metagRoot

F455355

General Info

Members	Datasets	Scaffolds	Average Seq Length
499	257	497	310

Family's Representative Sequence

Representative Sequence	3300007076\|Ga0075435_100119007\|Ga0075435_1001190072
Length	346
Sequence	VRVRREPRRRGVQALCVAAAAIVSAVSRSWSELLGEAHASPETEEERVGFLGRLRDSLSKSRRALTQQLAVAAFDPADEEAWERLEEALITADVGVPATAELVQRLEARGGLTTLDEPLAEELASLLGEPGTLDVSARPAVVLVVGVNGTGKTTTIGKLAAKLAGRGHSVLLAAADTFRAAAEEQLEAWAERAGADFVGSPRGGDPAAVAYDAIEAATARGRDVVIVDTAGRLHTQKNLMDELAKVRRVIAGRLDGAPQETLLVVDATTGQNGLQQARLFAEAVDVSGVVLTKLDGSAKGGIAVAIAHELGLPVTLVGVGEGLDDLRPFDPQDFARALVGSDPAGV

Samples

	Sample ID	Description	Type	Environment
1	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
2	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
3	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
4	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
5	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
6	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
7	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
8	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
16	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
22	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
23	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
24	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
25	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
28	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
29	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
30	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
31	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
32	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
33	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
34	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
35	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
36	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
37	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
38	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
39	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
40	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
41	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
42	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
43	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
44	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
45	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
46	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
47	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
48	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
49	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
50	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
51	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
52	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
53	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
54	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
55	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
56	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
57	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
59	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
60	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
61	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
62	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
63	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
64	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
65	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
66	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
67	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
68	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
69	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
70	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
71	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
72	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
73	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
74	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
75	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
76	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
77	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
78	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
118	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
121	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
122	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
123	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
124	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
125	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
126	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
127	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
128	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
129	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
130	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
131	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
132	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
133	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
134	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
135	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
136	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
137	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
138	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
139	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
140	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
141	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
142	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
143	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
144	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
145	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
146	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
147	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
148	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
149	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
150	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
151	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
152	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
153	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
154	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
155	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
156	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
157	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
158	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
159	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
160	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
161	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
162	3300042119	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902	Metagenome	Rhizosphere
163	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
164	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
165	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
166	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
167	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
168	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
169	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
170	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
171	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
172	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
173	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
174	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
175	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
176	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
177	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
178	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
179	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
180	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
181	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
