F455352

General Info

Members Datasets Scaffolds Average Seq Length
499 256 998 296

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100000049|Ga0075434_1000000493
Length 322
Sequence LQIADRVSRGTELKELLDRLYAEFNYPDSAADPIQIVRRHARDDDREVVGFVAASLAFGRVASVLQSIERVLAVMGPSPAAYVRRFDVRRDGRAFADIVHRWTRGRDIAALVWLMRQMIDRAGSLEGFFVEGYDQSAPDVEAALDRFSTRAMALDLKSAYGRVPARGGVCYFFPRPSAGSGCKRLNLFLRWMVRRDALDLGVWRRVAPAKLVVPLDTHVIRVGRCLRLTRYTSPGWPMARDITASLRALDADDPVKYDFALCHLGMMNACGFNRAQRDAQCPLRGICQPSLADFADKLRLGKPAGEGCRAVAAKRRRRTRGR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 4.61
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100000049 3300006871 Bacteria 57417
2 JGI24751J29686_10003789 3300002459 Bacteria 3050
3 Ga0065715_10100264 3300005293 Bacteria 3321
4 Ga0065715_10250607 3300005293 Bacteria 1168
5 Ga0065715_10266314 3300005293 Unclassified 1123
6 Ga0065707_10000702 3300005295 Bacteria 18763
7 Ga0070676_10009427 3300005328 Bacteria 5274
8 Ga0070676_10069727 3300005328 Bacteria 2108
9 Ga0070683_100079162 3300005329 Unclassified 3076
10 Ga0070683_100225920 3300005329 Bacteria 1779
11 Ga0070670_100092663 3300005331 Bacteria 2598
12 Ga0070680_100434663 3300005336 Bacteria 1120
13 Ga0070682_100148571 3300005337 Bacteria 1605
14 Ga0068868_100059080 3300005338 Bacteria 3032
15 Ga0070660_100022321 3300005339 Bacteria 4678
16 Ga0070692_10069211 3300005345 Bacteria 1877
17 Ga0070669_100041348 3300005353 Bacteria 3352
18 Ga0070669_100284219 3300005353 Bacteria 1326
19 Ga0070675_100010456 3300005354 Bacteria 7250
20 Ga0070671_100004673 3300005355 Bacteria 10865
21 Ga0070671_100037148 3300005355 Bacteria 4039
22 Ga0070674_100012032 3300005356 Bacteria 5300
23 Ga0070674_100043536 3300005356 Bacteria 3055
24 Ga0070674_100056026 3300005356 Bacteria 2733
25 Ga0070674_100155690 3300005356 Bacteria 1729
26 Ga0070674_100532150 3300005356 Bacteria 983
27 Ga0070673_100018829 3300005364 Bacteria 4946
28 Ga0070673_100028766 3300005364 Bacteria 4137
29 Ga0070673_100033655 3300005364 Bacteria 3872
30 Ga0070688_100011690 3300005365 Bacteria 4889
31 Ga0070659_100026209 3300005366 Bacteria 4484
32 Ga0070714_100005695 3300005435 Bacteria 9540
33 Ga0070701_10019994 3300005438 Bacteria 3171
34 Ga0070701_10292318 3300005438 Unclassified 999
35 Ga0070711_100031217 3300005439 Bacteria 3535
36 Ga0070705_100043820 3300005440 Bacteria 2567
37 Ga0070705_100147499 3300005440 Bacteria 1556
38 Ga0070705_100226416 3300005440 Unclassified 1298
39 Ga0070700_100003654 3300005441 Bacteria 7951
40 Ga0070694_100006572 3300005444 Bacteria 7064
41 Ga0070694_100099220 3300005444 Bacteria 2058
42 Ga0070708_100427123 3300005445 Bacteria 1250
43 Ga0070678_100034629 3300005456 Bacteria 3519
44 Ga0070662_100188707 3300005457 Bacteria 1629
45 Ga0070681_10003693 3300005458 Bacteria 14358
46 Ga0068867_100076787 3300005459 Bacteria 2509
47 Ga0068867_100082897 3300005459 Bacteria 2420
48 Ga0068867_100140534 3300005459 Unclassified 1887
49 Ga0070706_100284544 3300005467 Unclassified 1543
50 Ga0070706_100361738 3300005467 Bacteria 1352
51 Ga0070707_100216340 3300005468 Unclassified 1867
52 Ga0070707_100242858 3300005468 Bacteria 1753
53 Ga0070698_100035079 3300005471 Bacteria 5187
54 Ga0070698_100173694 3300005471 Bacteria 2095
55 Ga0070698_100302843 3300005471 Bacteria 1529
56 Ga0070698_100328195 3300005471 Bacteria 1461
57 Ga0070699_100002754 3300005518 Bacteria 15671
58 Ga0070699_100091575 3300005518 Bacteria 2658
59 Ga0070679_100025182 3300005530 Bacteria 5836
60 Ga0070679_100047412 3300005530 Bacteria 4283
61 Ga0070679_100102115 3300005530 Bacteria 2854
62 Ga0070684_100134056 3300005535 Bacteria 2236
63 Ga0070684_100163951 3300005535 Bacteria 2017
64 Ga0070697_100017293 3300005536 Bacteria 5673
65 Ga0070697_100113973 3300005536 Bacteria 2256
66 Ga0068853_100200874 3300005539 Bacteria 1814
67 Ga0070686_100127779 3300005544 Bacteria 1754
68 Ga0070686_100129542 3300005544 Bacteria 1743
69 Ga0070695_100004253 3300005545 Bacteria 8374
70 Ga0070695_100008618 3300005545 Bacteria 6057
71 Ga0070695_100149984 3300005545 Bacteria 1626
72 Ga0070696_100010254 3300005546 Bacteria 6271
73 Ga0070696_100025308 3300005546 Bacteria 4034
74 Ga0070696_100122437 3300005546 Bacteria 1884
75 Ga0070696_100226658 3300005546 Bacteria 1404
76 Ga0070665_100001879 3300005548 Bacteria 23848
77 Ga0070665_100011766 3300005548 Bacteria 8836
78 Ga0070704_100088011 3300005549 Bacteria 2306
79 Ga0070704_100089208 3300005549 Bacteria 2293
80 Ga0070704_100094114 3300005549 Bacteria 2241
81 Ga0070704_100127361 3300005549 Bacteria 1967
82 Ga0070704_100180194 3300005549 Bacteria 1689
83 Ga0070704_100190307 3300005549 Bacteria 1649
84 Ga0070704_100207161 3300005549 Bacteria 1587
85 Ga0068855_100029695 3300005563 Bacteria 6536
86 Ga0068855_100364294 3300005563 Bacteria 1590
