F455344

General Info

Members Datasets Scaffolds Average Seq Length
499 177 998 217

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10025465|Ga0081455_100254654
Length 248
Sequence MPQSDEQGSEGNNVADLMCRVPPGRTIFDVPKPELSVAIQDYVKEIYKLQSSGQRATTTAIAKEMGVAPSSVTSMVKKLAALGLANHAPYRGVELSDAGTKIALEVIRHHRLLEQYLAETLGVPIDAVHDEADRLEHVISEELEARIDEQLGYPTHDPHGDPIPDARLNVTRQDLRSLDVLEPGEEATVRRIPDGDADLLRYLAGLTLVPGQRVTMRKSEPFGGPLTVDVEGSEHAISRELAERIGVS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 2.81
Rhizosphere 96.59
Stem 0
Stem Tuber 0
Unclassified 4.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10025465 3300005937 Bacteria 5460
2 Ga0070683_100289251 3300005329 Unclassified 1559
3 Ga0070690_100080154 3300005330 Bacteria 2135
4 Ga0068869_100192848 3300005334 Bacteria 1603
5 Ga0068869_100260280 3300005334 Bacteria 1389
6 Ga0070680_100138918 3300005336 Bacteria 2037
7 Ga0070680_100816657 3300005336 Bacteria 804
8 Ga0070682_100677316 3300005337 Bacteria 824
9 Ga0070689_100021672 3300005340 Bacteria 4788
10 Ga0070661_100634591 3300005344 Bacteria 866
11 Ga0070668_100204062 3300005347 Bacteria 1624
12 Ga0070668_100451531 3300005347 Bacteria 1105
13 Ga0070675_100110659 3300005354 Bacteria 2323
14 Ga0070674_100757378 3300005356 Bacteria 835
15 Ga0070673_100250364 3300005364 Bacteria 1544
16 Ga0070673_100272123 3300005364 Unclassified 1483
17 Ga0070688_100024161 3300005365 Bacteria 3582
18 Ga0070701_10030240 3300005438 Bacteria 2678
19 Ga0070701_10043896 3300005438 Bacteria 2289
20 Ga0070705_100076754 3300005440 Bacteria 2038
21 Ga0070700_100006301 3300005441 Bacteria 6334
22 Ga0070700_100018458 3300005441 Archaea 4010
23 Ga0070694_100271194 3300005444 Bacteria 1291
24 Ga0070663_100222025 3300005455 Bacteria 1484
25 Ga0070678_100013698 3300005456 Bacteria 5096
26 Ga0070678_100545938 3300005456 Bacteria 1028
27 Ga0070662_100118350 3300005457 Bacteria 2028
28 Ga0070662_100901950 3300005457 Bacteria 754
29 Ga0068867_100028659 3300005459 Bacteria 4010
30 Ga0068867_100691853 3300005459 Bacteria 899
31 Ga0070698_100078309 3300005471 Bacteria 3304
32 Ga0070699_100003644 3300005518 Bacteria 13631
33 Ga0070684_100025855 3300005535 Bacteria 4939
34 Ga0070684_100037400 3300005535 Bacteria 4163
35 Ga0070684_100447551 3300005535 Unclassified 1194
36 Ga0070686_100008711 3300005544 Bacteria 5685
37 Ga0070686_100156419 3300005544 Bacteria 1601
38 Ga0070693_100008425 3300005547 Bacteria 5082
39 Ga0070665_100050450 3300005548 Bacteria 4175
40 Ga0070704_100235613 3300005549 Unclassified 1496
41 Ga0070664_100308833 3300005564 Bacteria 1431
42 Ga0068857_100007560 3300005577 Bacteria 9354
43 Ga0068857_100062463 3300005577 Bacteria 3311
44 Ga0068857_100399516 3300005577 Bacteria 1279
45 Ga0068854_100207269 3300005578 Bacteria 1544
46 Ga0068854_100383351 3300005578 Bacteria 1159
47 Ga0068856_100105182 3300005614 Bacteria 2816
48 Ga0070702_100020375 3300005615 Bacteria 3473
49 Ga0068859_100461004 3300005617 Bacteria 1367
50 Ga0068859_100527402 3300005617 Bacteria 1276
51 Ga0068864_100006769 3300005618 Bacteria 9382
52 Ga0068864_100078706 3300005618 Bacteria 2886
53 Ga0068866_10040796 3300005718 Bacteria 2300
54 Ga0068861_100200966 3300005719 Bacteria 1673
55 Ga0068861_100555836 3300005719 Bacteria 1047
56 Ga0068870_10068305 3300005840 Unclassified 1930
57 Ga0068858_100333183 3300005842 Bacteria 1452
58 Ga0081455_10009549 3300005937 Bacteria 9964
59 Ga0081455_10011181 3300005937 Bacteria 9032
60 Ga0081455_10046176 3300005937 Bacteria 3782
61 Ga0081455_10153330 3300005937 Bacteria 1774
62 Ga0081455_10173796 3300005937 Bacteria 1638
63 Ga0081455_10321822 3300005937 Bacteria 1101
64 Ga0081538_10000151 3300005981 Bacteria 72583
65 Ga0081538_10001655 3300005981 Bacteria 22763
66 Ga0081538_10001750 3300005981 Bacteria 22040
67 Ga0081538_10009203 3300005981 Bacteria 8276
68 Ga0081538_10010131 3300005981 Bacteria 7752
69 Ga0081538_10021847 3300005981 Bacteria 4656
70 Ga0081538_10041761 3300005981 Bacteria 2905
71 Ga0081538_10046083 3300005981 Bacteria 2694
72 Ga0081538_10048362 3300005981 Bacteria 2595
73 Ga0081538_10173845 3300005981 Unclassified 934
74 Ga0081539_10003259 3300005985 Bacteria 20371
75 Ga0075364_10013403 3300006051 Bacteria 5038
76 Ga0075362_10043970 3300006177 Bacteria 1979
77 Ga0075428_100032379 3300006844 Bacteria 5774
78 Ga0075428_100090080 3300006844 Bacteria 3346
79 Ga0075428_100392272 3300006844 Bacteria 1488
80 Ga0075428_100880102 3300006844 Bacteria 950
81 Ga0075430_100013815 3300006846 Bacteria 6880
82 Ga0075430_100065504 3300006846 Bacteria 3052