182	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
183	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
184	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
185	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
186	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
187	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
188	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
189	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
190	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
191	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
192	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
193	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
194	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
195	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
196	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
197	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
198	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
199	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
200	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
201	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
202	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
203	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
204	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
205	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
206	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
207	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
208	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
209	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
210	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
211	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
212	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
213	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
214	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
215	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
216	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
217	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
218	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
242	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
243	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
244	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
245	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
246	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
247	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
248	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
249	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
252	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
253	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
254	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
255	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
256	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
257	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99
Metatranscriptomes	0.6
Isolates	0.4

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.6
Nodule	0
Rhizoplane	13.63
Rhizosphere	82.57
Stem	0
Stem Tuber	0
Unclassified	2.2

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25155J39150_1000388	3300002704	Bacteria	12532
2	JGI25156J39149_1000288	3300002705	Bacteria	33984
3	JGI25156J39149_1000503	3300002705	Bacteria	22887
4	JGI25154J39366_1000313	3300002738	Bacteria	28101
5	JGI25157J39369_1000171	3300002741	Bacteria	54600
6	JGI25407J50210_10013926	3300003373	Bacteria	2070
7	Ga0055532_1000044	3300003758	Bacteria	191110
8	Ga0070683_100001865	3300005329	Bacteria	16455
9	Ga0070683_100210102	3300005329	Bacteria	1849
10	Ga0070680_100059670	3300005336	Bacteria	3122
11	Ga0070680_100113779	3300005336	Bacteria	2254
12	Ga0070682_100006755	3300005337	Bacteria	6435
13	Ga0068868_100036272	3300005338	Bacteria	3816
14	Ga0070660_100003932	3300005339	Bacteria	10268
15	Ga0070691_10005067	3300005341	Bacteria	5987
16	Ga0070661_100052357	3300005344	Bacteria	2988
17	Ga0070661_100108277	3300005344	Bacteria	2073
18	Ga0070661_100322451	3300005344	Bacteria	1207
19	Ga0070692_10019149	3300005345	Bacteria	3301
20	Ga0070668_100020048	3300005347	Bacteria	5042
21	Ga0070659_100035682	3300005366	Bacteria	3873
22	Ga0070659_100194043	3300005366	Bacteria	1670
23	Ga0070714_100054544	3300005435	Bacteria	3414
24	Ga0070713_100087789	3300005436	Bacteria	2668
25	Ga0070713_100187540	3300005436	Bacteria	1862
26	Ga0070701_10018655	3300005438	Bacteria	3263
27	Ga0070705_100017478	3300005440	Bacteria	3744
28	Ga0070705_100049198	3300005440	Bacteria	2446
29	Ga0070705_100254996	3300005440	Bacteria	1234
30	Ga0070700_100046226	3300005441	Bacteria	2689
31	Ga0070678_100197012	3300005456	Bacteria	1660
32	Ga0070681_10009129	3300005458	Bacteria	9744
33	Ga0070681_10012178	3300005458	Bacteria	8529
34	Ga0070681_10059544	3300005458	Bacteria	3799
35	Ga0070685_10033162	3300005466	Bacteria	2898
36	Ga0070698_100057422	3300005471	Bacteria	3938
37	Ga0070698_100113402	3300005471	Bacteria	2676
38	Ga0070699_100056724	3300005518	Bacteria	3392
39	Ga0070679_100009003	3300005530	Bacteria	9416
40	Ga0070679_100156672	3300005530	Bacteria	2252
41	Ga0070679_100308041	3300005530	Bacteria	1534
42	Ga0070679_100374784	3300005530	Bacteria	1370
43	Ga0070679_100565993	3300005530	Bacteria	1080
44	Ga0070684_100000949	3300005535	Bacteria	20660
45	Ga0070684_100041439	3300005535	Bacteria	3970
46	Ga0070684_100081799	3300005535	Bacteria	2858
47	Ga0070684_100170301	3300005535	Bacteria	1978
48	Ga0070695_100148379	3300005545	Bacteria	1634
49	Ga0070696_100017590	3300005546	Bacteria	4826
50	Ga0070696_100274952	3300005546	Bacteria	1282
51	Ga0070693_100003702	3300005547	Bacteria	7149
52	Ga0070693_100179958	3300005547	Bacteria	1361
53	Ga0070704_100070403	3300005549	Bacteria	2538
54	Ga0070704_100156380	3300005549	Bacteria	1798
55	Ga0068855_100056008	3300005563	Bacteria	4628
56	Ga0068855_100136886	3300005563	Bacteria	2793
57	Ga0068855_100194046	3300005563	Bacteria	2289
58	Ga0070664_100006648	3300005564	Bacteria	9325
59	Ga0070664_100285133	3300005564	Bacteria	1490
60	Ga0068854_100066493	3300005578	Bacteria	2624
61	Ga0068854_100072411	3300005578	Bacteria	2523
62	Ga0068856_100035359	3300005614	Bacteria	4896
63	Ga0068852_100165969	3300005616	Bacteria	2066
64	Ga0068864_100081681	3300005618	Bacteria	2834
65	Ga0068861_100074439	3300005719	Bacteria	2641
66	Ga0068863_100426552	3300005841	Bacteria	1299
67	Ga0081455_10009850	3300005937	Bacteria	9787
68	Ga0081455_10039361	3300005937	Bacteria	4179
69	Ga0081455_10098827	3300005937	Bacteria	2349
70	Ga0081455_10104385	3300005937	Bacteria	2267
71	Ga0081455_10110902	3300005937	Bacteria	2180
72	Ga0081455_10207894	3300005937	Bacteria	1460
73	Ga0081538_10000012	3300005981	Bacteria	153046
74	Ga0081538_10000205	3300005981	Bacteria	65480
75	Ga0081538_10000732	3300005981	Bacteria	35860
76	Ga0081538_10001539	3300005981	Bacteria	23646
77	Ga0081538_10005748	3300005981	Bacteria	11080
78	Ga0081538_10031809	3300005981	Bacteria	3550
79	Ga0081540_1002684	3300005983	Bacteria	14473
80	Ga0081540_1002689	3300005983	Bacteria	14457
81	Ga0081540_1024608	3300005983	Bacteria	3490
82	Ga0081539_10011591	3300005985	Bacteria	6947
83	Ga0075365_10081831	3300006038	Bacteria	2189
84	Ga0075365_10112300	3300006038	Bacteria	1874
85	Ga0070715_10035388	3300006163	Bacteria	2053
86	Ga0075428_100008965	3300006844	Bacteria	11099
87	Ga0075428_100070313	3300006844	Bacteria	3826
88	Ga0075428_100405921	3300006844	Bacteria	1460
89	Ga0075431_100117943	3300006847	Bacteria	2739
90	Ga0075431_100420353	3300006847	Bacteria	1336
91	Ga0075433_10009678	3300006852	Bacteria	7715
92	Ga0075433_10083637	3300006852	Bacteria	2817
93	Ga0075433_10085835	3300006852	Bacteria	2779
94	Ga0075434_100000243	3300006871	Bacteria	38048
95	Ga0075434_100092643	3300006871	Bacteria	3025
96	Ga0075434_100380855	3300006871	Bacteria	1431
97	Ga0075436_100015134	3300006914	Bacteria	5287