87 Ga0070664_100299425 3300005564 Unclassified 1453
88 Ga0068857_100311331 3300005577 Bacteria 1453
89 Ga0068854_100031976 3300005578 Bacteria 3659
90 Ga0068854_100115700 3300005578 Bacteria 2029
91 Ga0070702_100025723 3300005615 Bacteria 3156
92 Ga0068852_100087198 3300005616 Bacteria 2784
93 Ga0068859_100005220 3300005617 Bacteria 13200
94 Ga0068859_100024900 3300005617 Bacteria 6008
95 Ga0068859_100140685 3300005617 Bacteria 2487
96 Ga0068859_100716302 3300005617 Unclassified 1091
97 Ga0068864_100002418 3300005618 Bacteria 15421
98 Ga0068866_10051006 3300005718 Unclassified 2104
99 Ga0068861_100006770 3300005719 Bacteria 7828
100 Ga0068861_100080089 3300005719 Bacteria 2555
101 Ga0068861_100144206 3300005719 Unclassified 1947
102 Ga0068863_100004157 3300005841 Bacteria 14293
103 Ga0068863_100087628 3300005841 Unclassified 2950
104 Ga0068863_100273988 3300005841 Bacteria 1634
105 Ga0068858_100003569 3300005842 Bacteria 15398
106 Ga0068858_100004887 3300005842 Bacteria 13149
107 Ga0068858_100058039 3300005842 Bacteria 3578
108 Ga0068858_100188959 3300005842 Unclassified 1946
109 Ga0068858_100243584 3300005842 Bacteria 1706
110 Ga0068858_100379269 3300005842 Bacteria 1357
111 Ga0068858_100530433 3300005842 Bacteria 1139
112 Ga0068860_100014404 3300005843 Bacteria 7747
113 Ga0068860_100366926 3300005843 Bacteria 1419
114 Ga0068860_100429632 3300005843 Bacteria 1310
115 Ga0068862_100101688 3300005844 Bacteria 2515
116 Ga0068862_100284595 3300005844 Bacteria 1516
117 Ga0068862_100307617 3300005844 Bacteria 1460
118 Ga0068862_100314421 3300005844 Bacteria 1444
119 Ga0081539_10007071 3300005985 Bacteria 10377
120 Ga0070717_10021303 3300006028 Bacteria 5106
121 Ga0075364_10314604 3300006051 Bacteria 1066
122 Ga0075367_10060699 3300006178 Unclassified 2255
123 Ga0075367_10169260 3300006178 Unclassified 1360
124 Ga0097621_100005127 3300006237 Bacteria 9204
125 Ga0097621_100162055 3300006237 Bacteria 1923
126 Ga0097621_100200817 3300006237 Bacteria 1731
127 Ga0068871_100005171 3300006358 Bacteria 9124
128 Ga0068871_100025666 3300006358 Unclassified 4588
129 Ga0068871_100191746 3300006358 Bacteria 1761
130 Ga0075428_100000005 3300006844 Bacteria 326130
131 Ga0075428_100077244 3300006844 Bacteria 3634
132 Ga0075428_100110406 3300006844 Bacteria 2996
133 Ga0075430_100463612 3300006846 Bacteria 1046
134 Ga0075431_100115854 3300006847 Bacteria 2766
135 Ga0075431_100158865 3300006847 Bacteria 2325
136 Ga0075431_100365678 3300006847 Unclassified 1448
137 Ga0075431_100706252 3300006847 Bacteria 986
138 Ga0075433_10007439 3300006852 Bacteria 8698
139 Ga0075433_10025738 3300006852 Bacteria 4975
140 Ga0075433_10048253 3300006852 Bacteria 3703
141 Ga0075433_10310073 3300006852 Bacteria 1397
142 Ga0075433_10408880 3300006852 Unclassified 1197
143 Ga0075434_100028026 3300006871 Bacteria 5531
144 Ga0075434_100045015 3300006871 Bacteria 4378
145 Ga0075434_100091961 3300006871 Bacteria 3035
146 Ga0075434_100398171 3300006871 Unclassified 1398
147 Ga0068865_100050495 3300006881 Bacteria 2873
148 Ga0075436_100014776 3300006914 Bacteria 5350
149 Ga0075436_100072364 3300006914 Bacteria 2385
150 Ga0097620_100005219 3300006931 Bacteria 13200
151 Ga0097620_100024900 3300006931 Bacteria 6008
152 Ga0097620_100140683 3300006931 Bacteria 2487
153 Ga0097620_100224419 3300006931 Unclassified 1967
154 Ga0097620_100716186 3300006931 Unclassified 1091
155 Ga0075435_100009794 3300007076 Bacteria 6973
156 Ga0075435_100031560 3300007076 Bacteria 4175
157 Ga0075435_100072420 3300007076 Bacteria 2815
158 Ga0075435_100099088 3300007076 Bacteria 2413
159 Ga0075435_100127275 3300007076 Bacteria 2129
160 Ga0105240_10320770 3300009093 Bacteria 1766
161 Ga0111539_10040057 3300009094 Bacteria 5642
162 Ga0111539_10244459 3300009094 Bacteria 2089
163 Ga0105245_10019641 3300009098 Bacteria 5920
164 Ga0105245_10036477 3300009098 Bacteria 4367
165 Ga0114129_10002682 3300009147 Bacteria 24772
166 Ga0114129_10004292 3300009147 Bacteria 20145
167 Ga0114129_10008750 3300009147 Bacteria 14437
168 Ga0114129_10069380 3300009147 Bacteria 4913
169 Ga0114129_10118514 3300009147 Bacteria 3646
170 Ga0114129_10380839 3300009147 Bacteria 1863
171 Ga0114129_10475477 3300009147 Bacteria 1636
172 Ga0114129_10757384 3300009147 Unclassified 1242
173 Ga0105243_10039022 3300009148 Bacteria 3700
174 Ga0105243_10087586 3300009148 Bacteria 2556
175 Ga0105241_10508886 3300009174 Bacteria 1075
176 Ga0105242_10002104 3300009176 Bacteria 15686
177 Ga0105242_10061643 3300009176 Bacteria 3085
178 Ga0105248_10033372 3300009177 Bacteria 5750
179 Ga0105248_10076941 3300009177 Bacteria 3750
180 Ga0105248_10122798 3300009177 Bacteria 2930
181 Ga0105248_10155308 3300009177 Bacteria 2582
182 Ga0105248_10720489 3300009177 Bacteria 1126