83 Ga0075430_100242086 3300006846 Bacteria 1495
84 Ga0075430_100292142 3300006846 Bacteria 1348
85 Ga0075431_100040277 3300006847 Bacteria 4815
86 Ga0075431_100085559 3300006847 Bacteria 3255
87 Ga0075431_100317572 3300006847 Bacteria 1571
88 Ga0075429_100010623 3300006880 Bacteria 7965
89 Ga0075429_100270344 3300006880 Unclassified 1489
90 Ga0075429_100518485 3300006880 Bacteria 1044
91 Ga0068865_100140739 3300006881 Unclassified 1819
92 Ga0068865_100605187 3300006881 Bacteria 927
93 Ga0097620_100461042 3300006931 Bacteria 1367
94 Ga0097620_100527386 3300006931 Bacteria 1276
95 Ga0111539_10011238 3300009094 Bacteria 11247
96 Ga0111539_10012396 3300009094 Bacteria 10688
97 Ga0111539_10028065 3300009094 Bacteria 6871
98 Ga0111539_10091594 3300009094 Bacteria 3572
99 Ga0111539_10292990 3300009094 Unclassified 1894
100 Ga0111539_10429916 3300009094 Bacteria 1537
101 Ga0111539_10559034 3300009094 Bacteria 1332
102 Ga0111539_11010399 3300009094 Bacteria 967
103 Ga0105245_10142163 3300009098 Unclassified 2261
104 Ga0105245_10544745 3300009098 Bacteria 1182
105 Ga0114129_10001817 3300009147 Bacteria 29087
106 Ga0114129_10011389 3300009147 Bacteria 12671
107 Ga0114129_10037721 3300009147 Bacteria 6822
108 Ga0114129_10070445 3300009147 Bacteria 4876
109 Ga0114129_10091596 3300009147 Bacteria 4212
110 Ga0114129_10340456 3300009147 Bacteria 1989
111 Ga0114129_10408515 3300009147 Bacteria 1788
112 Ga0114129_11203108 3300009147 Unclassified 944
113 Ga0114129_11227109 3300009147 Bacteria 933
114 Ga0105243_10052297 3300009148 Bacteria 3235
115 Ga0105243_10054333 3300009148 Bacteria 3180
116 Ga0105243_10741116 3300009148 Bacteria 962
117 Ga0105242_10068218 3300009176 Bacteria 2942
118 Ga0105248_10069365 3300009177 Bacteria 3958
119 Ga0105248_10227737 3300009177 Bacteria 2098
120 Ga0105248_10359520 3300009177 Bacteria 1639
121 Ga0105239_10047739 3300010375 Bacteria 4692
122 Ga0105246_10028345 3300011119 Bacteria 3678
123 Ga0105246_10476242 3300011119 Bacteria 1055
124 Ga0157374_10135238 3300013296 Bacteria 2389
125 Ga0157378_10103990 3300013297 Bacteria 2596
126 Ga0157375_10004686 3300013308 Bacteria 11898
127 Ga0157375_10007188 3300013308 Bacteria 9731
128 Ga0163163_10008112 3300014325 Bacteria 9306
129 Ga0163163_10409941 3300014325 Bacteria 1414
130 Ga0157380_10236707 3300014326 Bacteria 1643
131 Ga0157377_10014612 3300014745 Bacteria 3997
132 Ga0157377_10021149 3300014745 Bacteria 3418
133 Ga0157379_10086622 3300014968 Bacteria 2808
134 Ga0157379_10369215 3300014968 Bacteria 1316
135 Ga0157376_10161554 3300014969 Bacteria 2031
136 Ga0207642_10150885 3300025899 Bacteria 1237
137 Ga0207688_10001622 3300025901 Bacteria 11875
138 Ga0207688_10042211 3300025901 Bacteria 2539
139 Ga0207643_10039091 3300025908 Bacteria 2669
140 Ga0207643_10053295 3300025908 Bacteria 2298
141 Ga0207649_10164953 3300025920 Bacteria 1538
142 Ga0207650_10004264 3300025925 Bacteria 9758
143 Ga0207687_10023992 3300025927 Bacteria 4069
144 Ga0207687_10091100 3300025927 Bacteria 2223
145 Ga0207706_10026028 3300025933 Bacteria 5238
146 Ga0207706_10376453 3300025933 Unclassified 1232
147 Ga0207706_10838665 3300025933 Bacteria 779
148 Ga0207686_10021938 3300025934 Bacteria 3672
149 Ga0207709_10195115 3300025935 Bacteria 1442
150 Ga0207669_10107915 3300025937 Unclassified 1858
151 Ga0207669_10442828 3300025937 Bacteria 1028
152 Ga0207704_10398223 3300025938 Bacteria 1086
153 Ga0207691_10045994 3300025940 Bacteria 4012
154 Ga0207691_10177841 3300025940 Bacteria 1860
155 Ga0207711_10114033 3300025941 Bacteria 2407
156 Ga0207711_10153427 3300025941 Bacteria 2080
157 Ga0207689_10005953 3300025942 Bacteria 10792
158 Ga0207661_10221837 3300025944 Bacteria 1671
159 Ga0207661_10424089 3300025944 Bacteria 1208
160 Ga0207661_10730375 3300025944 Unclassified 911
161 Ga0207651_10041886 3300025960 Bacteria 3044
162 Ga0207640_10121150 3300025981 Bacteria 1874
163 Ga0207677_10096175 3300026023 Bacteria 2166
164 Ga0207678_10100489 3300026067 Bacteria 2471
165 Ga0207708_10013066 3300026075 Bacteria 6195
166 Ga0207708_10014123 3300026075 Bacteria 5970
167 Ga0207648_10049213 3300026089 Bacteria 3689
168 Ga0207648_10247562 3300026089 Bacteria 1588
169 Ga0207676_10026915 3300026095 Bacteria 4278
170 Ga0207674_10002691 3300026116 Bacteria 22179
171 Ga0207674_10024380 3300026116 Bacteria 6467
172 Ga0207675_100033434 3300026118 Bacteria 4792
173 Ga0207675_100172385 3300026118 Bacteria 2068
174 Ga0207683_10029459 3300026121 Bacteria 4753
175 Ga0207683_10087407 3300026121 Bacteria 2772
