 178
490 3300031548 Ga0307408_100005978 Ga0307408_1000059782 178
491 3300031824 Ga0307413_10330839 Ga0307413_103308392 178
492 3300031852 Ga0307410_10089433 Ga0307410_100894332 178
493 3300031901 Ga0307406_10002935 Ga0307406_1000293511 178
494 3300031901 Ga0307406_10488581 Ga0307406_104885812 178
495 3300032002 Ga0307416_101695743 Ga0307416_1016957432 178
496 3300032004 Ga0307414_11017635 Ga0307414_110176351 178
497 3300035695 Ga0373927_0574160 Ga0373927_0574160_138_674 178
498 3300046459 Ga0495629_0590608 Ga0495629_0590608_147_683 178
499 3300050512 nmdc:mga0n895_1921_c1 nmdc:mga0n895_1921_c1_5309_5845 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03205

MobB

Molybdopterin guanine dinucleotide synthesis protein B

9

148

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f48-assembly1.cif.gz_A crystal structure of the escherichia coli arsenite-translocating atpase 0.8381 1 39
1p9n-assembly1.cif.gz_B crystal structure of escherichia coli mobb. 0.8256 4 170
8elf-assembly1.cif.gz_A structure of get3d, a homolog of get3, from arabidopsis thaliana 0.8138 5 50
8elf-assembly1.cif.gz_B structure of get3d, a homolog of get3, from arabidopsis thaliana 0.807 5 50
1np6-assembly1.cif.gz_A crystal structure of escherichia coli mobb 0.8068 4 176
ID Description Score Start End Superfamily
af_A0A1D6E955_51_382_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9129 4 39 3.40.50.300
af_Q7JWD3_1_334_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8513 4 43 3.40.50.300
1ihuA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8373 1 39 3.40.50.300
af_Q4CVV4_130_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8292 3 30 3.40.50.300
af_P32125_6_175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8284 5 170 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X5WJ61-F1-model_v4 deleted 0.9305 6 170
AF-A0A2V7LMK5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9289 6 172 GO:0005525
GO:0006777
AF-A0A1E4B481-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9284 1 170 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0061603
AF-A0A523N4H5-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9266 2 172 GO:0005525
GO:0006777
AF-A0A7K1KKF7-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein B 0.9215 2 171 GO:0005525
GO:0006777

Feature Viewer

pLDDT pTM Quality
86.82 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map