183 Ga0105238_10279331 3300009551 Bacteria 1651
184 Ga0105238_10297110 3300009551 Bacteria 1598
185 Ga0105249_10417706 3300009553 Bacteria 1374
186 Ga0105249_10450174 3300009553 Unclassified 1326
187 Ga0105246_10164117 3300011119 Bacteria 1695
188 Ga0105246_10209351 3300011119 Bacteria 1521
189 Ga0157369_10314907 3300013105 Unclassified 1627
190 Ga0157374_10010055 3300013296 Bacteria 8124
191 Ga0163162_10037487 3300013306 Bacteria 4838
192 Ga0163162_10050695 3300013306 Bacteria 4163
193 Ga0157375_10404317 3300013308 Bacteria 1532
194 Ga0163163_10010073 3300014325 Bacteria 8478
195 Ga0157380_10085567 3300014326 Bacteria 2588
196 Ga0157380_10216099 3300014326 Unclassified 1712
197 Ga0157380_10227613 3300014326 Bacteria 1672
198 Ga0157379_10013796 3300014968 Bacteria 7081
199 Ga0157379_10020277 3300014968 Bacteria 5878
200 Ga0157379_10034676 3300014968 Unclassified 4500
201 Ga0157376_10003021 3300014969 Bacteria 11544
202 Ga0157376_10271939 3300014969 Bacteria 1592
203 Ga0163161_10308966 3300017792 Bacteria 1247
204 Ga0207682_10079916 3300025893 Bacteria 1400
205 Ga0207682_10124626 3300025893 Unclassified 1146
206 Ga0207642_10031362 3300025899 Bacteria 2225
207 Ga0207642_10033730 3300025899 Unclassified 2169
208 Ga0207642_10041369 3300025899 Bacteria 2017
209 Ga0207710_10016800 3300025900 Unclassified 3098
210 Ga0207710_10020690 3300025900 Bacteria 2815
211 Ga0207710_10044361 3300025900 Unclassified 1980
212 Ga0207688_10134557 3300025901 Bacteria 1451
213 Ga0207645_10004630 3300025907 Bacteria 10129
214 Ga0207645_10069832 3300025907 Bacteria 2247
215 Ga0207643_10049073 3300025908 Bacteria 2392
216 Ga0207705_10075903 3300025909 Bacteria 2442
217 Ga0207684_10098366 3300025910 Bacteria 2499
218 Ga0207695_10054574 3300025913 Bacteria 4171
219 Ga0207695_10352738 3300025913 Bacteria 1358
220 Ga0207663_10087611 3300025916 Bacteria 2056
221 Ga0207660_10244105 3300025917 Bacteria 1416
222 Ga0207657_10023667 3300025919 Bacteria 5713
223 Ga0207657_10048191 3300025919 Bacteria 3720
224 Ga0207652_10213418 3300025921 Bacteria 1738
225 Ga0207646_10111410 3300025922 Bacteria 2456
226 Ga0207646_10245013 3300025922 Bacteria 1619
227 Ga0207681_10226906 3300025923 Unclassified 1448
228 Ga0207650_10019728 3300025925 Bacteria 4742
229 Ga0207650_10121298 3300025925 Bacteria 2036
230 Ga0207659_10048899 3300025926 Bacteria 2997
231 Ga0207659_10088528 3300025926 Bacteria 2306
232 Ga0207659_10282353 3300025926 Bacteria 1358
233 Ga0207659_10534204 3300025926 Bacteria 995
234 Ga0207687_10032811 3300025927 Bacteria 3519
235 Ga0207687_10144598 3300025927 Unclassified 1808
236 Ga0207700_10005812 3300025928 Bacteria 7408
237 Ga0207664_10011127 3300025929 Bacteria 6377
238 Ga0207644_10048370 3300025931 Bacteria 3040
239 Ga0207706_10047265 3300025933 Bacteria 3808
240 Ga0207686_10018963 3300025934 Bacteria 3903
241 Ga0207669_10017551 3300025937 Bacteria 3675
242 Ga0207669_10036352 3300025937 Bacteria 2813
243 Ga0207669_10044188 3300025937 Bacteria 2616
244 Ga0207669_10303577 3300025937 Bacteria 1214
245 Ga0207669_10401622 3300025937 Bacteria 1074
246 Ga0207704_10124763 3300025938 Bacteria 1770
247 Ga0207704_10271576 3300025938 Bacteria 1284
248 Ga0207704_10287986 3300025938 Bacteria 1252
249 Ga0207691_10006933 3300025940 Bacteria 10926
250 Ga0207691_10338076 3300025940 Unclassified 1289
251 Ga0207711_10025211 3300025941 Bacteria 4988
252 Ga0207711_10036901 3300025941 Unclassified 4148
253 Ga0207711_10045878 3300025941 Bacteria 3734
254 Ga0207711_10051121 3300025941 Bacteria 3539
255 Ga0207711_10093045 3300025941 Bacteria 2655
256 Ga0207711_10161820 3300025941 Bacteria 2027
257 Ga0207711_10207829 3300025941 Bacteria 1788
258 Ga0207711_10440858 3300025941 Bacteria 1212
259 Ga0207689_10136459 3300025942 Bacteria 2020
260 Ga0207689_10221610 3300025942 Bacteria 1563
261 Ga0207661_10585058 3300025944 Bacteria 1024
262 Ga0207679_10067384 3300025945 Bacteria 2685
263 Ga0207667_10199814 3300025949 Bacteria 2051
264 Ga0207651_10051576 3300025960 Unclassified 2800
265 Ga0207651_10084122 3300025960 Bacteria 2303
266 Ga0207651_10375171 3300025960 Bacteria 1204
267 Ga0207712_10066561 3300025961 Bacteria 2576
268 Ga0207712_10155279 3300025961 Unclassified 1772
269 Ga0207640_10038758 3300025981 Unclassified 3010
270 Ga0207640_10077036 3300025981 Bacteria 2266
271 Ga0207677_10433274 3300026023 Bacteria 1123
272 Ga0207703_10132388 3300026035 Bacteria 2155
273 Ga0207703_10217957 3300026035 Bacteria 1705
274 Ga0207703_10231770 3300026035 Unclassified 1656
275 Ga0207703_10233369 3300026035 Bacteria 1650
276 Ga0207708_10000978 3300026075 Bacteria 21433
277 Ga0207708_10056457 3300026075 Bacteria 2995
278 Ga0207641_10061612 3300026088 Unclassified 3200
279 Ga0207641_10322710 3300026088 Bacteria 1465