98	Ga0075436_100038736	3300006914	Bacteria	3290
99	Ga0075435_100002589	3300007076	Bacteria	12066
100	Ga0075435_100119007	3300007076	Bacteria	2203
101	Ga0111539_10028671	3300009094	Bacteria	6789
102	Ga0111539_10034827	3300009094	Bacteria	6100
103	Ga0111539_10109917	3300009094	Bacteria	3235
104	Ga0111539_10146531	3300009094	Bacteria	2764
105	Ga0105245_10018728	3300009098	Bacteria	6057
106	Ga0105245_10031800	3300009098	Bacteria	4672
107	Ga0114129_10000306	3300009147	Bacteria	57109
108	Ga0114129_10495658	3300009147	Bacteria	1596
109	Ga0114129_10548668	3300009147	Bacteria	1503
110	Ga0105243_10011508	3300009148	Bacteria	6695
111	Ga0105242_10248393	3300009176	Bacteria	1602
112	Ga0105242_10348907	3300009176	Bacteria	1366
113	Ga0105249_10018217	3300009553	Bacteria	6242
114	Ga0105249_10298228	3300009553	Bacteria	1615
115	Ga0105239_10071321	3300010375	Bacteria	3817
116	Ga0105239_10127363	3300010375	Bacteria	2831
117	Ga0105246_10069289	3300011119	Bacteria	2477
118	Ga0105246_10070394	3300011119	Bacteria	2460
119	Ga0163162_10135063	3300013306	Bacteria	2577
120	Ga0157375_10290974	3300013308	Bacteria	1797
121	Ga0157375_10393334	3300013308	Bacteria	1553
122	Ga0163163_10108886	3300014325	Bacteria	2798
123	Ga0182008_10132782	3300014497	Bacteria	1242
124	Ga0157376_10312358	3300014969	Bacteria	1491
125	Ga0163161_10203595	3300017792	Bacteria	1526
126	Ga0206354_11162916	3300020081	Bacteria	1526
127	Ga0206353_10114056	3300020082	Bacteria	2920
128	Ga0209435_100004	3300025206	Bacteria	633417
129	Ga0209147_100011	3300025229	Bacteria	702140
130	Ga0209258_100279	3300025242	Bacteria	86008
131	Ga0209646_1000140	3300025246	Bacteria	111155
132	Ga0209026_1000066	3300025250	Bacteria	207691
133	Ga0209759_1000114	3300025256	Bacteria	142233
134	Ga0209455_1001794	3300025272	Bacteria	9049
135	Ga0207656_10084755	3300025321	Bacteria	1430
136	Ga0207643_10020870	3300025908	Bacteria	3595
137	Ga0207654_10039839	3300025911	Bacteria	2645
138	Ga0207707_10056896	3300025912	Bacteria	3404
139	Ga0207707_10096396	3300025912	Bacteria	2585
140	Ga0207707_10130066	3300025912	Bacteria	2202
141	Ga0207707_10227453	3300025912	Bacteria	1623
142	Ga0207693_10016507	3300025915	Bacteria	5899
143	Ga0207693_10016567	3300025915	Bacteria	5888
144	Ga0207663_10391946	3300025916	Bacteria	1060
145	Ga0207660_10041959	3300025917	Bacteria	3209
146	Ga0207660_10157006	3300025917	Bacteria	1752
147	Ga0207657_10006843	3300025919	Bacteria	11761
148	Ga0207657_10015818	3300025919	Bacteria	7292
149	Ga0207649_10157880	3300025920	Bacteria	1569
150	Ga0207652_10044799	3300025921	Bacteria	3770
151	Ga0207652_10234658	3300025921	Bacteria	1653
152	Ga0207687_10010926	3300025927	Bacteria	5933
153	Ga0207687_10011630	3300025927	Bacteria	5752
154	Ga0207687_10041296	3300025927	Bacteria	3166
155	Ga0207700_10061255	3300025928	Bacteria	2853
156	Ga0207700_10092100	3300025928	Bacteria	2396
157	Ga0207700_10183660	3300025928	Bacteria	1753
158	Ga0207664_10431113	3300025929	Bacteria	1175
159	Ga0207644_10283068	3300025931	Bacteria	1332
160	Ga0207690_10019527	3300025932	Bacteria	4176
161	Ga0207706_10022121	3300025933	Bacteria	5707
162	Ga0207686_10044602	3300025934	Bacteria	2724
163	Ga0207669_10318236	3300025937	Bacteria	1190
164	Ga0207665_10001017	3300025939	Bacteria	18936
165	Ga0207689_10269518	3300025942	Bacteria	1410
166	Ga0207661_10004931	3300025944	Bacteria	9358
167	Ga0207679_10003601	3300025945	Bacteria	9609
168	Ga0207679_10186380	3300025945	Bacteria	1721
169	Ga0207667_10335834	3300025949	Bacteria	1542
170	Ga0207651_10116944	3300025960	Bacteria	2014
171	Ga0207712_10032630	3300025961	Bacteria	3515
172	Ga0207712_10189941	3300025961	Bacteria	1621
173	Ga0207668_10057406	3300025972	Bacteria	2715
174	Ga0207668_10087404	3300025972	Bacteria	2280
175	Ga0207640_10072021	3300025981	Bacteria	2330
176	Ga0207677_10032262	3300026023	Bacteria	3365
177	Ga0207639_10200590	3300026041	Bacteria	1711
178	Ga0207678_10007838	3300026067	Bacteria	9426
179	Ga0207708_10009965	3300026075	Bacteria	7057
180	Ga0207708_10074014	3300026075	Bacteria	2611
181	Ga0207702_10008481	3300026078	Bacteria	8666
182	Ga0207702_10304899	3300026078	Bacteria	1512
183	Ga0207702_10478368	3300026078	Bacteria	1212
184	Ga0207641_10335612	3300026088	Bacteria	1437
185	Ga0207648_10053071	3300026089	Bacteria	3544
186	Ga0207648_10302959	3300026089	Bacteria	1433
187	Ga0207676_10144146	3300026095	Bacteria	2043
188	Ga0207675_100001579	3300026118	Bacteria	22778
189	Ga0207675_100007009	3300026118	Bacteria	10658
190	Ga0207675_100095043	3300026118	Bacteria	2804
191	Ga0207683_10237910	3300026121	Bacteria	1661
192	Ga0207683_10303945	3300026121	Bacteria	1460
193	Ga0207698_10027324	3300026142	Bacteria	4049
194	Ga0209966_1004668	3300027695	Bacteria	2328
195	Ga0207428_10005386	3300027907	Bacteria	11939
196	Ga0207428_10016091	3300027907	Bacteria	6444
197	Ga0207428_10118645	3300027907	Bacteria	2030
198	Ga0268265_10030805	3300028380	Bacteria	3868
199	Ga0268264_10446471	3300028381	Bacteria	1252
200	Ga0265326_10013267	3300028558	Bacteria	2413
201	Ga0265319_1003514	3300028563	Bacteria	8143
202	Ga0265319_1034147	3300028563	Bacteria	1752
203	Ga0265334_10001551	3300028573	Bacteria	11056
204	Ga0265334_10026404	3300028573	Bacteria	2345
205	Ga0265318_10000752	3300028577	Bacteria	21581
206	Ga0265318_10028073	3300028577	Bacteria	2204
207	Ga0265322_10001804	3300028654	Bacteria	6786
208	Ga0265336_10032742	3300028666	Bacteria	1612
209	Ga0265338_10003362	3300028800	Bacteria	22582
210	Ga0265338_10003630	3300028800	Bacteria	21488
211	Ga0265338_10074038	3300028800	Bacteria	2899
212	Ga0265338_10115844	3300028800	Bacteria	2148
213	Ga0265324_10019038	3300029957	Bacteria	2475
214	Ga0265330_10005773	3300031235	Bacteria	6143
215	Ga0265332_10001967	3300031238	Bacteria	10819
216	Ga0265332_10037195	3300031238	Bacteria	2112
217	Ga0265328_10001176	3300031239	Bacteria	12107
218	Ga0265325_10000754	3300031241	Bacteria	23431
219	Ga0265329_10000312	3300031242	Bacteria	25792
220	Ga0265340_10004408	3300031247	Bacteria	7874
221	Ga0265340_10019508	3300031247	Bacteria	3492
222	Ga0265340_10080854	3300031247	Bacteria	1530
223	Ga0265339_10003846	3300031249	Bacteria	10418
224	Ga0265339_10013058	3300031249	Bacteria	5045
225	Ga0265331_10006670	3300031250	Bacteria	6782
226	Ga0265331_10026102	3300031250	Bacteria	2942
227	Ga0265327_10004389	3300031251	Bacteria	12519
228	Ga0265327_10021924	3300031251	Bacteria	3837
229	Ga0265327_10044258	3300031251	Bacteria	2376
230	Ga0265327_10094387	3300031251	Bacteria	1454
231	Ga0265316_10002465	3300031344	Bacteria	19197
232	Ga0265316_10005704	3300031344	Bacteria	12036
233	Ga0265316_10006899	3300031344	Bacteria	10777
234	Ga0265316_10028920	3300031344	Bacteria	4564
235	Ga0265316_10119732	3300031344	Bacteria	1989
236	Ga0307408_100380696	3300031548	Bacteria	1206
237	Ga0265313_10001277	3300031595	Bacteria	23843
238	Ga0265313_10001578	3300031595	Bacteria	21129
239	Ga0265314_10004653	3300031711	Bacteria	12615
240	Ga0265314_10014089	3300031711	Bacteria	6420
241	Ga0265314_10021169	3300031711	Bacteria	5007
242	Ga0265314_10101677	3300031711	Bacteria	1846
243	Ga0265342_10006994	3300031712	Bacteria	8333
244	Ga0265342_10007930	3300031712	Bacteria	7701
245	Ga0265342_10042561	3300031712	Bacteria	2743
246	Ga0307410_10188076	3300031852	Bacteria	1568
247	Ga0307409_100304534	3300031995	Bacteria	1484
248	Ga0307411_10260831	3300032005	Bacteria	1368
249	Ga0316593_10035544	3300032168	Bacteria	1640
250	Ga0373948_0038229	3300034817	Bacteria	995
251	Ga0373945_0045222	3300035116	Bacteria	1603
252	Ga0373943_0008773	3300035170	Bacteria	4529
253	Ga0373946_0021194	3300035171	Bacteria	2518
254	Ga0373962_0024128	3300035242	Bacteria	1624
255	Ga0373927_0212424	3300035695	Bacteria	1271
256	Ga0373947_0007289	3300035725	Bacteria	6406
257	Ga0373937_0040507	3300036401	Bacteria	4246
258	Ga0373937_0316047	3300036401	Bacteria	1477
259	Ga0395899_0001925	3300037312	Bacteria	17111
260	Ga0395899_0003213	3300037312	Bacteria	12958
261	Ga0395899_0004943	3300037312	Bacteria	10373