176 Ga0207683_10336303 3300026121 Bacteria 1384
177 Ga0207683_10818170 3300026121 Bacteria 865
178 Ga0207428_10010029 3300027907 Bacteria 8477
179 Ga0207428_10029608 3300027907 Bacteria 4535
180 Ga0207428_10120490 3300027907 Bacteria 2012
181 Ga0207428_10203327 3300027907 Bacteria 1490
182 Ga0268265_10064844 3300028380 Bacteria 2816
183 Ga0268265_10154899 3300028380 Bacteria 1938
184 Ga0307408_100021096 3300031548 Bacteria 4404
185 Ga0307408_100261587 3300031548 Bacteria 1432
186 Ga0307408_100290213 3300031548 Bacteria 1366
187 Ga0307405_10007142 3300031731 Bacteria 5554
188 Ga0307413_10004871 3300031824 Bacteria 5901
189 Ga0307413_10798669 3300031824 Bacteria 793
190 Ga0307410_10474344 3300031852 Bacteria 1025
191 Ga0307407_10001483 3300031903 Bacteria 8547
192 Ga0307407_10811694 3300031903 Bacteria 712
193 Ga0307412_10240468 3300031911 Bacteria 1400
194 Ga0307409_100023296 3300031995 Bacteria 4287
195 Ga0307409_100030583 3300031995 Bacteria 3871
196 Ga0307409_100129539 3300031995 Unclassified 2153
197 Ga0307409_100708098 3300031995 Unclassified 1007
198 Ga0307416_100000964 3300032002 Bacteria 15201
199 Ga0307416_100004943 3300032002 Bacteria 8121
200 Ga0307416_100130910 3300032002 Bacteria 2258
201 Ga0307416_100341041 3300032002 Bacteria 1511
202 Ga0307411_10040646 3300032005 Bacteria 2952
203 Ga0307411_10045320 3300032005 Bacteria 2828
204 Ga0307415_100000242 3300032126 Bacteria 23821
205 Ga0307415_100001841 3300032126 Bacteria 10402
206 Ga0373931_0166770 3300035691 Bacteria 1295
207 Ga0395899_0002470 3300037312 Bacteria 15010
208 Ga0395899_0003140 3300037312 Bacteria 13143
209 Ga0395899_0017473 3300037312 Bacteria 5465
210 Ga0395899_0033863 3300037312 Bacteria 3836
211 Ga0395899_0076240 3300037312 Bacteria 2448
212 Ga0395900_0001311 3300037418 Bacteria 30204
213 Ga0395900_0006969 3300037418 Bacteria 11714
214 Ga0395900_0008091 3300037418 Bacteria 10824
215 Ga0395900_0009949 3300037418 Bacteria 9736
216 Ga0395900_0025643 3300037418 Bacteria 6034
217 Ga0395900_0045602 3300037418 Bacteria 4515
218 Ga0395900_0061838 3300037418 Bacteria 3849
219 Ga0395900_0255991 3300037418 Unclassified 1750
220 Ga0395898_0000635 3300037466 Bacteria 64060
221 Ga0395898_0005072 3300037466 Bacteria 14278
222 Ga0395898_0007417 3300037466 Bacteria 11643
223 Ga0395898_0009163 3300037466 Bacteria 10426
224 Ga0395898_0041553 3300037466 Bacteria 4541
225 Ga0395898_0212640 3300037466 Bacteria 1844
226 Ga0395898_0221808 3300037466 Bacteria 1803
227 Ga0395898_0367760 3300037466 Bacteria 1371
228 Ga0395905_0001334 3300037471 Bacteria 30049
229 Ga0395905_0021379 3300037471 Bacteria 6119
230 Ga0395905_0026092 3300037471 Bacteria 5510
231 Ga0395905_0201010 3300037471 Bacteria 1868
232 Ga0395905_0471101 3300037471 Bacteria 1155
233 Ga0395905_0531763 3300037471 Bacteria 1076
234 Ga0395905_0593364 3300037471 Bacteria 1009
235 Ga0395905_0772804 3300037471 Bacteria 863
236 Ga0395901_0001474 3300038443 Bacteria 24475
237 Ga0395901_0005717 3300038443 Bacteria 12591
238 Ga0395901_0032217 3300038443 Bacteria 5408
239 Ga0395901_0033960 3300038443 Bacteria 5266
240 Ga0395901_0039988 3300038443 Bacteria 4854
241 Ga0395901_0056458 3300038443 Bacteria 4084
242 Ga0395901_0069898 3300038443 Bacteria 3657
243 Ga0395901_0147930 3300038443 Bacteria 2468
244 Ga0395901_0222588 3300038443 Bacteria 1972
245 Ga0395901_0331638 3300038443 Unclassified 1573
246 Ga0395901_0391431 3300038443 Bacteria 1429
247 Ga0395901_0417562 3300038443 Unclassified 1376
248 Ga0395901_0435678 3300038443 Bacteria 1342
249 Ga0395901_0503559 3300038443 Unclassified 1233
250 Ga0395901_0626203 3300038443 Unclassified 1082
251 Ga0395901_0990134 3300038443 Bacteria 817
252 Ga0439448_0059144 3300042005 Bacteria 1265
253 Ga0450918_050143 3300042531 Bacteria 759
254 Ga0451576_0078805 3300045051 Bacteria 3428
255 Ga0451576_0082100 3300045051 Bacteria 3352
256 Ga0495605_0033583 3300046474 Bacteria 2603
257 Ga0495585_0107567 3300046492 Bacteria 1486
258 Ga0495596_0067540 3300046500 Bacteria 1389
259 Ga0495663_0011749 3300046525 Bacteria 2439
260 Ga0495642_0102018 3300046528 Bacteria 1222
261 Ga0495609_0130334 3300046538 Bacteria 1077
262 Ga0495656_0189595 3300046615 Bacteria 1015
263 Ga0495656_0378608 3300046615 Bacteria 737
264 Ga0495668_0147109 3300046616 Bacteria 1290
265 Ga0495625_0331365 3300046660 Bacteria 967
266 Ga0495671_0085094 3300046692 Bacteria 1549
267 Ga0495589_0074360 3300046794 Bacteria 1658
268 Ga0495589_0135638 3300046794 Bacteria 1180
269 Ga0495636_0055442 3300047318 Bacteria 1667