280 Ga0207648_10004331 3300026089 Bacteria 14617
281 Ga0207648_10027201 3300026089 Bacteria 5080
282 Ga0207648_10505946 3300026089 Bacteria 1106
283 Ga0207676_10079440 3300026095 Bacteria 2660
284 Ga0207676_10449541 3300026095 Unclassified 1214
285 Ga0207676_10466884 3300026095 Unclassified 1193
286 Ga0207676_10565304 3300026095 Unclassified 1088
287 Ga0207674_10312346 3300026116 Bacteria 1521
288 Ga0207675_100007948 3300026118 Bacteria 10003
289 Ga0207675_100011666 3300026118 Bacteria 8217
290 Ga0207675_100063970 3300026118 Bacteria 3437
291 Ga0207675_100188123 3300026118 Bacteria 1979
292 Ga0207675_100190522 3300026118 Bacteria 1967
293 Ga0207675_100229123 3300026118 Bacteria 1792
294 Ga0207675_100548068 3300026118 Bacteria 1155
295 Ga0207683_10078810 3300026121 Bacteria 2920
296 Ga0207428_10000019 3300027907 Bacteria 276945
297 Ga0207428_10068169 3300027907 Bacteria 2799
298 Ga0207428_10140612 3300027907 Bacteria 1843
299 Ga0268266_10018083 3300028379 Bacteria 6008
300 Ga0268266_10019196 3300028379 Bacteria 5821
301 Ga0268266_10071358 3300028379 Bacteria 3010
302 Ga0268266_10093364 3300028379 Unclassified 2640
303 Ga0268265_10030336 3300028380 Bacteria 3892
304 Ga0268264_10129880 3300028381 Bacteria 2231
305 Ga0268264_10162892 3300028381 Bacteria 2011
306 Ga0268264_10315544 3300028381 Bacteria 1476
307 Ga0268264_10386477 3300028381 Bacteria 1341
308 Ga0265336_10029834 3300028666 Bacteria 1700
309 Ga0265314_10076667 3300031711 Bacteria 2220
310 Ga0265314_10103496 3300031711 Bacteria 1825
311 Ga0307413_10191097 3300031824 Unclassified 1470
312 Ga0307407_10434067 3300031903 Bacteria 950
313 Ga0307414_10076191 3300032004 Unclassified 2437
314 Ga0307415_100007022 3300032126 Bacteria 6125
315 Ga0373948_0000442 3300034817 Bacteria 5140
316 Ga0373958_0010564 3300034819 Bacteria 1543
317 Ga0373959_0009093 3300034820 Bacteria 1705
318 Ga0373938_0000931 3300034957 Bacteria 4686
319 Ga0373928_0003949 3300035084 Bacteria 2829
320 Ga0373929_0006348 3300035085 Unclassified 2136
321 Ga0373940_0004139 3300035088 Bacteria 3040
322 Ga0373949_0001959 3300035090 Bacteria 5524
323 Ga0373951_0003916 3300035091 Bacteria 3578
324 Ga0373952_0004870 3300035092 Bacteria 2441
325 Ga0373932_0004037 3300035112 Bacteria 3492
326 Ga0373932_0010183 3300035112 Unclassified 2272
327 Ga0373939_0001349 3300035114 Bacteria 5943
328 Ga0373939_0070244 3300035114 Bacteria 1138
329 Ga0373941_0004911 3300035115 Bacteria 3116
330 Ga0373960_0013394 3300035121 Bacteria 2057
331 Ga0373943_0019436 3300035170 Bacteria 3124
332 Ga0373946_0094991 3300035171 Bacteria 1327
333 Ga0373955_0111851 3300035172 Unclassified 1580
334 Ga0373955_0247209 3300035172 Bacteria 1069
335 Ga0373942_0004490 3300035207 Bacteria 3236
336 Ga0373961_0003661 3300035241 Bacteria 3770
337 Ga0373962_0000201 3300035242 Bacteria 12625
338 Ga0373924_0071591 3300035410 Bacteria 1463
339 Ga0373931_0008923 3300035691 Bacteria 4777
340 Ga0373935_0201999 3300035692 Bacteria 1374
341 Ga0373935_0410919 3300035692 Bacteria 973
342 Ga0373947_0068733 3300035725 Bacteria 2167
343 Ga0373937_0134086 3300036401 Bacteria 2315
344 Ga0373937_0265833 3300036401 Bacteria 1618
345 Ga0373937_0342382 3300036401 Bacteria 1416
346 Ga0373937_0559817 3300036401 Bacteria 1086
347 Ga0373925_0003479 3300037068 Bacteria 12183
348 Ga0373925_0189143 3300037068 Unclassified 1633
349 Ga0373925_0282140 3300037068 Bacteria 1338
350 Ga0436365_1095435 3300039437 Bacteria 2030
351 Ga0439439_0035734 3300041406 Bacteria 1277
352 Ga0450923_014886 3300042125 Bacteria 1448
353 Ga0439446_0007486 3300042156 Bacteria 2872
354 Ga0451577_0072495 3300042876 Bacteria 3073
355 Ga0466963_0341692 3300044694 Bacteria 1054
356 Ga0451576_0006121 3300045051 Bacteria 14828
357 Ga0451576_0704875 3300045051 Bacteria 1061
358 Ga0495603_0083206 3300046455 Bacteria 1874
359 Ga0495603_0117050 3300046455 Bacteria 1554
360 Ga0495629_0289820 3300046459 Bacteria 1122
361 Ga0495653_0183477 3300046463 Bacteria 1434
362 Ga0495653_0287573 3300046463 Bacteria 1077
363 Ga0495580_0035626 3300046472 Bacteria 3578
364 Ga0495608_0020498 3300046511 Bacteria 4544
365 Ga0495618_0047760 3300046514 Bacteria 2702
366 Ga0495628_0002852 3300046516 Bacteria 15494
367 Ga0495628_0267548 3300046516 Bacteria 1272
368 Ga0495630_0082301 3300046517 Bacteria 2430
369 Ga0495652_0185845 3300046529 Unclassified 1590
370 Ga0495640_0095495 3300046533 Bacteria 1957
371 Ga0495587_0228172 3300046536 Bacteria 1050
372 Ga0495621_0019080 3300046539 Bacteria 2235
373 Ga0495645_0018486 3300046543 Bacteria 5006
374 Ga0495645_0044147 3300046543 Bacteria 3251
375 Ga0495633_0069658 3300046558 Bacteria 1642
376 Ga0495667_0207691 3300046559 Bacteria 1252
377 Ga0495667_0331708 3300046559 Bacteria 962
378 Ga0495635_0064854 3300046663 Bacteria 2507