262	Ga0395899_0047873	3300037312	Bacteria	3182
263	Ga0395899_0112472	3300037312	Bacteria	1956
264	Ga0395900_0012832	3300037418	Bacteria	8562
265	Ga0395900_0016706	3300037418	Bacteria	7486
266	Ga0395898_0002942	3300037466	Bacteria	19375
267	Ga0395898_0004451	3300037466	Bacteria	15315
268	Ga0395898_0005381	3300037466	Bacteria	13834
269	Ga0395898_0077983	3300037466	Bacteria	3197
270	Ga0395905_0000212	3300037471	Bacteria	89838
271	Ga0395905_0000960	3300037471	Bacteria	37034
272	Ga0395905_0017672	3300037471	Bacteria	6769
273	Ga0395905_0017965	3300037471	Bacteria	6715
274	Ga0395905_0020954	3300037471	Bacteria	6190
275	Ga0395905_0068089	3300037471	Bacteria	3335
276	Ga0395905_0513526	3300037471	Bacteria	1098
277	Ga0395901_0003244	3300038443	Bacteria	16363
278	Ga0395901_0005249	3300038443	Bacteria	13080
279	Ga0395901_0005887	3300038443	Bacteria	12407
280	Ga0395901_0022437	3300038443	Bacteria	6469
281	Ga0395901_0031577	3300038443	Bacteria	5460
282	Ga0395901_0280561	3300038443	Bacteria	1731
283	Ga0395901_0281974	3300038443	Bacteria	1726
284	Ga0395901_0380662	3300038443	Bacteria	1452
285	Ga0395901_0381028	3300038443	Bacteria	1451
286	Ga0395901_0394673	3300038443	Bacteria	1422
287	Ga0439448_0075158	3300042005	Bacteria	1129
288	Ga0439451_007125	3300042009	Bacteria	2285
289	Ga0439463_047033	3300042016	Bacteria	1099
290	Ga0450915_000183	3300042119	Bacteria	1813
291	Ga0439458_0007312	3300042157	Bacteria	2458
292	Ga0450893_0003629	3300042532	Bacteria	2436
293	Ga0466969_0050356	3300044656	Bacteria	2053
294	Ga0466966_0056795	3300044684	Bacteria	2475
295	Ga0466961_0156470	3300044693	Bacteria	1421
296	Ga0466963_0003590	3300044694	Bacteria	8917
297	Ga0466963_0048519	3300044694	Bacteria	2806
298	Ga0466963_0263505	3300044694	Bacteria	1210
299	Ga0466964_0000279	3300044706	Bacteria	14888
300	Ga0466964_0033138	3300044706	Bacteria	2057
301	Ga0466971_0041508	3300044719	Bacteria	2066
302	Ga0466957_0138180	3300044842	Bacteria	1568
303	Ga0466959_0068394	3300045049	Bacteria	2573
304	Ga0451576_0186135	3300045051	Bacteria	2168
305	Ga0466958_0016911	3300045836	Bacteria	4208
306	Ga0466967_0000086	3300045976	Bacteria	34116
307	Ga0466967_0002111	3300045976	Bacteria	12196
308	Ga0466967_0003772	3300045976	Bacteria	10002
309	Ga0466967_0022598	3300045976	Bacteria	5136
310	Ga0466967_0029931	3300045976	Bacteria	4563
311	Ga0466967_0085687	3300045976	Bacteria	2853
312	Ga0466967_0128330	3300045976	Bacteria	2351
313	Ga0466967_0213323	3300045976	Bacteria	1832
314	Ga0495603_0002705	3300046455	Bacteria	10444
315	Ga0495629_0211328	3300046459	Bacteria	1340
316	Ga0495651_0036441	3300046462	Bacteria	3830
317	Ga0495653_0024543	3300046463	Bacteria	4857
318	Ga0495653_0097010	3300046463	Bacteria	2142
319	Ga0495582_0152464	3300046473	Bacteria	1312
320	Ga0495585_0114715	3300046492	Bacteria	1430
321	Ga0495608_0071040	3300046511	Bacteria	2271
322	Ga0495608_0101207	3300046511	Bacteria	1858
323	Ga0495618_0199938	3300046514	Bacteria	1265
324	Ga0495630_0150043	3300046517	Bacteria	1773
325	Ga0495652_0208882	3300046529	Bacteria	1476
326	Ga0495586_0008192	3300046535	Bacteria	5570
327	Ga0495587_0013006	3300046536	Bacteria	5234
328	Ga0495609_0024554	3300046538	Bacteria	2765
329	Ga0495667_0084256	3300046559	Bacteria	2064
330	Ga0495656_0054104	3300046615	Bacteria	1726
331	Ga0495635_0135925	3300046663	Bacteria	1676
332	Ga0495657_0204106	3300046675	Bacteria	1203
333	Ga0495646_0046293	3300046680	Bacteria	2653
334	Ga0495647_0024494	3300046681	Bacteria	2197
335	Ga0495658_0246821	3300046683	Bacteria	1122
336	Ga0495613_0080724	3300046689	Bacteria	2364
337	Ga0495604_0054893	3300047317	Bacteria	3072
338	Ga0495604_0140375	3300047317	Bacteria	1727
339	Ga0495674_0328179	3300047319	Bacteria	1245
340	Ga0495676_0044785	3300047321	Bacteria	3608
341	Ga0495676_0279372	3300047321	Bacteria	1131
342	Ga0495680_0028249	3300047322	Bacteria	4600
343	Ga0495684_0036068	3300047471	Bacteria	3791
344	Ga0496100_0007587	3300048903	Bacteria	5995
345	Ga0496100_0071679	3300048903	Bacteria	2314
346	Ga0496101_0024232	3300048904	Bacteria	4198
347	Ga0496101_0032772	3300048904	Bacteria	3660
348	Ga0496101_0063932	3300048904	Bacteria	2680
349	Ga0496101_0083666	3300048904	Bacteria	2362
350	Ga0496101_0159156	3300048904	Bacteria	1731
351	Ga0496101_0252554	3300048904	Bacteria	1374
352	Ga0496102_0008381	3300048905	Bacteria	8853
353	Ga0496102_0041519	3300048905	Bacteria	4165
354	Ga0496102_0162880	3300048905	Bacteria	2098
355	Ga0496103_0003994	3300048906	Bacteria	8960
356	Ga0496103_0016198	3300048906	Bacteria	4448
357	Ga0496103_0184564	3300048906	Bacteria	1341
358	Ga0496104_0001085	3300048907	Bacteria	23243
359	Ga0496104_0008530	3300048907	Bacteria	9109
360	Ga0496104_0064121	3300048907	Bacteria	3486
361	Ga0496104_0134465	3300048907	Bacteria	2375
362	Ga0496104_0300808	3300048907	Bacteria	1516
363	Ga0496105_0000401	3300048908	Bacteria	28464
364	Ga0496105_0001381	3300048908	Bacteria	17045
365	Ga0496105_0019075	3300048908	Bacteria	5528
366	Ga0496105_0176508	3300048908	Bacteria	1750
367	Ga0496106_0010484	3300048909	Bacteria	6844
368	Ga0496106_0035691	3300048909	Bacteria	3718
369	Ga0496106_0049451	3300048909	Bacteria	3167
370	Ga0496106_0167458	3300048909	Bacteria	1740
371	Ga0496107_0005558	3300048910	Bacteria	8634
372	Ga0496107_0020586	3300048910	Bacteria	4661
373	Ga0496107_0072340	3300048910	Bacteria	2506
374	Ga0496107_0100684	3300048910	Bacteria	2118
375	Ga0496107_0141246	3300048910	Bacteria	1780
376	Ga0496107_0333078	3300048910	Bacteria	1129
377	Ga0496108_0007445	3300048911	Bacteria	8873
378	Ga0496108_0019915	3300048911	Bacteria	5511
379	Ga0496108_0109238	3300048911	Bacteria	2363
380	Ga0496109_0000487	3300048912	Bacteria	33924
381	Ga0496109_0043688	3300048912	Bacteria	4062
382	Ga0496109_0147838	3300048912	Bacteria	2199
383	Ga0496109_0184797	3300048912	Bacteria	1958
384	Ga0496109_0303166	3300048912	Bacteria	1507
385	Ga0496109_0308619	3300048912	Bacteria	1492
386	Ga0496110_0000382	3300048913	Bacteria	29798
387	Ga0496110_0000826	3300048913	Bacteria	21737
388	Ga0496110_0016611	3300048913	Bacteria	6146
389	Ga0496110_0142326	3300048913	Bacteria	2168
390	Ga0496111_0000277	3300048914	Bacteria	24931
391	Ga0496111_0000503	3300048914	Bacteria	20219
392	Ga0496111_0006656	3300048914	Bacteria	7517
393	Ga0496111_0119490	3300048914	Bacteria	1946
394	Ga0496111_0292126	3300048914	Bacteria	1209
395	Ga0496112_0000831	3300048915	Bacteria	21961
396	Ga0496112_0028010	3300048915	Bacteria	5435
397	Ga0496112_0046391	3300048915	Bacteria	4262
398	Ga0496112_0065009	3300048915	Bacteria	3600
399	Ga0496112_0076370	3300048915	Bacteria	3313
400	Ga0496112_0115841	3300048915	Bacteria	2650
401	Ga0496113_0001539	3300048916	Bacteria	12917
402	Ga0496113_0053006	3300048916	Bacteria	3032
403	Ga0496113_0054884	3300048916	Bacteria	2985
404	Ga0496113_0133848	3300048916	Bacteria	1947
405	Ga0496113_0342039	3300048916	Bacteria	1200
406	Ga0496113_0345694	3300048916	Bacteria	1193
407	Ga0496114_0001239	3300048917	Bacteria	19299
408	Ga0496114_0067492	3300048917	Bacteria	3000
409	Ga0496115_0018691	3300048918	Bacteria	5328
410	Ga0496115_0085828	3300048918	Bacteria	2568
411	Ga0496115_0185382	3300048918	Bacteria	1719
412	Ga0501031_0007362	3300049568	Bacteria	7173
413	Ga0501031_0011048	3300049568	Bacteria	5884
414	Ga0501031_0142724	3300049568	Bacteria	1565
415	Ga0501036_0002190	3300049572	Bacteria	15260
416	Ga0501036_0034836	3300049572	Bacteria	4259
417	Ga0501038_0004572	3300049574	Bacteria	12877
418	Ga0501039_0095807	3300049575	Bacteria	2314
419	Ga0501039_0152307	3300049575	Bacteria	1816
420	Ga0501040_0002822	3300049576	Bacteria	11209
421	Ga0501040_0005591	3300049576	Bacteria	8126
422	Ga0501041_0015528	3300049577	Bacteria	4523
423	Ga0501042_0006558	3300049578	Bacteria	7566
424	Ga0501042_0048723	3300049578	Bacteria	3021
425	Ga0501042_0075742	3300049578	Bacteria	2408
426	Ga0501046_0028115	3300049580	Bacteria	4582
427	Ga0501046_0156860	3300049580	Bacteria	1714