270 Ga0496106_0369719 3300048909 Bacteria 1152
271 Ga0496107_0082155 3300048910 Bacteria 2350
272 Ga0496107_0507896 3300048910 Bacteria 894
273 Ga0496108_0023196 3300048911 Bacteria 5104
274 Ga0496108_0322408 3300048911 Bacteria 1347
275 Ga0496109_0005568 3300048912 Bacteria 10546
276 Ga0496109_0014745 3300048912 Bacteria 6799
277 Ga0496110_0000565 3300048913 Bacteria 25344
278 Ga0496110_0007567 3300048913 Bacteria 8678
279 Ga0496111_0000075 3300048914 Bacteria 41061
280 Ga0496111_0000684 3300048914 Bacteria 17856
281 Ga0496113_0259135 3300048916 Bacteria 1389
282 Ga0496114_0311147 3300048917 Bacteria 1391
283 Ga0496114_0312938 3300048917 Bacteria 1387
284 Ga0501031_0021179 3300049568 Bacteria 4240
285 Ga0501031_0023298 3300049568 Archaea 4037
286 Ga0501031_0325916 3300049568 Bacteria 995
287 Ga0501032_0001265 3300049569 Bacteria 20279
288 Ga0501032_0014508 3300049569 Bacteria 5578
289 Ga0501032_0050945 3300049569 Bacteria 2791
290 Ga0501033_0000196 3300049570 Bacteria 57814
291 Ga0501033_0011965 3300049570 Bacteria 6629
292 Ga0501033_0148675 3300049570 Bacteria 1691
293 Ga0501033_0286344 3300049570 Bacteria 1162
294 Ga0501034_0009816 3300049571 Bacteria 10008
295 Ga0501034_0011961 3300049571 Bacteria 8969
296 Ga0501034_0062243 3300049571 Bacteria 3747
297 Ga0501036_0000532 3300049572 Bacteria 27334
298 Ga0501036_0031098 3300049572 Bacteria 4511
299 Ga0501036_0031364 3300049572 Bacteria 4491
300 Ga0501036_0034881 3300049572 Bacteria 4256
301 Ga0501036_0045432 3300049572 Bacteria 3720
302 Ga0501037_0000254 3300049573 Bacteria 45796
303 Ga0501037_0049585 3300049573 Bacteria 3074
304 Ga0501037_0066365 3300049573 Bacteria 2629
305 Ga0501038_0000266 3300049574 Bacteria 44169
306 Ga0501038_0013652 3300049574 Bacteria 7404
307 Ga0501038_0016302 3300049574 Bacteria 6737
308 Ga0501038_0150555 3300049574 Bacteria 1897
309 Ga0501039_0000178 3300049575 Bacteria 45220
310 Ga0501039_0007541 3300049575 Bacteria 8311
311 Ga0501039_0015355 3300049575 Bacteria 5862
312 Ga0501039_0018781 3300049575 Bacteria 5306
313 Ga0501039_0033682 3300049575 Bacteria 3951
314 Ga0501040_0004280 3300049576 Bacteria 9284
315 Ga0501040_0006601 3300049576 Bacteria 7531
316 Ga0501040_0021008 3300049576 Bacteria 4354
317 Ga0501040_0021880 3300049576 Bacteria 4275
318 Ga0501040_0040807 3300049576 Bacteria 3159
319 Ga0501040_0079530 3300049576 Bacteria 2269
320 Ga0501040_0407891 3300049576 Bacteria 976
321 Ga0501040_0560224 3300049576 Bacteria 825
322 Ga0501041_0002309 3300049577 Bacteria 10785
323 Ga0501041_0006544 3300049577 Bacteria 6823
324 Ga0501041_0023069 3300049577 Bacteria 3730
325 Ga0501041_0051132 3300049577 Bacteria 2518
326 Ga0501041_0413959 3300049577 Unclassified 854
327 Ga0501042_0001946 3300049578 Bacteria 12432
328 Ga0501042_0019392 3300049578 Bacteria 4721
329 Ga0501042_0026664 3300049578 Bacteria 4059
330 Ga0501042_0027309 3300049578 Bacteria 4013
331 Ga0501042_0062347 3300049578 Bacteria 2664
332 Ga0501042_0064852 3300049578 Bacteria 2610
333 Ga0501042_0103391 3300049578 Bacteria 2049
334 Ga0501043_0002582 3300049579 Bacteria 15303
335 Ga0501043_0060328 3300049579 Bacteria 2977
336 Ga0501043_0089588 3300049579 Bacteria 2418
337 Ga0501046_0000640 3300049580 Bacteria 34263
338 Ga0501046_0002548 3300049580 Bacteria 17045
339 Ga0501046_0018832 3300049580 Bacteria 5734
340 Ga0501046_0020085 3300049580 Bacteria 5531
341 Ga0501046_0090529 3300049580 Bacteria 2354
342 Ga0501046_0111754 3300049580 Bacteria 2086
343 Ga0501047_0000991 3300049581 Bacteria 28652
344 Ga0501047_0118298 3300049581 Archaea 2531
345 Ga0501048_0000164 3300049582 Bacteria 41709
346 Ga0501048_0001886 3300049582 Bacteria 15915
347 Ga0501048_0016627 3300049582 Bacteria 5424
348 Ga0501048_0048784 3300049582 Bacteria 3019
349 Ga0501048_0051081 3300049582 Bacteria 2943
350 Ga0501048_0353585 3300049582 Bacteria 1048
351 Ga0501048_0512810 3300049582 Bacteria 860
352 Ga0501067_0032776 3300049583 Bacteria 2883
353 Ga0501067_0078609 3300049583 Bacteria 1828
354 Ga0501068_0000009 3300049584 Bacteria 67122
355 Ga0501068_0013881 3300049584 Bacteria 4592
356 Ga0501068_0059694 3300049584 Bacteria 2315
357 Ga0501069_0000627 3300049585 Bacteria 16319
358 Ga0501069_0003149 3300049585 Bacteria 8459
359 Ga0501069_0103363 3300049585 Bacteria 1618
360 Ga0501070_0000808 3300049586 Bacteria 28444
361 Ga0501070_0084050 3300049586 Bacteria 2635
362 Ga0501070_0131429 3300049586 Bacteria 2067
363 Ga0501070_0226890 3300049586 Bacteria 1531
364 Ga0501071_0000195 3300049587 Bacteria 27326
365 Ga0501071_0009124 3300049587 Bacteria 6588