379 Ga0495635_0134688 3300046663 Bacteria 1684
380 Ga0495623_0142699 3300046679 Bacteria 1423
381 Ga0495658_0086249 3300046683 Bacteria 1852
382 Ga0495658_0161999 3300046683 Bacteria 1380
383 Ga0495669_0002522 3300046684 Bacteria 7477
384 Ga0495669_0033369 3300046684 Bacteria 2265
385 Ga0495669_0062389 3300046684 Bacteria 1689
386 Ga0495624_0117665 3300046690 Bacteria 1633
387 Ga0495600_0082722 3300046809 Unclassified 2095
388 Ga0495604_0060989 3300047317 Bacteria 2886
389 Ga0495674_0008199 3300047319 Bacteria 9969
390 Ga0495674_0257601 3300047319 Bacteria 1434
391 Ga0495675_0215686 3300047444 Bacteria 1163
392 Ga0495684_0035082 3300047471 Bacteria 3848
393 Ga0496100_0000818 3300048903 Bacteria 14930
394 Ga0496100_0405699 3300048903 Bacteria 1039
395 Ga0496101_0001528 3300048904 Bacteria 13862
396 Ga0496102_0519855 3300048905 Bacteria 1113
397 Ga0496104_0005154 3300048907 Bacteria 11417
398 Ga0496104_0134640 3300048907 Bacteria 2374
399 Ga0496105_0072592 3300048908 Bacteria 2844
400 Ga0496106_0052493 3300048909 Bacteria 3076
401 Ga0496106_0248348 3300048909 Archaea 1422
402 Ga0496106_0306113 3300048909 Unclassified 1275
403 Ga0496107_0271428 3300048910 Bacteria 1262
404 Ga0496107_0321870 3300048910 Bacteria 1151
405 Ga0496109_0121589 3300048912 Bacteria 2432
406 Ga0496109_0657733 3300048912 Bacteria 985
407 Ga0496110_0053926 3300048913 Bacteria 3536
408 Ga0496110_0094846 3300048913 Unclassified 2672
409 Ga0496111_0317680 3300048914 Bacteria 1154
410 Ga0496112_0058711 3300048915 Bacteria 3789
411 Ga0496112_0111625 3300048915 Unclassified 2704
412 Ga0496113_0012232 3300048916 Bacteria 5761
413 Ga0496114_0000958 3300048917 Bacteria 21594
414 Ga0496114_0029520 3300048917 Bacteria 4509
415 Ga0496115_0440285 3300048918 Bacteria 1054
416 Ga0501031_0212232 3300049568 Bacteria 1261
417 Ga0501033_0107706 3300049570 Bacteria 2030
418 Ga0501036_0036270 3300049572 Bacteria 4172
419 Ga0501039_0015150 3300049575 Bacteria 5900
420 Ga0501040_0028437 3300049576 Bacteria 3769
421 Ga0501041_0022553 3300049577 Bacteria 3769
422 Ga0501042_0032237 3300049578 Bacteria 3710
423 Ga0501042_0033516 3300049578 Bacteria 3641
424 Ga0501042_0192080 3300049578 Bacteria 1473
425 Ga0501046_0007069 3300049580 Bacteria 9884
426 Ga0501047_0010713 3300049581 Bacteria 8666
427 Ga0501068_0081475 3300049584 Bacteria 1987
428 Ga0501071_0045068 3300049587 Bacteria 3165
429 Ga0501072_0060693 3300049588 Unclassified 2981
430 Ga0501073_0110839 3300049589 Bacteria 1904
431 Ga0501075_0012169 3300049591 Bacteria 6109
432 Ga0501075_0037308 3300049591 Bacteria 3630
433 Ga0501075_0271808 3300049591 Bacteria 1292
434 Ga0501076_0015882 3300049592 Bacteria 5698
435 Ga0501077_0168846 3300049593 Bacteria 1390
436 Ga0501261_007656 3300049690 Bacteria 1388
437 Ga0501079_0006744 3300049741 Bacteria 8638
438 Ga0501079_0146725 3300049741 Bacteria 1839
439 Ga0501083_0202884 3300049744 Bacteria 1293
440 Ga0501035_0300545 3300049822 Bacteria 1352
441 Ga0501045_0032570 3300049824 Bacteria 3777
442 Ga0501045_0047508 3300049824 Bacteria 3127
443 nmdc:mga06z11_225505_c1 3300050494 Bacteria 1096
444 nmdc:mga05p37_146720_c1 3300050507 Bacteria 2888
445 nmdc:mga05p37_236252_c1 3300050507 Bacteria 2200
446 nmdc:mga05p37_3190_c1 3300050507 Bacteria 19076
447 nmdc:mga05p37_39557_c1 3300050507 Bacteria 5790
448 nmdc:mga05p37_417818_c1 3300050507 Bacteria 1561
449 nmdc:mga05p37_4987_c1 3300050507 Bacteria 15557
450 nmdc:mga05p37_59330_c1 3300050507 Bacteria 4712
451 nmdc:mga05p37_91408_c1 3300050507 Bacteria 3751
452 nmdc:mga05p37_91504_c1 3300050507 Bacteria 3748
453 nmdc:mga05p37_99056_c1 3300050507 Bacteria 3591
454 nmdc:mga0qj67_291556_c1 3300050509 Unclassified 1322
455 nmdc:mga06r32_186899_c1 3300050510 Bacteria 2059
456 nmdc:mga08y16_10531_c1 3300050511 Bacteria 9704
457 nmdc:mga08y16_157332_c1 3300050511 Bacteria 2361
458 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
459 nmdc:mga08y16_52250_c1 3300050511 Bacteria 4276
460 nmdc:mga0n895_14185_c1 3300050512 Bacteria 7227
461 nmdc:mga0n895_184169_c1 3300050512 Bacteria 2120
462 nmdc:mga0n895_29803_c1 3300050512 Bacteria 5207
463 nmdc:mga0n895_309347_c1 3300050512 Unclassified 1601
464 nmdc:mga0n895_41949_c1 3300050512 Bacteria 4450
465 nmdc:mga0n895_78871_c1 3300050512 Bacteria 3278
466 nmdc:mga0rr50_10841_c1 3300050513 Bacteria 5810
467 nmdc:mga0rr50_166469_c1 3300050513 Bacteria 1793
468 nmdc:mga0rr50_194011_c1 3300050513 Bacteria 1666
469 nmdc:mga0rr50_24904_c1 3300050513 Bacteria 4153
470 nmdc:mga0rr50_27460_c1 3300050513 Bacteria 3986
471 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
472 nmdc:mga0rr50_71989_c1 3300050513 Bacteria 2639
473 nmdc:mga08x19_163481_c1 3300050514 Unclassified 1513
474 nmdc:mga08x19_191460_c1 3300050514 Bacteria 1399