428	Ga0501046_0167305	3300049580	Bacteria	1651
429	Ga0501048_0001463	3300049582	Bacteria	17915
430	Ga0501048_0117320	3300049582	Bacteria	1880
431	Ga0501067_0002079	3300049583	Bacteria	11026
432	Ga0501068_0007767	3300049584	Bacteria	5941
433	Ga0501069_0001947	3300049585	Bacteria	10307
434	Ga0501070_0032717	3300049586	Bacteria	4351
435	Ga0501070_0038219	3300049586	Bacteria	4005
436	Ga0501071_0008807	3300049587	Bacteria	6685
437	Ga0501071_0015172	3300049587	Bacteria	5284
438	Ga0501072_0010356	3300049588	Bacteria	7105
439	Ga0501072_0036513	3300049588	Bacteria	3852
440	Ga0501075_0022830	3300049591	Bacteria	4575
441	Ga0501075_0048675	3300049591	Bacteria	3185
442	Ga0501075_0116319	3300049591	Bacteria	2033
443	Ga0501076_0015569	3300049592	Bacteria	5752
444	Ga0501076_0075747	3300049592	Bacteria	2697
445	Ga0501077_0007485	3300049593	Bacteria	6738
446	Ga0501077_0021134	3300049593	Bacteria	4118
447	Ga0501077_0034901	3300049593	Bacteria	3201
448	Ga0501079_0017853	3300049741	Bacteria	5419
449	Ga0501079_0023106	3300049741	Bacteria	4773
450	Ga0501079_0031596	3300049741	Bacteria	4070
451	Ga0501079_0041793	3300049741	Bacteria	3540
452	Ga0501079_0090942	3300049741	Bacteria	2365
453	Ga0501079_0607980	3300049741	Bacteria	860
454	Ga0501080_0002379	3300049742	Bacteria	16405
455	Ga0501080_0004400	3300049742	Bacteria	12519
456	Ga0501083_0016716	3300049744	Bacteria	5127
457	Ga0501083_0053239	3300049744	Bacteria	2717
458	Ga0501035_0015276	3300049822	Bacteria	7086
459	Ga0501044_0167347	3300049823	Bacteria	2172
460	Ga0501044_0442264	3300049823	Bacteria	1208
461	Ga0501045_0006576	3300049824	Bacteria	8051
462	Ga0501045_0018783	3300049824	Bacteria	4920
463	Ga0501045_0205074	3300049824	Bacteria	1469
464	nmdc:mga0yw44_95770_c1	3300050492	Bacteria	1883
465	nmdc:mga05p37_171171_c1	3300050507	Bacteria	2648
466	nmdc:mga05p37_258692_c1	3300050507	Bacteria	2084
467	nmdc:mga05p37_9_c1	3300050507	Bacteria	151480
468	nmdc:mga09592_359328_c1	3300050508	Bacteria	1260
469	nmdc:mga09592_483358_c1	3300050508	Bacteria	1067
470	nmdc:mga09592_5244_c1	3300050508	Bacteria	10529
471	nmdc:mga06r32_120145_c1	3300050510	Bacteria	2591
472	nmdc:mga08y16_15415_c1	3300050511	Bacteria	8038
473	nmdc:mga08y16_51051_c1	3300050511	Bacteria	4326
474	nmdc:mga0n895_176991_c1	3300050512	Bacteria	2164
475	nmdc:mga0n895_207965_c1	3300050512	Bacteria	1987
476	nmdc:mga0n895_492_c1	3300050512	Bacteria	26770
477	nmdc:mga0rr50_33053_c1	3300050513	Bacteria	3693
478	nmdc:mga0rr50_50016_c1	3300050513	Bacteria	3096
479	nmdc:mga08x19_41028_c1	3300050514	Bacteria	2947
480	nmdc:mga0a205_154997_c1	3300050515	Bacteria	2189
481	nmdc:mga0a205_172104_c1	3300050515	Bacteria	2061
482	nmdc:mga0a205_24596_c1	3300050515	Bacteria	5730
483	nmdc:mga0a205_55214_c1	3300050515	Bacteria	3837
484	Ga0495595_0003395	3300053084	Bacteria	6327
485	Ga0495619_0139561	3300053085	Bacteria	1668
486	Ga0500593_005689	3300053117	Bacteria	4936
487	Ga0501084_0040655	3300054114	Bacteria	3890
488	Ga0501084_0124669	3300054114	Bacteria	2167
489	Ga0501082_0024990	3300060353	Bacteria	5146
490	Ga0501082_0046641	3300060353	Bacteria	3734
491	Ga0501082_0098423	3300060353	Bacteria	2529
492	Ga0501082_0124367	3300060353	Bacteria	2237
493	Ga0501082_0207725	3300060353	Bacteria	1704
494	Ga0466962_0003630	3300061719	Bacteria	7359
495	Ga0530510_0029180	3300061734	Bacteria	3958
496	Ga0530510_0039910	3300061734	Bacteria	3388
497	Ga0530510_0274967	3300061734	Bacteria	1257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049741	Ga0501079_0607980	Ga0501079_0607980_73_837	251
2	3300009094	Ga0111539_10034827	Ga0111539_100348276	258
3	3300027907	Ga0207428_10016091	Ga0207428_100160912	260
4	3300050508	nmdc:mga09592_5244_c1	nmdc:mga09592_5244_c1_2624_3571	260
5	3300005937	Ga0081455_10207894	Ga0081455_102078942	262
6	3300042119	Ga0450915_000183	Ga0450915_000183_242_1189	265
7	3300028573	Ga0265334_10026404	Ga0265334_100264042	269
8	3300028800	Ga0265338_10115844	Ga0265338_101158442	269
9	3300031251	Ga0265327_10044258	Ga0265327_100442582	269
10	3300031344	Ga0265316_10002465	Ga0265316_1000246515	269
11	3300031595	Ga0265313_10001277	Ga0265313_1000127713	269
12	3300037312	Ga0395899_0112472	Ga0395899_0112472_472_1422	269
13	3300037466	Ga0395898_0077983	Ga0395898_0077983_847_1797	269
14	3300005981	Ga0081538_10001539	Ga0081538_100015397	270
15	3300036401	Ga0373937_0316047	Ga0373937_0316047_176_1114	270
16	3300046459	Ga0495629_0211328	Ga0495629_0211328_147_1085	270
17	3300046463	Ga0495653_0097010	Ga0495653_0097010_45_983	270
18	3300046511	Ga0495608_0071040	Ga0495608_0071040_1007_1945	270
19	3300046514	Ga0495618_0199938	Ga0495618_0199938_184_1122	270
20	3300046517	Ga0495630_0150043	Ga0495630_0150043_141_1079	270
21	3300046536	Ga0495587_0013006	Ga0495587_0013006_2643_3581	270
22	3300046663	Ga0495635_0135925	Ga0495635_0135925_13_951	270
23	3300046675	Ga0495657_0204106	Ga0495657_0204106_107_1045	270
24	3300046680	Ga0495646_0046293	Ga0495646_0046293_1644_2582	270
25	3300047317	Ga0495604_0054893	Ga0495604_0054893_690_1628	270
26	3300047319	Ga0495674_0328179	Ga0495674_0328179_118_1056	270
27	3300047322	Ga0495680_0028249	Ga0495680_0028249_898_1836	270
28	3300053084	Ga0495595_0003395	Ga0495595_0003395_2942_3880	270
29	3300053085	Ga0495619_0139561	Ga0495619_0139561_322_1260	270
30	3300005336	Ga0070680_100059670	Ga0070680_1000596702	272
31	3300005338	Ga0068868_100036272	Ga0068868_1000362722	272
32	3300005344	Ga0070661_100052357	Ga0070661_1000523571	272
33	3300005456	Ga0070678_100197012	Ga0070678_1001970122	272
34	3300005458	Ga0070681_10009129	Ga0070681_100091292	272
35	3300005530	Ga0070679_100009003	Ga0070679_10000900312	272
36	3300005535	Ga0070684_100000949	Ga0070684_1000009495	272
37	3300005547	Ga0070693_100003702	Ga0070693_1000037022	272
38	3300005564	Ga0070664_100285133	Ga0070664_1002851332	272
39	3300005614	Ga0068856_100035359	Ga0068856_1000353592	272
40	3300005937	Ga0081455_10104385	Ga0081455_101043854	272
41	3300009098	Ga0105245_10018728	Ga0105245_100187288	272
42	3300009176	Ga0105242_10248393	Ga0105242_102483932	272
43	3300025912	Ga0207707_10056896	Ga0207707_100568962	272
44	3300025927	Ga0207687_10010926	Ga0207687_100109262	272
45	3300025934	Ga0207686_10044602	Ga0207686_100446022	272
46	3300025945	Ga0207679_10186380	Ga0207679_101863802	272
47	3300026023	Ga0207677_10032262	Ga0207677_100322621	272
48	3300026121	Ga0207683_10237910	Ga0207683_102379102	272
49	3300028563	Ga0265319_1034147	Ga0265319_10341472	272
50	3300031344	Ga0265316_10119732	Ga0265316_101197322	272
51	3300048910	Ga0496107_0333078	Ga0496107_0333078_69_1034	272
52	3300048917	Ga0496114_0067492	Ga0496114_0067492_1397_2362	272
53	3300048918	Ga0496115_0018691	Ga0496115_0018691_3243_4208	272
54	3300026078	Ga0207702_10008481	Ga0207702_100084814	273
55	3300028654	Ga0265322_10001804	Ga0265322_100018046	273
56	3300028800	Ga0265338_10003362	Ga0265338_100033623	273
57	3300031235	Ga0265330_10005773	Ga0265330_100057733	273
58	3300031238	Ga0265332_10037195	Ga0265332_100371952	273
59	3300031247	Ga0265340_10019508	Ga0265340_100195082	273
60	3300031250	Ga0265331_10026102	Ga0265331_100261023	273
61	3300031251	Ga0265327_10004389	Ga0265327_1000438914	273
62	3300031711	Ga0265314_10004653	Ga0265314_1000465314	273
63	3300031712	Ga0265342_10006994	Ga0265342_1000699410	273
64	3300037471	Ga0395905_0068089	Ga0395905_0068089_1079_2029	273
65	3300038443	Ga0395901_0280561	Ga0395901_0280561_488_1438	273
66	3300048915	Ga0496112_0076370	Ga0496112_0076370_1313_2263	273
67	3300048916	Ga0496113_0054884	Ga0496113_0054884_734_1684	273
68	3300005336	Ga0070680_100113779	Ga0070680_1001137792	274
69	3300005337	Ga0070682_100006755	Ga0070682_1000067552	274
70	3300005339	Ga0070660_100003932	Ga0070660_1000039324	274
71	3300005344	Ga0070661_100108277	Ga0070661_1001082771	274
72	3300005366	Ga0070659_100035682	Ga0070659_1000356822	274
73	3300005458	Ga0070681_10012178	Ga0070681_100121784	274
74	3300005530	Ga0070679_100156672	Ga0070679_1001566722	274