366 Ga0501071_0012202 3300049587 Bacteria 5817
367 Ga0501071_0048064 3300049587 Bacteria 3067
368 Ga0501071_0050887 3300049587 Bacteria 2984
369 Ga0501071_0149969 3300049587 Bacteria 1739
370 Ga0501072_0001747 3300049588 Bacteria 16152
371 Ga0501072_0005418 3300049588 Bacteria 9712
372 Ga0501072_0006292 3300049588 Bacteria 9037
373 Ga0501072_0008836 3300049588 Bacteria 7654
374 Ga0501072_0023484 3300049588 Bacteria 4790
375 Ga0501072_0059745 3300049588 Bacteria 3006
376 Ga0501072_0127975 3300049588 Bacteria 2023
377 Ga0501072_0160646 3300049588 Bacteria 1792
378 Ga0501072_0221253 3300049588 Bacteria 1509
379 Ga0501072_0244006 3300049588 Bacteria 1431
380 Ga0501073_0000932 3300049589 Bacteria 20979
381 Ga0501073_0006171 3300049589 Bacteria 8946
382 Ga0501073_0095246 3300049589 Bacteria 2067
383 Ga0501073_0163604 3300049589 Bacteria 1541
384 Ga0501074_0000249 3300049590 Bacteria 30332
385 Ga0501074_0024945 3300049590 Bacteria 4344
386 Ga0501074_0091963 3300049590 Bacteria 2172
387 Ga0501074_0183870 3300049590 Bacteria 1491
388 Ga0501074_0198903 3300049590 Bacteria 1428
389 Ga0501074_0382253 3300049590 Bacteria 999
390 Ga0501075_0000310 3300049591 Bacteria 27255
391 Ga0501075_0010560 3300049591 Bacteria 6492
392 Ga0501075_0031150 3300049591 Bacteria 3957
393 Ga0501075_0045539 3300049591 Bacteria 3292
394 Ga0501075_0051538 3300049591 Bacteria 3094
395 Ga0501075_0056092 3300049591 Bacteria 2966
396 Ga0501075_0079053 3300049591 Archaea 2489
397 Ga0501075_0113154 3300049591 Bacteria 2063
398 Ga0501076_0000083 3300049592 Bacteria 49438
399 Ga0501076_0008803 3300049592 Bacteria 7417
400 Ga0501076_0009067 3300049592 Bacteria 7325
401 Ga0501076_0012446 3300049592 Bacteria 6360
402 Ga0501076_0022485 3300049592 Bacteria 4845
403 Ga0501076_0040116 3300049592 Bacteria 3678
404 Ga0501076_0209396 3300049592 Bacteria 1593
405 Ga0501076_0295634 3300049592 Bacteria 1327
406 Ga0501076_0469442 3300049592 Bacteria 1036
407 Ga0501077_0000048 3300049593 Bacteria 61935
408 Ga0501077_0013036 3300049593 Bacteria 5208
409 Ga0501077_0046379 3300049593 Bacteria 2761
410 Ga0501077_0080219 3300049593 Bacteria 2067
411 Ga0501077_0122296 3300049593 Bacteria 1650
412 Ga0501077_0155627 3300049593 Bacteria 1451
413 Ga0501077_0161085 3300049593 Bacteria 1424
414 Ga0501227_106391 3300049665 Bacteria 749
415 Ga0501079_0000430 3300049741 Bacteria 27322
416 Ga0501079_0006983 3300049741 Bacteria 8510
417 Ga0501079_0008833 3300049741 Bacteria 7630
418 Ga0501079_0034950 3300049741 Bacteria 3867
419 Ga0501079_0056229 3300049741 Bacteria 3036
420 Ga0501079_0064379 3300049741 Bacteria 2828
421 Ga0501079_0333350 3300049741 Bacteria 1188
422 Ga0501080_0000026 3300049742 Bacteria 89548
423 Ga0501080_0155431 3300049742 Bacteria 2113
424 Ga0501080_0224389 3300049742 Bacteria 1718
425 Ga0501080_0275202 3300049742 Bacteria 1531
426 Ga0501080_0293328 3300049742 Bacteria 1476
427 Ga0501080_0294889 3300049742 Bacteria 1472
428 Ga0501081_0000117 3300049743 Bacteria 34303
429 Ga0501081_0001373 3300049743 Bacteria 14891
430 Ga0501081_0017961 3300049743 Bacteria 4691
431 Ga0501081_0021021 3300049743 Bacteria 4356
432 Ga0501081_0088325 3300049743 Bacteria 2177
433 Ga0501081_0134485 3300049743 Bacteria 1769
434 Ga0501081_0285067 3300049743 Bacteria 1210
435 Ga0501083_0000136 3300049744 Bacteria 49859
436 Ga0501083_0005576 3300049744 Bacteria 8911
437 Ga0501083_0071664 3300049744 Bacteria 2303
438 Ga0501035_0001888 3300049822 Bacteria 21086
439 Ga0501035_0018401 3300049822 Bacteria 6437
440 Ga0501035_0294835 3300049822 Bacteria 1368
441 Ga0501035_0364555 3300049822 Bacteria 1207
442 Ga0501044_0016704 3300049823 Bacteria 7879
443 Ga0501044_0018076 3300049823 Bacteria 7561
444 Ga0501044_0143903 3300049823 Bacteria 2371
445 Ga0501044_0556477 3300049823 Bacteria 1044
446 Ga0501045_0000199 3300049824 Bacteria 34181
447 Ga0501045_0000708 3300049824 Bacteria 21218
448 Ga0501045_0026784 3300049824 Bacteria 4149
449 Ga0501045_0045229 3300049824 Bacteria 3205
450 Ga0501045_0083668 3300049824 Bacteria 2354
451 Ga0501045_0089064 3300049824 Bacteria 2279
452 Ga0501045_0521548 3300049824 Bacteria 882
453 nmdc:mga00v17_8828_c1 3300050491 Bacteria 5433
454 nmdc:mga05p37_238569_c1 3300050507 Bacteria 2187
455 nmdc:mga05p37_2481_c1 3300050507 Bacteria 21472
456 nmdc:mga05p37_287234_c1 3300050507 Bacteria 1959
457 nmdc:mga05p37_34092_c1 3300050507 Bacteria 6235
458 nmdc:mga05p37_5738_c1 3300050507 Bacteria 14599
459 nmdc:mga05p37_59144_c1 3300050507 Bacteria 4721
460 nmdc:mga05p37_59630_c1 3300050507 Bacteria 4699