475 nmdc:mga08x19_235750_c1 3300050514 Bacteria 1260
476 nmdc:mga08x19_874_c1 3300050514 Bacteria 19134
477 nmdc:mga0a205_170011_c1 3300050515 Bacteria 2076
478 nmdc:mga0a205_188290_c1 3300050515 Bacteria 1956
479 nmdc:mga0a205_273270_c1 3300050515 Bacteria 1567
480 nmdc:mga0a205_367248_c1 3300050515 Bacteria 1305
481 nmdc:mga0a205_6507_c1 3300050515 Bacteria 10561
482 nmdc:mga0a205_77398_c1 3300050515 Bacteria 1874
483 nmdc:mga0a205_86881_c1 3300050515 Bacteria 3021
484 Ga0495601_0111736 3300053077 Bacteria 1770
485 Ga0495595_0012017 3300053084 Bacteria 3632
486 Ga0495619_0002018 3300053085 Bacteria 13495
487 Ga0495619_0008673 3300053085 Bacteria 6433
488 Ga0495619_0043883 3300053085 Bacteria 2933
489 Ga0495619_0046787 3300053085 Bacteria 2846
490 Ga0495619_0257127 3300053085 Bacteria 1210
491 Ga0500556_0043955 3300053104 Bacteria 1588
492 Ga0500658_0034922 3300053134 Bacteria 1988
493 Ga0501084_0020169 3300054114 Bacteria 5556
494 Ga0501084_0302905 3300054114 Bacteria 1350
495 Ga0501084_0437459 3300054114 Bacteria 1106
496 Ga0590071_000125 3300059421 Bacteria 21355
497 Ga0590077_001180 3300059426 Bacteria 6355
498 Ga0501082_0023130 3300060353 Bacteria 5359
499 Ga0530510_0023851 3300061734 Unclassified 4362
500 Ga0075434_100000049
501 JGI24751J29686_10003789
502 Ga0065715_10100264
503 Ga0065715_10250607
504 Ga0065715_10266314
505 Ga0065707_10000702
506 Ga0070676_10009427
507 Ga0070676_10069727
508 Ga0070683_100079162
509 Ga0070683_100225920
510 Ga0070670_100092663
511 Ga0070680_100434663
512 Ga0070682_100148571
513 Ga0068868_100059080
514 Ga0070660_100022321
515 Ga0070692_10069211
516 Ga0070669_100041348
517 Ga0070669_100284219
518 Ga0070675_100010456
519 Ga0070671_100004673
520 Ga0070671_100037148
521 Ga0070674_100012032
522 Ga0070674_100043536
523 Ga0070674_100056026
524 Ga0070674_100155690
525 Ga0070674_100532150
526 Ga0070673_100018829
527 Ga0070673_100028766
528 Ga0070673_100033655
529 Ga0070688_100011690
530 Ga0070659_100026209
531 Ga0070714_100005695
532 Ga0070701_10019994
533 Ga0070701_10292318
534 Ga0070711_100031217
535 Ga0070705_100043820
536 Ga0070705_100147499
537 Ga0070705_100226416
538 Ga0070700_100003654
539 Ga0070694_100006572
540 Ga0070694_100099220
541 Ga0070708_100427123
542 Ga0070678_100034629
543 Ga0070662_100188707
544 Ga0070681_10003693
545 Ga0068867_100076787
546 Ga0068867_100082897
547 Ga0068867_100140534
548 Ga0070706_100284544
549 Ga0070706_100361738
550 Ga0070707_100216340
551 Ga0070707_100242858
552 Ga0070698_100035079
553 Ga0070698_100173694
554 Ga0070698_100302843
555 Ga0070698_100328195
556 Ga0070699_100002754
557 Ga0070699_100091575
558 Ga0070679_100025182
559 Ga0070679_100047412
560 Ga0070679_100102115
561 Ga0070684_100134056
562 Ga0070684_100163951
563 Ga0070697_100017293
564 Ga0070697_100113973
565 Ga0068853_100200874
566 Ga0070686_100127779
567 Ga0070686_100129542
568 Ga0070695_100004253
569 Ga0070695_100008618
570 Ga0070695_100149984
571 Ga0070696_100010254
572 Ga0070696_100025308
573 Ga0070696_100122437
574 Ga0070696_100226658
575 Ga0070665_100001879
576 Ga0070665_100011766
577 Ga0070704_100088011
578 Ga0070704_100089208
579 Ga0070704_100094114
580 Ga0070704_100127361
581 Ga0070704_100180194
582 Ga0070704_100190307
583 Ga0070704_100207161
584 Ga0068855_100029695
585 Ga0068855_100364294
586 Ga0070664_100299425
587 Ga0068857_100311331
588 Ga0068854_100031976
589 Ga0068854_100115700
590 Ga0070702_100025723
591 Ga0068852_100087198
592 Ga0068859_100005220
593 Ga0068859_100024900
594 Ga0068859_100140685
595 Ga0068859_100716302
596 Ga0068864_100002418
597 Ga0068866_10051006
598 Ga0068861_100006770
599 Ga0068861_100080089
600 Ga0068861_100144206
601 Ga0068863_100004157
602 Ga0068863_100087628
603 Ga0068863_100273988
604 Ga0068858_100003569
605 Ga0068858_100004887
606 Ga0068858_100058039
607 Ga0068858_100188959
608 Ga0068858_100243584
609 Ga0068858_100379269
610 Ga0068858_100530433
611 Ga0068860_100014404
612 Ga0068860_100366926
613 Ga0068860_100429632
614 Ga0068862_100101688
615 Ga0068862_100284595
616 Ga0068862_100307617
617 Ga0068862_100314421
618 Ga0081539_10007071
619 Ga0070717_10021303
620 Ga0075364_10314604
621 Ga0075367_10060699
622 Ga0075367_10169260
623 Ga0097621_100005127
624 Ga0097621_100162055
625 Ga0097621_100200817
626 Ga0068871_100005171
627 Ga0068871_100025666
628 Ga0068871_100191746
629 Ga0075428_100000005
630 Ga0075428_100077244
631 Ga0075428_100110406
632 Ga0075430_100463612
633 Ga0075431_100115854
634 Ga0075431_100158865
635 Ga0075431_100365678
636 Ga0075431_100706252
637 Ga0075433_10007439
638 Ga0075433_10025738
639 Ga0075433_10048253
640 Ga0075433_10310073
641 Ga0075433_10408880
642 Ga0075434_100028026
643 Ga0075434_100045015
644 Ga0075434_100091961
645 Ga0075434_100398171
646 Ga0068865_100050495
647 Ga0075436_100014776