75	3300020081	Ga0206354_11162916	Ga0206354_111629161	274
76	3300020082	Ga0206353_10114056	Ga0206353_101140562	274
77	3300025912	Ga0207707_10096396	Ga0207707_100963963	274
78	3300025917	Ga0207660_10041959	Ga0207660_100419592	274
79	3300025919	Ga0207657_10006843	Ga0207657_100068432	274
80	3300025920	Ga0207649_10157880	Ga0207649_101578801	274
81	3300025921	Ga0207652_10044799	Ga0207652_100447992	274
82	3300025932	Ga0207690_10019527	Ga0207690_100195274	274
83	3300048907	Ga0496104_0064121	Ga0496104_0064121_100_1050	274
84	3300048912	Ga0496109_0308619	Ga0496109_0308619_228_1178	274
85	3300048915	Ga0496112_0028010	Ga0496112_0028010_2241_3191	274
86	3300049568	Ga0501031_0142724	Ga0501031_0142724_13_966	274
87	3300049578	Ga0501042_0048723	Ga0501042_0048723_1702_2655	274
88	3300049588	Ga0501072_0010356	Ga0501072_0010356_521_1474	274
89	3300049591	Ga0501075_0022830	Ga0501075_0022830_891_1844	274
90	3300049592	Ga0501076_0015569	Ga0501076_0015569_1647_2600	274
91	3300049741	Ga0501079_0031596	Ga0501079_0031596_776_1729	274
92	3300049741	Ga0501079_0090942	Ga0501079_0090942_199_1152	274
93	3300049823	Ga0501044_0442264	Ga0501044_0442264_21_974	274
94	3300060353	Ga0501082_0098423	Ga0501082_0098423_858_1811	274
95	3300061734	Ga0530510_0039910	Ga0530510_0039910_1898_2851	274
96	3300005436	Ga0070713_100187540	Ga0070713_1001875403	275
97	3300006871	Ga0075434_100092643	Ga0075434_1000926431	275
98	3300009147	Ga0114129_10548668	Ga0114129_105486681	275
99	3300025928	Ga0207700_10092100	Ga0207700_100921002	275
100	3300044694	Ga0466963_0263505	Ga0466963_0263505_58_1011	275
101	3300050507	nmdc:mga05p37_171171_c1	nmdc:mga05p37_171171_c1_172_1122	275
102	3300050512	nmdc:mga0n895_176991_c1	nmdc:mga0n895_176991_c1_272_1222	275
103	3300050514	nmdc:mga08x19_41028_c1	nmdc:mga08x19_41028_c1_52_1005	275
104	3300025912	Ga0207707_10130066	Ga0207707_101300662	276
105	3300006038	Ga0075365_10081831	Ga0075365_100818313	277
106	3300028666	Ga0265336_10032742	Ga0265336_100327422	280
107	3300031711	Ga0265314_10021169	Ga0265314_100211693	280
108	3300038443	Ga0395901_0031577	Ga0395901_0031577_1047_1985	280
109	3300006844	Ga0075428_100070313	Ga0075428_1000703132	281
110	3300006852	Ga0075433_10085835	Ga0075433_100858353	281
111	3300006914	Ga0075436_100015134	Ga0075436_1000151343	281
112	3300027695	Ga0209966_1004668	Ga0209966_10046682	281
113	3300027907	Ga0207428_10005386	Ga0207428_100053865	281
114	3300031251	Ga0265327_10094387	Ga0265327_100943872	281
115	3300045976	Ga0466967_0213323	Ga0466967_0213323_20_967	281
116	3300005458	Ga0070681_10059544	Ga0070681_100595441	282
117	3300005471	Ga0070698_100113402	Ga0070698_1001134021	282
118	3300025912	Ga0207707_10227453	Ga0207707_102274532	282
119	3300028558	Ga0265326_10013267	Ga0265326_100132673	282
120	3300028563	Ga0265319_1003514	Ga0265319_10035142	282
121	3300028573	Ga0265334_10001551	Ga0265334_100015518	282
122	3300028577	Ga0265318_10000752	Ga0265318_1000075222	282
123	3300028800	Ga0265338_10003630	Ga0265338_100036307	282
124	3300029957	Ga0265324_10019038	Ga0265324_100190382	282
125	3300031238	Ga0265332_10001967	Ga0265332_100019675	282
126	3300031239	Ga0265328_10001176	Ga0265328_100011767	282
127	3300031241	Ga0265325_10000754	Ga0265325_1000075424	282
128	3300031242	Ga0265329_10000312	Ga0265329_100003128	282
129	3300031247	Ga0265340_10004408	Ga0265340_100044087	282
130	3300031249	Ga0265339_10013058	Ga0265339_100130583	282
131	3300031250	Ga0265331_10006670	Ga0265331_100066707	282
132	3300031251	Ga0265327_10021924	Ga0265327_100219242	282
133	3300031344	Ga0265316_10006899	Ga0265316_1000689911	282
134	3300031595	Ga0265313_10001578	Ga0265313_100015783	282
135	3300031711	Ga0265314_10014089	Ga0265314_100140893	282
136	3300031712	Ga0265342_10007930	Ga0265342_100079303	282
137	3300035171	Ga0373946_0021194	Ga0373946_0021194_607_1527	282
138	3300045976	Ga0466967_0022598	Ga0466967_0022598_19_897	282
139	3300045976	Ga0466967_0128330	Ga0466967_0128330_847_1803	282
140	3300046535	Ga0495586_0008192	Ga0495586_0008192_533_1453	282
141	3300014325	Ga0163163_10108886	Ga0163163_101088862	283
142	3300025960	Ga0207651_10116944	Ga0207651_101169442	283
143	3300031995	Ga0307409_100304534	Ga0307409_1003045342	283
144	3300034817	Ga0373948_0038229	Ga0373948_0038229_77_958	283
145	3300035695	Ga0373927_0212424	Ga0373927_0212424_66_950	283
146	3300048904	Ga0496101_0159156	Ga0496101_0159156_506_1387	283
147	3300048907	Ga0496104_0134465	Ga0496104_0134465_1128_2009	283
148	3300048908	Ga0496105_0001381	Ga0496105_0001381_3097_3978	283
149	3300048913	Ga0496110_0000382	Ga0496110_0000382_5035_5916	283
150	3300048914	Ga0496111_0000503	Ga0496111_0000503_13602_14483	283
151	3300048915	Ga0496112_0000831	Ga0496112_0000831_14737_15618	283
152	3300048915	Ga0496112_0046391	Ga0496112_0046391_2284_3231	283
153	3300048916	Ga0496113_0001539	Ga0496113_0001539_2414_3295	283
154	3300025928	Ga0207700_10183660	Ga0207700_101836602	284
155	3300032168	Ga0316593_10035544	Ga0316593_100355442	284
156	3300046689	Ga0495613_0080724	Ga0495613_0080724_1356_2282	285
157	3300050512	nmdc:mga0n895_207965_c1	nmdc:mga0n895_207965_c1_163_1116	285
158	3300044842	Ga0466957_0138180	Ga0466957_0138180_591_1550	286
159	3300050510	nmdc:mga06r32_120145_c1	nmdc:mga06r32_120145_c1_1388_2323	286
160	3300044694	Ga0466963_0003590	Ga0466963_0003590_2290_3249	288
161	3300044706	Ga0466964_0033138	Ga0466964_0033138_231_1181	288
162	3300045976	Ga0466967_0000086	Ga0466967_0000086_24135_25085	288
163	3300045976	Ga0466967_0085687	Ga0466967_0085687_1058_2017	288
164	3300050492	nmdc:mga0yw44_95770_c1	nmdc:mga0yw44_95770_c1_674_1582	288
165	3300011119	Ga0105246_10070394	Ga0105246_100703942	289
166	3300006844	Ga0075428_100008965	Ga0075428_1000089654	290
167	3300006847	Ga0075431_100420353	Ga0075431_1004203531	290
168	3300009094	Ga0111539_10146531	Ga0111539_101465312	290
169	3300009147	Ga0114129_10000306	Ga0114129_1000030629	290
170	3300048905	Ga0496102_0008381	Ga0496102_0008381_5529_6494	290
171	3300050507	nmdc:mga05p37_9_c1	nmdc:mga05p37_9_c1_38940_39872	290
172	3300050508	nmdc:mga09592_483358_c1	nmdc:mga09592_483358_c1_11_943	290
173	3300050511	nmdc:mga08y16_15415_c1	nmdc:mga08y16_15415_c1_1021_1953	290
174	3300050515	nmdc:mga0a205_172104_c1	nmdc:mga0a205_172104_c1_177_1109	290
175	3300005441	Ga0070700_100046226	Ga0070700_1000462262	291
176	3300006844	Ga0075428_100405921	Ga0075428_1004059212	291
177	3300009147	Ga0114129_10495658	Ga0114129_104956582	291
178	3300009176	Ga0105242_10348907	Ga0105242_103489072	291
179	3300014497	Ga0182008_10132782	Ga0182008_101327821	291
180	3300025927	Ga0207687_10011630	Ga0207687_100116308	291
181	3300026075	Ga0207708_10074014	Ga0207708_100740142	291
182	3300050507	nmdc:mga05p37_258692_c1	nmdc:mga05p37_258692_c1_248_1261	291
183	3300005329	Ga0070683_100001865	Ga0070683_10000186510	292
184	3300005466	Ga0070685_10033162	Ga0070685_100331622	292
185	3300005471	Ga0070698_100057422	Ga0070698_1000574222	292
186	3300005535	Ga0070684_100041439	Ga0070684_1000414393	292
187	3300005564	Ga0070664_100006648	Ga0070664_1000066484	292
188	3300006038	Ga0075365_10112300	Ga0075365_101123002	292
189	3300006871	Ga0075434_100380855	Ga0075434_1003808552	292
190	3300013308	Ga0157375_10290974	Ga0157375_102909742	292
191	3300014969	Ga0157376_10312358	Ga0157376_103123582	292
192	3300025908	Ga0207643_10020870	Ga0207643_100208703	292
193	3300025944	Ga0207661_10004931	Ga0207661_100049317	292
194	3300025945	Ga0207679_10003601	Ga0207679_100036017	292
195	3300026089	Ga0207648_10302959	Ga0207648_103029592	292
196	3300037312	Ga0395899_0003213	Ga0395899_0003213_10637_11566	292
197	3300037418	Ga0395900_0012832	Ga0395900_0012832_1532_2461	292
198	3300037466	Ga0395898_0002942	Ga0395898_0002942_17470_18399	292
199	3300037471	Ga0395905_0000960	Ga0395905_0000960_12516_13445	292
200	3300038443	Ga0395901_0003244	Ga0395901_0003244_7115_8044	292
201	3300038443	Ga0395901_0394673	Ga0395901_0394673_172_1101	292