461 nmdc:mga05p37_72608_c1 3300050507 Bacteria 2629
462 nmdc:mga09592_280735_c1 3300050508 Bacteria 1445
463 nmdc:mga09592_29066_c1 3300050508 Bacteria 4597
464 nmdc:mga0qj67_112428_c1 3300050509 Bacteria 2199
465 nmdc:mga0qj67_15378_c1 3300050509 Bacteria 5794
466 nmdc:mga0qj67_42967_c1 3300050509 Bacteria 3559
467 nmdc:mga0qj67_6566_c1 3300050509 Bacteria 8544
468 nmdc:mga06r32_20515_c1 3300050510 Bacteria 6086
469 nmdc:mga06r32_88075_c1 3300050510 Bacteria 3030
470 nmdc:mga06r32_96611_c1 3300050510 Bacteria 2894
471 nmdc:mga08y16_178453_c1 3300050511 Bacteria 2206
472 nmdc:mga08y16_262901_c1 3300050511 Bacteria 1782
473 nmdc:mga08y16_366215_c1 3300050511 Unclassified 1479
474 nmdc:mga08y16_45720_c1 3300050511 Bacteria 4586
475 nmdc:mga08y16_54955_c1 3300050511 Bacteria 4162
476 nmdc:mga08y16_96165_c1 3300050511 Bacteria 3084
477 nmdc:mga0n895_303665_c1 3300050512 Bacteria 1618
478 Ga0495655_0021030 3300053083 Bacteria 1471
479 Ga0501084_0002961 3300054114 Bacteria 13753
480 Ga0501084_0005971 3300054114 Bacteria 10024
481 Ga0501084_0010788 3300054114 Bacteria 7563
482 Ga0501084_0030799 3300054114 Bacteria 4486
483 Ga0501084_0095060 3300054114 Bacteria 2502
484 Ga0501084_0127571 3300054114 Bacteria 2141
485 Ga0501084_0168317 3300054114 Bacteria 1850
486 Ga0501084_0173693 3300054114 Bacteria 1819
487 Ga0501084_0280630 3300054114 Bacteria 1407
488 Ga0590075_019746 3300059424 Bacteria 1675
489 Ga0501082_0000897 3300060353 Bacteria 26250
490 Ga0501082_0001243 3300060353 Bacteria 22391
491 Ga0501082_0002401 3300060353 Bacteria 16423
492 Ga0501082_0054519 3300060353 Bacteria 3446
493 Ga0501082_0090049 3300060353 Bacteria 2649
494 Ga0501082_0352091 3300060353 Bacteria 1284
495 Ga0530510_0000434 3300061734 Bacteria 26970
496 Ga0530510_0003186 3300061734 Bacteria 11282
497 Ga0530510_0005271 3300061734 Bacteria 8927
498 Ga0530510_0012443 3300061734 Bacteria 5977
499 Ga0530510_0308802 3300061734 Bacteria 1184
500 Ga0081455_10025465
501 Ga0070683_100289251
502 Ga0070690_100080154
503 Ga0068869_100192848
504 Ga0068869_100260280
505 Ga0070680_100138918
506 Ga0070680_100816657
507 Ga0070682_100677316
508 Ga0070689_100021672
509 Ga0070661_100634591
510 Ga0070668_100204062
511 Ga0070668_100451531
512 Ga0070675_100110659
513 Ga0070674_100757378
514 Ga0070673_100250364
515 Ga0070673_100272123
516 Ga0070688_100024161
517 Ga0070701_10030240
518 Ga0070701_10043896
519 Ga0070705_100076754
520 Ga0070700_100006301
521 Ga0070700_100018458
522 Ga0070694_100271194
523 Ga0070663_100222025
524 Ga0070678_100013698
525 Ga0070678_100545938
526 Ga0070662_100118350
527 Ga0070662_100901950
528 Ga0068867_100028659
529 Ga0068867_100691853
530 Ga0070698_100078309
531 Ga0070699_100003644
532 Ga0070684_100025855
533 Ga0070684_100037400
534 Ga0070684_100447551
535 Ga0070686_100008711
536 Ga0070686_100156419
537 Ga0070693_100008425
538 Ga0070665_100050450
539 Ga0070704_100235613
540 Ga0070664_100308833
541 Ga0068857_100007560
542 Ga0068857_100062463
543 Ga0068857_100399516
544 Ga0068854_100207269
545 Ga0068854_100383351
546 Ga0068856_100105182
547 Ga0070702_100020375
548 Ga0068859_100461004
549 Ga0068859_100527402
550 Ga0068864_100006769
551 Ga0068864_100078706
552 Ga0068866_10040796
553 Ga0068861_100200966
554 Ga0068861_100555836
555 Ga0068870_10068305
556 Ga0068858_100333183
557 Ga0081455_10009549
558 Ga0081455_10011181
559 Ga0081455_10046176
560 Ga0081455_10153330
561 Ga0081455_10173796
562 Ga0081455_10321822
563 Ga0081538_10000151
564 Ga0081538_10001655
565 Ga0081538_10001750
566 Ga0081538_10009203
567 Ga0081538_10010131
568 Ga0081538_10021847
569 Ga0081538_10041761
570 Ga0081538_10046083
571 Ga0081538_10048362
572 Ga0081538_10173845
573 Ga0081539_10003259
574 Ga0075364_10013403
575 Ga0075362_10043970
576 Ga0075428_100032379
577 Ga0075428_100090080
578 Ga0075428_100392272
579 Ga0075428_100880102
580 Ga0075430_100013815
581 Ga0075430_100065504
582 Ga0075430_100242086
583 Ga0075430_100292142
584 Ga0075431_100040277
585 Ga0075431_100085559
586 Ga0075431_100317572
587 Ga0075429_100010623
588 Ga0075429_100270344
589 Ga0075429_100518485
590 Ga0068865_100140739
591 Ga0068865_100605187
592 Ga0097620_100461042
593 Ga0097620_100527386
594 Ga0111539_10011238
595 Ga0111539_10012396
596 Ga0111539_10028065
597 Ga0111539_10091594
598 Ga0111539_10292990
599 Ga0111539_10429916
600 Ga0111539_10559034
601 Ga0111539_11010399
602 Ga0105245_10142163
603 Ga0105245_10544745
604 Ga0114129_10001817
605 Ga0114129_10011389
606 Ga0114129_10037721
607 Ga0114129_10070445