648 Ga0075436_100072364
649 Ga0097620_100005219
650 Ga0097620_100024900
651 Ga0097620_100140683
652 Ga0097620_100224419
653 Ga0097620_100716186
654 Ga0075435_100009794
655 Ga0075435_100031560
656 Ga0075435_100072420
657 Ga0075435_100099088
658 Ga0075435_100127275
659 Ga0105240_10320770
660 Ga0111539_10040057
661 Ga0111539_10244459
662 Ga0105245_10019641
663 Ga0105245_10036477
664 Ga0114129_10002682
665 Ga0114129_10004292
666 Ga0114129_10008750
667 Ga0114129_10069380
668 Ga0114129_10118514
669 Ga0114129_10380839
670 Ga0114129_10475477
671 Ga0114129_10757384
672 Ga0105243_10039022
673 Ga0105243_10087586
674 Ga0105241_10508886
675 Ga0105242_10002104
676 Ga0105242_10061643
677 Ga0105248_10033372
678 Ga0105248_10076941
679 Ga0105248_10122798
680 Ga0105248_10155308
681 Ga0105248_10720489
682 Ga0105238_10279331
683 Ga0105238_10297110
684 Ga0105249_10417706
685 Ga0105249_10450174
686 Ga0105246_10164117
687 Ga0105246_10209351
688 Ga0157369_10314907
689 Ga0157374_10010055
690 Ga0163162_10037487
691 Ga0163162_10050695
692 Ga0157375_10404317
693 Ga0163163_10010073
694 Ga0157380_10085567
695 Ga0157380_10216099
696 Ga0157380_10227613
697 Ga0157379_10013796
698 Ga0157379_10020277
699 Ga0157379_10034676
700 Ga0157376_10003021
701 Ga0157376_10271939
702 Ga0163161_10308966
703 Ga0207682_10079916
704 Ga0207682_10124626
705 Ga0207642_10031362
706 Ga0207642_10033730
707 Ga0207642_10041369
708 Ga0207710_10016800
709 Ga0207710_10020690
710 Ga0207710_10044361
711 Ga0207688_10134557
712 Ga0207645_10004630
713 Ga0207645_10069832
714 Ga0207643_10049073
715 Ga0207705_10075903
716 Ga0207684_10098366
717 Ga0207695_10054574
718 Ga0207695_10352738
719 Ga0207663_10087611
720 Ga0207660_10244105
721 Ga0207657_10023667
722 Ga0207657_10048191
723 Ga0207652_10213418
724 Ga0207646_10111410
725 Ga0207646_10245013
726 Ga0207681_10226906
727 Ga0207650_10019728
728 Ga0207650_10121298
729 Ga0207659_10048899
730 Ga0207659_10088528
731 Ga0207659_10282353
732 Ga0207659_10534204
733 Ga0207687_10032811
734 Ga0207687_10144598
735 Ga0207700_10005812
736 Ga0207664_10011127
737 Ga0207644_10048370
738 Ga0207706_10047265
739 Ga0207686_10018963
740 Ga0207669_10017551
741 Ga0207669_10036352
742 Ga0207669_10044188
743 Ga0207669_10303577
744 Ga0207669_10401622
745 Ga0207704_10124763
746 Ga0207704_10271576
747 Ga0207704_10287986
748 Ga0207691_10006933
749 Ga0207691_10338076
750 Ga0207711_10025211
751 Ga0207711_10036901
752 Ga0207711_10045878
753 Ga0207711_10051121
754 Ga0207711_10093045
755 Ga0207711_10161820
756 Ga0207711_10207829
757 Ga0207711_10440858
758 Ga0207689_10136459
759 Ga0207689_10221610
760 Ga0207661_10585058
761 Ga0207679_10067384
762 Ga0207667_10199814
763 Ga0207651_10051576
764 Ga0207651_10084122
765 Ga0207651_10375171
766 Ga0207712_10066561
767 Ga0207712_10155279
768 Ga0207640_10038758
769 Ga0207640_10077036
770 Ga0207677_10433274
771 Ga0207703_10132388
772 Ga0207703_10217957
773 Ga0207703_10231770
774 Ga0207703_10233369
775 Ga0207708_10000978
776 Ga0207708_10056457
777 Ga0207641_10061612
778 Ga0207641_10322710
779 Ga0207648_10004331
780 Ga0207648_10027201
781 Ga0207648_10505946
782 Ga0207676_10079440
783 Ga0207676_10449541
784 Ga0207676_10466884
785 Ga0207676_10565304
786 Ga0207674_10312346
787 Ga0207675_100007948
788 Ga0207675_100011666
789 Ga0207675_100063970
790 Ga0207675_100188123
791 Ga0207675_100190522
792 Ga0207675_100229123
793 Ga0207675_100548068
794 Ga0207683_10078810
795 Ga0207428_10000019
796 Ga0207428_10068169
797 Ga0207428_10140612
798 Ga0268266_10018083
799 Ga0268266_10019196
800 Ga0268266_10071358
801 Ga0268266_10093364
802 Ga0268265_10030336
803 Ga0268264_10129880
804 Ga0268264_10162892
805 Ga0268264_10315544
806 Ga0268264_10386477
807 Ga0265336_10029834
808 Ga0265314_10076667
809 Ga0265314_10103496
810 Ga0307413_10191097
811 Ga0307407_10434067
812 Ga0307414_10076191
813 Ga0307415_100007022
814 Ga0373948_0000442
815 Ga0373958_0010564
816 Ga0373959_0009093
817 Ga0373938_0000931
818 Ga0373928_0003949
819 Ga0373929_0006348
820 Ga0373940_0004139
821 Ga0373949_0001959
822 Ga0373951_0003916
823 Ga0373952_0004870
824 Ga0373932_0004037
825 Ga0373932_0010183
826 Ga0373939_0001349
827 Ga0373939_0070244
828 Ga0373941_0004911
829 Ga0373960_0013394
830 Ga0373943_0019436
831 Ga0373946_0094991
832 Ga0373955_0111851
833 Ga0373955_0247209
834 Ga0373942_0004490
835 Ga0373961_0003661
836 Ga0373962_0000201
837 Ga0373924_0071591
838 Ga0373931_0008923
839 Ga0373935_0201999
840 Ga0373935_0410919
841 Ga0373947_0068733
842 Ga0373937_0134086
843 Ga0373937_0265833
844 Ga0373937_0342382
845 Ga0373937_0559817
846 Ga0373925_0003479
847 Ga0373925_0189143
848 Ga0373925_0282140
849 Ga0436365_1095435
850 Ga0439439_0035734
851 Ga0450923_014886
852 Ga0439446_0007486
853 Ga0451577_0072495
854 Ga0466963_0341692