202	3300047321	Ga0495676_0279372	Ga0495676_0279372_147_1070	292
203	3300048904	Ga0496101_0024232	Ga0496101_0024232_2204_3130	292
204	3300048908	Ga0496105_0019075	Ga0496105_0019075_2470_3396	292
205	3300048911	Ga0496108_0007445	Ga0496108_0007445_1170_2096	292
206	3300048912	Ga0496109_0043688	Ga0496109_0043688_3115_4044	292
207	3300048913	Ga0496110_0016611	Ga0496110_0016611_958_1884	292
208	3300048914	Ga0496111_0006656	Ga0496111_0006656_978_1907	292
209	3300048914	Ga0496111_0292126	Ga0496111_0292126_168_1100	292
210	3300048915	Ga0496112_0115841	Ga0496112_0115841_949_1878	292
211	3300048916	Ga0496113_0053006	Ga0496113_0053006_1998_2927	292
212	3300049580	Ga0501046_0167305	Ga0501046_0167305_65_994	292
213	3300049591	Ga0501075_0116319	Ga0501075_0116319_435_1364	292
214	3300049741	Ga0501079_0041793	Ga0501079_0041793_1546_2475	292
215	3300054114	Ga0501084_0124669	Ga0501084_0124669_499_1428	292
216	3300005563	Ga0068855_100194046	Ga0068855_1001940463	293
217	3300013308	Ga0157375_10393334	Ga0157375_103933342	294
218	3300026078	Ga0207702_10478368	Ga0207702_104783681	294
219	3300048903	Ga0496100_0071679	Ga0496100_0071679_795_1745	294
220	3300048905	Ga0496102_0162880	Ga0496102_0162880_647_1597	294
221	3300048906	Ga0496103_0184564	Ga0496103_0184564_106_1056	294
222	3300048909	Ga0496106_0035691	Ga0496106_0035691_2449_3399	294
223	3300048912	Ga0496109_0147838	Ga0496109_0147838_623_1573	294
224	3300048914	Ga0496111_0119490	Ga0496111_0119490_735_1685	294
225	3300005440	Ga0070705_100017478	Ga0070705_1000174782	295
226	3300005518	Ga0070699_100056724	Ga0070699_1000567243	295
227	3300005937	Ga0081455_10039361	Ga0081455_100393614	295
228	3300005983	Ga0081540_1002689	Ga0081540_10026893	295
229	3300005983	Ga0081540_1024608	Ga0081540_10246082	295
230	3300006847	Ga0075431_100117943	Ga0075431_1001179433	295
231	3300009098	Ga0105245_10031800	Ga0105245_100318003	295
232	3300026118	Ga0207675_100001579	Ga0207675_1000015794	295
233	3300042005	Ga0439448_0075158	Ga0439448_0075158_95_1045	295
234	3300042016	Ga0439463_047033	Ga0439463_047033_32_982	295
235	3300042157	Ga0439458_0007312	Ga0439458_0007312_790_1740	295
236	3300044706	Ga0466964_0000279	Ga0466964_0000279_506_1453	295
237	3300045051	Ga0451576_0186135	Ga0451576_0186135_437_1393	295
238	3300045976	Ga0466967_0003772	Ga0466967_0003772_5239_6186	295
239	3300046615	Ga0495656_0054104	Ga0495656_0054104_667_1620	295
240	3300048913	Ga0496110_0142326	Ga0496110_0142326_587_1540	295
241	3300049583	Ga0501067_0002079	Ga0501067_0002079_1033_1980	295
242	3300049585	Ga0501069_0001947	Ga0501069_0001947_5108_6055	295
243	3300049586	Ga0501070_0032717	Ga0501070_0032717_3077_4024	295
244	3300050513	nmdc:mga0rr50_33053_c1	nmdc:mga0rr50_33053_c1_884_1834	295
245	3300050515	nmdc:mga0a205_55214_c1	nmdc:mga0a205_55214_c1_1831_2781	295
246	3300003373	JGI25407J50210_10013926	JGI25407J50210_100139262	296
247	3300005344	Ga0070661_100322451	Ga0070661_1003224511	296
248	3300005347	Ga0070668_100020048	Ga0070668_1000200487	296
249	3300005366	Ga0070659_100194043	Ga0070659_1001940432	296
250	3300005440	Ga0070705_100254996	Ga0070705_1002549961	296
251	3300005530	Ga0070679_100308041	Ga0070679_1003080412	296
252	3300005530	Ga0070679_100565993	Ga0070679_1005659931	296
253	3300005535	Ga0070684_100170301	Ga0070684_1001703012	296
254	3300005545	Ga0070695_100148379	Ga0070695_1001483792	296
255	3300005546	Ga0070696_100274952	Ga0070696_1002749522	296
256	3300005549	Ga0070704_100070403	Ga0070704_1000704032	296
257	3300005563	Ga0068855_100136886	Ga0068855_1001368862	296
258	3300005578	Ga0068854_100066493	Ga0068854_1000664932	296
259	3300005937	Ga0081455_10009850	Ga0081455_100098505	296
260	3300005937	Ga0081455_10098827	Ga0081455_100988272	296
261	3300005981	Ga0081538_10000012	Ga0081538_10000012166	296
262	3300005981	Ga0081538_10000205	Ga0081538_1000020565	296
263	3300005981	Ga0081538_10000732	Ga0081538_1000073233	296
264	3300005981	Ga0081538_10005748	Ga0081538_1000574815	296
265	3300005981	Ga0081538_10031809	Ga0081538_100318092	296
266	3300006852	Ga0075433_10009678	Ga0075433_100096785	296
267	3300006871	Ga0075434_100000243	Ga0075434_10000024343	296
268	3300006914	Ga0075436_100038736	Ga0075436_1000387363	296
269	3300007076	Ga0075435_100002589	Ga0075435_10000258913	296
270	3300009553	Ga0105249_10018217	Ga0105249_100182175	296
271	3300010375	Ga0105239_10071321	Ga0105239_100713212	296
272	3300011119	Ga0105246_10069289	Ga0105246_100692892	296
273	3300013306	Ga0163162_10135063	Ga0163162_101350632	296
274	3300017792	Ga0163161_10203595	Ga0163161_102035952	296
275	3300025911	Ga0207654_10039839	Ga0207654_100398392	296
276	3300025919	Ga0207657_10015818	Ga0207657_1001581811	296
277	3300025921	Ga0207652_10234658	Ga0207652_102346581	296
278	3300025927	Ga0207687_10041296	Ga0207687_100412962	296
279	3300025933	Ga0207706_10022121	Ga0207706_100221215	296
280	3300025949	Ga0207667_10335834	Ga0207667_103358342	296
281	3300025961	Ga0207712_10032630	Ga0207712_100326302	296
282	3300025972	Ga0207668_10057406	Ga0207668_100574062	296
283	3300025981	Ga0207640_10072021	Ga0207640_100720212	296
284	3300028800	Ga0265338_10074038	Ga0265338_100740382	296
285	3300031249	Ga0265339_10003846	Ga0265339_1000384610	296
286	3300031344	Ga0265316_10005704	Ga0265316_100057042	296
287	3300031344	Ga0265316_10028920	Ga0265316_100289203	296
288	3300031548	Ga0307408_100380696	Ga0307408_1003806962	296
289	3300031711	Ga0265314_10101677	Ga0265314_101016772	296
290	3300031852	Ga0307410_10188076	Ga0307410_101880761	296
291	3300032005	Ga0307411_10260831	Ga0307411_102608312	296
292	3300036401	Ga0373937_0040507	Ga0373937_0040507_2662_3612	296
293	3300037312	Ga0395899_0001925	Ga0395899_0001925_11174_12118	296
294	3300037312	Ga0395899_0004943	Ga0395899_0004943_914_1864	296
295	3300037418	Ga0395900_0016706	Ga0395900_0016706_1535_2485	296
296	3300037466	Ga0395898_0005381	Ga0395898_0005381_476_1420	296
297	3300037471	Ga0395905_0017672	Ga0395905_0017672_3598_4542	296
298	3300037471	Ga0395905_0017965	Ga0395905_0017965_1535_2485	296
299	3300038443	Ga0395901_0005249	Ga0395901_0005249_7922_8872	296
300	3300038443	Ga0395901_0022437	Ga0395901_0022437_4222_5166	296
301	3300038443	Ga0395901_0281974	Ga0395901_0281974_429_1379	296
302	3300038443	Ga0395901_0380662	Ga0395901_0380662_397_1347	296
303	3300042009	Ga0439451_007125	Ga0439451_007125_681_1628	296
304	3300044656	Ga0466969_0050356	Ga0466969_0050356_739_1689	296
305	3300044684	Ga0466966_0056795	Ga0466966_0056795_797_1747	296
306	3300044693	Ga0466961_0156470	Ga0466961_0156470_365_1315	296
307	3300044694	Ga0466963_0048519	Ga0466963_0048519_970_1920	296
308	3300044719	Ga0466971_0041508	Ga0466971_0041508_666_1616	296
309	3300045049	Ga0466959_0068394	Ga0466959_0068394_692_1642	296
310	3300045836	Ga0466958_0016911	Ga0466958_0016911_2200_3150	296
311	3300045976	Ga0466967_0002111	Ga0466967_0002111_4476_5426	296
312	3300045976	Ga0466967_0029931	Ga0466967_0029931_2210_3160	296
313	3300046462	Ga0495651_0036441	Ga0495651_0036441_106_1056	296
314	3300046463	Ga0495653_0024543	Ga0495653_0024543_817_1767	296
315	3300046492	Ga0495585_0114715	Ga0495585_0114715_154_1107	296
316	3300046511	Ga0495608_0101207	Ga0495608_0101207_90_1040	296
317	3300046538	Ga0495609_0024554	Ga0495609_0024554_1359_2312	296
318	3300046559	Ga0495667_0084256	Ga0495667_0084256_933_1883	296
319	3300047317	Ga0495604_0140375	Ga0495604_0140375_155_1105	296
320	3300047471	Ga0495684_0036068	Ga0495684_0036068_301_1251	296
321	3300048904	Ga0496101_0063932	Ga0496101_0063932_452_1411	296
322	3300048907	Ga0496104_0001085	Ga0496104_0001085_7856_8815	296
323	3300048908	Ga0496105_0000401	Ga0496105_0000401_17821_18780	296
324	3300048909	Ga0496106_0010484	Ga0496106_0010484_2007_2954	296
325	3300048909	Ga0496106_0167458	Ga0496106_0167458_442_1401	296
326	3300048910	Ga0496107_0005558	Ga0496107_0005558_4624_5571	296
327	3300048911	Ga0496108_0109238	Ga0496108_0109238_713_1672	296