608 Ga0114129_10091596
609 Ga0114129_10340456
610 Ga0114129_10408515
611 Ga0114129_11203108
612 Ga0114129_11227109
613 Ga0105243_10052297
614 Ga0105243_10054333
615 Ga0105243_10741116
616 Ga0105242_10068218
617 Ga0105248_10069365
618 Ga0105248_10227737
619 Ga0105248_10359520
620 Ga0105239_10047739
621 Ga0105246_10028345
622 Ga0105246_10476242
623 Ga0157374_10135238
624 Ga0157378_10103990
625 Ga0157375_10004686
626 Ga0157375_10007188
627 Ga0163163_10008112
628 Ga0163163_10409941
629 Ga0157380_10236707
630 Ga0157377_10014612
631 Ga0157377_10021149
632 Ga0157379_10086622
633 Ga0157379_10369215
634 Ga0157376_10161554
635 Ga0207642_10150885
636 Ga0207688_10001622
637 Ga0207688_10042211
638 Ga0207643_10039091
639 Ga0207643_10053295
640 Ga0207649_10164953
641 Ga0207650_10004264
642 Ga0207687_10023992
643 Ga0207687_10091100
644 Ga0207706_10026028
645 Ga0207706_10376453
646 Ga0207706_10838665
647 Ga0207686_10021938
648 Ga0207709_10195115
649 Ga0207669_10107915
650 Ga0207669_10442828
651 Ga0207704_10398223
652 Ga0207691_10045994
653 Ga0207691_10177841
654 Ga0207711_10114033
655 Ga0207711_10153427
656 Ga0207689_10005953
657 Ga0207661_10221837
658 Ga0207661_10424089
659 Ga0207661_10730375
660 Ga0207651_10041886
661 Ga0207640_10121150
662 Ga0207677_10096175
663 Ga0207678_10100489
664 Ga0207708_10013066
665 Ga0207708_10014123
666 Ga0207648_10049213
667 Ga0207648_10247562
668 Ga0207676_10026915
669 Ga0207674_10002691
670 Ga0207674_10024380
671 Ga0207675_100033434
672 Ga0207675_100172385
673 Ga0207683_10029459
674 Ga0207683_10087407
675 Ga0207683_10336303
676 Ga0207683_10818170
677 Ga0207428_10010029
678 Ga0207428_10029608
679 Ga0207428_10120490
680 Ga0207428_10203327
681 Ga0268265_10064844
682 Ga0268265_10154899
683 Ga0307408_100021096
684 Ga0307408_100261587
685 Ga0307408_100290213
686 Ga0307405_10007142
687 Ga0307413_10004871
688 Ga0307413_10798669
689 Ga0307410_10474344
690 Ga0307407_10001483
691 Ga0307407_10811694
692 Ga0307412_10240468
693 Ga0307409_100023296
694 Ga0307409_100030583
695 Ga0307409_100129539
696 Ga0307409_100708098
697 Ga0307416_100000964
698 Ga0307416_100004943
699 Ga0307416_100130910
700 Ga0307416_100341041
701 Ga0307411_10040646
702 Ga0307411_10045320
703 Ga0307415_100000242
704 Ga0307415_100001841
705 Ga0373931_0166770
706 Ga0395899_0002470
707 Ga0395899_0003140
708 Ga0395899_0017473
709 Ga0395899_0033863
710 Ga0395899_0076240
711 Ga0395900_0001311
712 Ga0395900_0006969
713 Ga0395900_0008091
714 Ga0395900_0009949
715 Ga0395900_0025643
716 Ga0395900_0045602
717 Ga0395900_0061838
718 Ga0395900_0255991
719 Ga0395898_0000635
720 Ga0395898_0005072
721 Ga0395898_0007417
722 Ga0395898_0009163
723 Ga0395898_0041553
724 Ga0395898_0212640
725 Ga0395898_0221808
726 Ga0395898_0367760
727 Ga0395905_0001334
728 Ga0395905_0021379
729 Ga0395905_0026092
730 Ga0395905_0201010
731 Ga0395905_0471101
732 Ga0395905_0531763
733 Ga0395905_0593364
734 Ga0395905_0772804
735 Ga0395901_0001474
736 Ga0395901_0005717
737 Ga0395901_0032217
738 Ga0395901_0033960
739 Ga0395901_0039988
740 Ga0395901_0056458
741 Ga0395901_0069898
742 Ga0395901_0147930
743 Ga0395901_0222588
744 Ga0395901_0331638
745 Ga0395901_0391431
746 Ga0395901_0417562
747 Ga0395901_0435678
748 Ga0395901_0503559
749 Ga0395901_0626203
750 Ga0395901_0990134
751 Ga0439448_0059144
752 Ga0450918_050143
753 Ga0451576_0078805
754 Ga0451576_0082100
755 Ga0495605_0033583
756 Ga0495585_0107567
757 Ga0495596_0067540
758 Ga0495663_0011749
759 Ga0495642_0102018
760 Ga0495609_0130334
761 Ga0495656_0189595
762 Ga0495656_0378608
763 Ga0495668_0147109
764 Ga0495625_0331365
765 Ga0495671_0085094
766 Ga0495589_0074360
767 Ga0495589_0135638
768 Ga0495636_0055442
769 Ga0496106_0369719
770 Ga0496107_0082155
771 Ga0496107_0507896
772 Ga0496108_0023196
773 Ga0496108_0322408
774 Ga0496109_0005568
775 Ga0496109_0014745
776 Ga0496110_0000565
777 Ga0496110_0007567
778 Ga0496111_0000075
779 Ga0496111_0000684
780 Ga0496113_0259135
781 Ga0496114_0311147
782 Ga0496114_0312938
783 Ga0501031_0021179
784 Ga0501031_0023298
785 Ga0501031_0325916
786 Ga0501032_0001265
787 Ga0501032_0014508
788 Ga0501032_0050945
789 Ga0501033_0000196
790 Ga0501033_0011965
791 Ga0501033_0148675
792 Ga0501033_0286344
793 Ga0501034_0009816
794 Ga0501034_0011961
795 Ga0501034_0062243
796 Ga0501036_0000532
797 Ga0501036_0031098
798 Ga0501036_0031364
799 Ga0501036_0034881
800 Ga0501036_0045432
801 Ga0501037_0000254
802 Ga0501037_0049585
803 Ga0501037_0066365
804 Ga0501038_0000266
805 Ga0501038_0013652
806 Ga0501038_0016302
807 Ga0501038_0150555