855 Ga0451576_0006121
856 Ga0451576_0704875
857 Ga0495603_0083206
858 Ga0495603_0117050
859 Ga0495629_0289820
860 Ga0495653_0183477
861 Ga0495653_0287573
862 Ga0495580_0035626
863 Ga0495608_0020498
864 Ga0495618_0047760
865 Ga0495628_0002852
866 Ga0495628_0267548
867 Ga0495630_0082301
868 Ga0495652_0185845
869 Ga0495640_0095495
870 Ga0495587_0228172
871 Ga0495621_0019080
872 Ga0495645_0018486
873 Ga0495645_0044147
874 Ga0495633_0069658
875 Ga0495667_0207691
876 Ga0495667_0331708
877 Ga0495635_0064854
878 Ga0495635_0134688
879 Ga0495623_0142699
880 Ga0495658_0086249
881 Ga0495658_0161999
882 Ga0495669_0002522
883 Ga0495669_0033369
884 Ga0495669_0062389
885 Ga0495624_0117665
886 Ga0495600_0082722
887 Ga0495604_0060989
888 Ga0495674_0008199
889 Ga0495674_0257601
890 Ga0495675_0215686
891 Ga0495684_0035082
892 Ga0496100_0000818
893 Ga0496100_0405699
894 Ga0496101_0001528
895 Ga0496102_0519855
896 Ga0496104_0005154
897 Ga0496104_0134640
898 Ga0496105_0072592
899 Ga0496106_0052493
900 Ga0496106_0248348
901 Ga0496106_0306113
902 Ga0496107_0271428
903 Ga0496107_0321870
904 Ga0496109_0121589
905 Ga0496109_0657733
906 Ga0496110_0053926
907 Ga0496110_0094846
908 Ga0496111_0317680
909 Ga0496112_0058711
910 Ga0496112_0111625
911 Ga0496113_0012232
912 Ga0496114_0000958
913 Ga0496114_0029520
914 Ga0496115_0440285
915 Ga0501031_0212232
916 Ga0501033_0107706
917 Ga0501036_0036270
918 Ga0501039_0015150
919 Ga0501040_0028437
920 Ga0501041_0022553
921 Ga0501042_0032237
922 Ga0501042_0033516
923 Ga0501042_0192080
924 Ga0501046_0007069
925 Ga0501047_0010713
926 Ga0501068_0081475
927 Ga0501071_0045068
928 Ga0501072_0060693
929 Ga0501073_0110839
930 Ga0501075_0012169
931 Ga0501075_0037308
932 Ga0501075_0271808
933 Ga0501076_0015882
934 Ga0501077_0168846
935 Ga0501261_007656
936 Ga0501079_0006744
937 Ga0501079_0146725
938 Ga0501083_0202884
939 Ga0501035_0300545
940 Ga0501045_0032570
941 Ga0501045_0047508
942 nmdc:mga06z11_225505_c1
943 nmdc:mga05p37_146720_c1
944 nmdc:mga05p37_236252_c1
945 nmdc:mga05p37_3190_c1
946 nmdc:mga05p37_39557_c1
947 nmdc:mga05p37_417818_c1
948 nmdc:mga05p37_4987_c1
949 nmdc:mga05p37_59330_c1
950 nmdc:mga05p37_91408_c1
951 nmdc:mga05p37_91504_c1
952 nmdc:mga05p37_99056_c1
953 nmdc:mga0qj67_291556_c1
954 nmdc:mga06r32_186899_c1
955 nmdc:mga08y16_10531_c1
956 nmdc:mga08y16_157332_c1
957 nmdc:mga08y16_17_c1
958 nmdc:mga08y16_52250_c1
959 nmdc:mga0n895_14185_c1
960 nmdc:mga0n895_184169_c1
961 nmdc:mga0n895_29803_c1
962 nmdc:mga0n895_309347_c1
963 nmdc:mga0n895_41949_c1
964 nmdc:mga0n895_78871_c1
965 nmdc:mga0rr50_10841_c1
966 nmdc:mga0rr50_166469_c1
967 nmdc:mga0rr50_194011_c1
968 nmdc:mga0rr50_24904_c1
969 nmdc:mga0rr50_27460_c1
970 nmdc:mga0rr50_28_c1
971 nmdc:mga0rr50_71989_c1
972 nmdc:mga08x19_163481_c1
973 nmdc:mga08x19_191460_c1
974 nmdc:mga08x19_235750_c1
975 nmdc:mga08x19_874_c1
976 nmdc:mga0a205_170011_c1
977 nmdc:mga0a205_188290_c1
978 nmdc:mga0a205_273270_c1
979 nmdc:mga0a205_367248_c1
980 nmdc:mga0a205_6507_c1
981 nmdc:mga0a205_77398_c1
982 nmdc:mga0a205_86881_c1
983 Ga0495601_0111736
984 Ga0495595_0012017
985 Ga0495619_0002018
986 Ga0495619_0008673
987 Ga0495619_0043883
988 Ga0495619_0046787
989 Ga0495619_0257127
990 Ga0500556_0043955
991 Ga0500658_0034922
992 Ga0501084_0020169
993 Ga0501084_0302905
994 Ga0501084_0437459
995 Ga0590071_000125
996 Ga0590077_001180
997 Ga0501082_0023130
998 Ga0530510_0023851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09674

DUF2400

Protein of unknown function (DUF2400)

32

267

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.6421 5 288
1rrq-assembly1.cif.gz_A muty adenine glycosylase in complex with dna containing an a:oxog pair 0.6404 13 288
8a5f-assembly1.cif.gz_A crystal structure of deinococcus radiodurans endonuclease iii-1 r61q variant 0.6288 5 286
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.6274 5 288
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.6204 5 288
ID Description Score Start End Superfamily
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.5402 47 158 1.10.340.30
af_Q58829_25_138_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.5256 39 171 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.5006 47 158 1.10.340.30
af_Q58829_25_138_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.4966 39 171 1.10.340.30
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.4861 38 159 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7W0HF73-F1-model_v4 TIGR02757 family protein 0.9922 11 256
AF-A0A3N5YYZ6-F1-model_v4 TIGR02757 family protein 0.9841 35 267
AF-A0A3N5GDJ4-F1-model_v4 DUF2400 family protein 0.9818 10 176
AF-A0A7V8WDA6-F1-model_v4 DUF2400 family protein 0.9812 108 289 GO:0003824
GO:0006281
AF-A0A7W0HF73-F1-model_v4 TIGR02757 family protein 0.9803 11 256

Map