808 Ga0501039_0000178
809 Ga0501039_0007541
810 Ga0501039_0015355
811 Ga0501039_0018781
812 Ga0501039_0033682
813 Ga0501040_0004280
814 Ga0501040_0006601
815 Ga0501040_0021008
816 Ga0501040_0021880
817 Ga0501040_0040807
818 Ga0501040_0079530
819 Ga0501040_0407891
820 Ga0501040_0560224
821 Ga0501041_0002309
822 Ga0501041_0006544
823 Ga0501041_0023069
824 Ga0501041_0051132
825 Ga0501041_0413959
826 Ga0501042_0001946
827 Ga0501042_0019392
828 Ga0501042_0026664
829 Ga0501042_0027309
830 Ga0501042_0062347
831 Ga0501042_0064852
832 Ga0501042_0103391
833 Ga0501043_0002582
834 Ga0501043_0060328
835 Ga0501043_0089588
836 Ga0501046_0000640
837 Ga0501046_0002548
838 Ga0501046_0018832
839 Ga0501046_0020085
840 Ga0501046_0090529
841 Ga0501046_0111754
842 Ga0501047_0000991
843 Ga0501047_0118298
844 Ga0501048_0000164
845 Ga0501048_0001886
846 Ga0501048_0016627
847 Ga0501048_0048784
848 Ga0501048_0051081
849 Ga0501048_0353585
850 Ga0501048_0512810
851 Ga0501067_0032776
852 Ga0501067_0078609
853 Ga0501068_0000009
854 Ga0501068_0013881
855 Ga0501068_0059694
856 Ga0501069_0000627
857 Ga0501069_0003149
858 Ga0501069_0103363
859 Ga0501070_0000808
860 Ga0501070_0084050
861 Ga0501070_0131429
862 Ga0501070_0226890
863 Ga0501071_0000195
864 Ga0501071_0009124
865 Ga0501071_0012202
866 Ga0501071_0048064
867 Ga0501071_0050887
868 Ga0501071_0149969
869 Ga0501072_0001747
870 Ga0501072_0005418
871 Ga0501072_0006292
872 Ga0501072_0008836
873 Ga0501072_0023484
874 Ga0501072_0059745
875 Ga0501072_0127975
876 Ga0501072_0160646
877 Ga0501072_0221253
878 Ga0501072_0244006
879 Ga0501073_0000932
880 Ga0501073_0006171
881 Ga0501073_0095246
882 Ga0501073_0163604
883 Ga0501074_0000249
884 Ga0501074_0024945
885 Ga0501074_0091963
886 Ga0501074_0183870
887 Ga0501074_0198903
888 Ga0501074_0382253
889 Ga0501075_0000310
890 Ga0501075_0010560
891 Ga0501075_0031150
892 Ga0501075_0045539
893 Ga0501075_0051538
894 Ga0501075_0056092
895 Ga0501075_0079053
896 Ga0501075_0113154
897 Ga0501076_0000083
898 Ga0501076_0008803
899 Ga0501076_0009067
900 Ga0501076_0012446
901 Ga0501076_0022485
902 Ga0501076_0040116
903 Ga0501076_0209396
904 Ga0501076_0295634
905 Ga0501076_0469442
906 Ga0501077_0000048
907 Ga0501077_0013036
908 Ga0501077_0046379
909 Ga0501077_0080219
910 Ga0501077_0122296
911 Ga0501077_0155627
912 Ga0501077_0161085
913 Ga0501227_106391
914 Ga0501079_0000430
915 Ga0501079_0006983
916 Ga0501079_0008833
917 Ga0501079_0034950
918 Ga0501079_0056229
919 Ga0501079_0064379
920 Ga0501079_0333350
921 Ga0501080_0000026
922 Ga0501080_0155431
923 Ga0501080_0224389
924 Ga0501080_0275202
925 Ga0501080_0293328
926 Ga0501080_0294889
927 Ga0501081_0000117
928 Ga0501081_0001373
929 Ga0501081_0017961
930 Ga0501081_0021021
931 Ga0501081_0088325
932 Ga0501081_0134485
933 Ga0501081_0285067
934 Ga0501083_0000136
935 Ga0501083_0005576
936 Ga0501083_0071664
937 Ga0501035_0001888
938 Ga0501035_0018401
939 Ga0501035_0294835
940 Ga0501035_0364555
941 Ga0501044_0016704
942 Ga0501044_0018076
943 Ga0501044_0143903
944 Ga0501044_0556477
945 Ga0501045_0000199
946 Ga0501045_0000708
947 Ga0501045_0026784
948 Ga0501045_0045229
949 Ga0501045_0083668
950 Ga0501045_0089064
951 Ga0501045_0521548
952 nmdc:mga00v17_8828_c1
953 nmdc:mga05p37_238569_c1
954 nmdc:mga05p37_2481_c1
955 nmdc:mga05p37_287234_c1
956 nmdc:mga05p37_34092_c1
957 nmdc:mga05p37_5738_c1
958 nmdc:mga05p37_59144_c1
959 nmdc:mga05p37_59630_c1
960 nmdc:mga05p37_72608_c1
961 nmdc:mga09592_280735_c1
962 nmdc:mga09592_29066_c1
963 nmdc:mga0qj67_112428_c1
964 nmdc:mga0qj67_15378_c1
965 nmdc:mga0qj67_42967_c1
966 nmdc:mga0qj67_6566_c1
967 nmdc:mga06r32_20515_c1
968 nmdc:mga06r32_88075_c1
969 nmdc:mga06r32_96611_c1
970 nmdc:mga08y16_178453_c1
971 nmdc:mga08y16_262901_c1
972 nmdc:mga08y16_366215_c1
973 nmdc:mga08y16_45720_c1
974 nmdc:mga08y16_54955_c1
975 nmdc:mga08y16_96165_c1
976 nmdc:mga0n895_303665_c1
977 Ga0495655_0021030
978 Ga0501084_0002961
979 Ga0501084_0005971
980 Ga0501084_0010788
981 Ga0501084_0030799
982 Ga0501084_0095060
983 Ga0501084_0127571
984 Ga0501084_0168317
985 Ga0501084_0173693
986 Ga0501084_0280630
987 Ga0590075_019746
988 Ga0501082_0000897
989 Ga0501082_0001243
990 Ga0501082_0002401
991 Ga0501082_0054519
992 Ga0501082_0090049
993 Ga0501082_0352091
994 Ga0530510_0000434
995 Ga0530510_0003186
996 Ga0530510_0005271
997 Ga0530510_0012443
998 Ga0530510_0308802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

96

165

0.98

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

34

93

0.97

PF04023

FeoA

FeoA domain

176

248

0.97

Map