328	3300048912	Ga0496109_0000487	Ga0496109_0000487_14223_15182	296
329	3300048913	Ga0496110_0000826	Ga0496110_0000826_770_1729	296
330	3300048914	Ga0496111_0000277	Ga0496111_0000277_23349_24308	296
331	3300048915	Ga0496112_0065009	Ga0496112_0065009_2520_3470	296
332	3300048916	Ga0496113_0342039	Ga0496113_0342039_221_1171	296
333	3300048917	Ga0496114_0001239	Ga0496114_0001239_16130_17089	296
334	3300048918	Ga0496115_0085828	Ga0496115_0085828_990_1949	296
335	3300049568	Ga0501031_0007362	Ga0501031_0007362_1927_2874	296
336	3300049568	Ga0501031_0011048	Ga0501031_0011048_4075_5022	296
337	3300049572	Ga0501036_0002190	Ga0501036_0002190_4293_5240	296
338	3300049572	Ga0501036_0034836	Ga0501036_0034836_2277_3224	296
339	3300049574	Ga0501038_0004572	Ga0501038_0004572_2032_2979	296
340	3300049575	Ga0501039_0152307	Ga0501039_0152307_801_1748	296
341	3300049576	Ga0501040_0002822	Ga0501040_0002822_9718_10665	296
342	3300049576	Ga0501040_0005591	Ga0501040_0005591_4742_5689	296
343	3300049577	Ga0501041_0015528	Ga0501041_0015528_2429_3376	296
344	3300049578	Ga0501042_0006558	Ga0501042_0006558_2448_3395	296
345	3300049580	Ga0501046_0028115	Ga0501046_0028115_1498_2445	296
346	3300049580	Ga0501046_0156860	Ga0501046_0156860_472_1422	296
347	3300049582	Ga0501048_0001463	Ga0501048_0001463_15671_16618	296
348	3300049584	Ga0501068_0007767	Ga0501068_0007767_2334_3281	296
349	3300049586	Ga0501070_0038219	Ga0501070_0038219_365_1312	296
350	3300049587	Ga0501071_0008807	Ga0501071_0008807_3303_4250	296
351	3300049587	Ga0501071_0015172	Ga0501071_0015172_2736_3683	296
352	3300049591	Ga0501075_0048675	Ga0501075_0048675_1633_2580	296
353	3300049593	Ga0501077_0007485	Ga0501077_0007485_5350_6297	296
354	3300049593	Ga0501077_0021134	Ga0501077_0021134_2627_3574	296
355	3300049593	Ga0501077_0034901	Ga0501077_0034901_485_1432	296
356	3300049741	Ga0501079_0023106	Ga0501079_0023106_876_1823	296
357	3300049742	Ga0501080_0002379	Ga0501080_0002379_12851_13798	296
358	3300049742	Ga0501080_0004400	Ga0501080_0004400_1102_2049	296
359	3300049744	Ga0501083_0016716	Ga0501083_0016716_252_1199	296
360	3300049744	Ga0501083_0053239	Ga0501083_0053239_1464_2411	296
361	3300049822	Ga0501035_0015276	Ga0501035_0015276_699_1646	296
362	3300049823	Ga0501044_0167347	Ga0501044_0167347_1020_1967	296
363	3300049824	Ga0501045_0006576	Ga0501045_0006576_3140_4087	296
364	3300049824	Ga0501045_0018783	Ga0501045_0018783_2838_3785	296
365	3300050512	nmdc:mga0n895_492_c1	nmdc:mga0n895_492_c1_20520_21470	296
366	3300050513	nmdc:mga0rr50_50016_c1	nmdc:mga0rr50_50016_c1_400_1350	296
367	3300050515	nmdc:mga0a205_24596_c1	nmdc:mga0a205_24596_c1_4063_5013	296
368	3300054114	Ga0501084_0040655	Ga0501084_0040655_467_1414	296
369	3300060353	Ga0501082_0024990	Ga0501082_0024990_2164_3111	296
370	3300060353	Ga0501082_0046641	Ga0501082_0046641_1298_2245	296
371	3300060353	Ga0501082_0124367	Ga0501082_0124367_570_1520	296
372	3300060353	Ga0501082_0207725	Ga0501082_0207725_351_1298	296
373	3300061719	Ga0466962_0003630	Ga0466962_0003630_898_1848	296
374	3300061734	Ga0530510_0029180	Ga0530510_0029180_2820_3767	296
375	3300061734	Ga0530510_0274967	Ga0530510_0274967_59_1006	296
376	3300005341	Ga0070691_10005067	Ga0070691_100050675	297
377	3300005345	Ga0070692_10019149	Ga0070692_100191492	297
378	3300005435	Ga0070714_100054544	Ga0070714_1000545441	297
379	3300005436	Ga0070713_100087789	Ga0070713_1000877893	297
380	3300005438	Ga0070701_10018655	Ga0070701_100186553	297
381	3300005440	Ga0070705_100049198	Ga0070705_1000491982	297
382	3300005535	Ga0070684_100081799	Ga0070684_1000817992	297
383	3300005546	Ga0070696_100017590	Ga0070696_1000175902	297
384	3300005547	Ga0070693_100179958	Ga0070693_1001799582	297
385	3300005549	Ga0070704_100156380	Ga0070704_1001563802	297
386	3300005563	Ga0068855_100056008	Ga0068855_1000560082	297
387	3300005578	Ga0068854_100072411	Ga0068854_1000724112	297
388	3300005616	Ga0068852_100165969	Ga0068852_1001659692	297
389	3300005618	Ga0068864_100081681	Ga0068864_1000816811	297
390	3300005841	Ga0068863_100426552	Ga0068863_1004265521	297
391	3300005983	Ga0081540_1002684	Ga0081540_10026848	297
392	3300006163	Ga0070715_10035388	Ga0070715_100353882	297
393	3300006852	Ga0075433_10083637	Ga0075433_100836374	297
394	3300009094	Ga0111539_10028671	Ga0111539_100286717	297
395	3300009094	Ga0111539_10109917	Ga0111539_101099172	297
396	3300009148	Ga0105243_10011508	Ga0105243_100115087	297
397	3300010375	Ga0105239_10127363	Ga0105239_101273632	297
398	3300025915	Ga0207693_10016507	Ga0207693_100165075	297
399	3300025915	Ga0207693_10016567	Ga0207693_100165672	297
400	3300025916	Ga0207663_10391946	Ga0207663_103919461	297
401	3300025928	Ga0207700_10061255	Ga0207700_100612552	297
402	3300025929	Ga0207664_10431113	Ga0207664_104311131	297
403	3300025939	Ga0207665_10001017	Ga0207665_100010175	297
404	3300026067	Ga0207678_10007838	Ga0207678_100078383	297
405	3300026075	Ga0207708_10009965	Ga0207708_100099656	297
406	3300026078	Ga0207702_10304899	Ga0207702_103048992	297
407	3300026088	Ga0207641_10335612	Ga0207641_103356122	297
408	3300026095	Ga0207676_10144146	Ga0207676_101441461	297
409	3300026118	Ga0207675_100007009	Ga0207675_1000070094	297
410	3300026121	Ga0207683_10303945	Ga0207683_103039452	297
411	3300026142	Ga0207698_10027324	Ga0207698_100273244	297
412	3300027907	Ga0207428_10118645	Ga0207428_101186452	297
413	3300028380	Ga0268265_10030805	Ga0268265_100308053	297
414	3300028381	Ga0268264_10446471	Ga0268264_104464711	297
415	3300035116	Ga0373945_0045222	Ga0373945_0045222_397_1353	297
416	3300035170	Ga0373943_0008773	Ga0373943_0008773_2466_3422	297
417	3300035242	Ga0373962_0024128	Ga0373962_0024128_445_1398	297
418	3300035725	Ga0373947_0007289	Ga0373947_0007289_1517_2473	297
419	3300037471	Ga0395905_0020954	Ga0395905_0020954_654_1607	297
420	3300038443	Ga0395901_0005887	Ga0395901_0005887_10211_11164	297
421	3300038443	Ga0395901_0381028	Ga0395901_0381028_137_1093	297
422	3300046455	Ga0495603_0002705	Ga0495603_0002705_3965_4921	297
423	3300046473	Ga0495582_0152464	Ga0495582_0152464_30_986	297
424	3300046681	Ga0495647_0024494	Ga0495647_0024494_419_1375	297
425	3300046683	Ga0495658_0246821	Ga0495658_0246821_37_993	297
426	3300047321	Ga0495676_0044785	Ga0495676_0044785_1943_2899	297
427	3300048903	Ga0496100_0007587	Ga0496100_0007587_4551_5504	297
428	3300048904	Ga0496101_0032772	Ga0496101_0032772_840_1793	297
429	3300048904	Ga0496101_0083666	Ga0496101_0083666_258_1211	297
430	3300048905	Ga0496102_0041519	Ga0496102_0041519_2955_3908	297
431	3300048906	Ga0496103_0003994	Ga0496103_0003994_1809_2762	297
432	3300048906	Ga0496103_0016198	Ga0496103_0016198_395_1348	297
433	3300048907	Ga0496104_0008530	Ga0496104_0008530_19_972	297
434	3300048907	Ga0496104_0300808	Ga0496104_0300808_229_1182	297
435	3300048910	Ga0496107_0020586	Ga0496107_0020586_1173_2126	297
436	3300048910	Ga0496107_0072340	Ga0496107_0072340_1099_2052	297
437	3300048910	Ga0496107_0141246	Ga0496107_0141246_149_1102	297
438	3300048912	Ga0496109_0184797	Ga0496109_0184797_612_1565	297
439	3300048916	Ga0496113_0133848	Ga0496113_0133848_297_1250	297
440	3300048916	Ga0496113_0345694	Ga0496113_0345694_87_1040	297
441	3300048918	Ga0496115_0185382	Ga0496115_0185382_447_1400	297
442	3300050508	nmdc:mga09592_359328_c1	nmdc:mga09592_359328_c1_293_1240	297
443	3300050511	nmdc:mga08y16_51051_c1	nmdc:mga08y16_51051_c1_2462_3418	297
444	3300050515	nmdc:mga0a205_154997_c1	nmdc:mga0a205_154997_c1_268_1224	297
445	3300005329	Ga0070683_100210102	Ga0070683_1002101022	299
446	3300005530	Ga0070679_100374784	Ga0070679_1003747842	299
447	3300005719	Ga0068861_100074439	Ga0068861_1000744392	299
448	3300005937	Ga0081455_10110902	Ga0081455_101109022	299
449	3300005985	Ga0081539_10011591	Ga0081539_100115918	299
450	3300009553	Ga0105249_10298228	Ga0105249_102982281	299
451	3300025931	Ga0207644_10283068	Ga0207644_102830682	299
452	3300025937	Ga0207669_10318236	Ga0207669_103182362	299
453	3300025942	Ga0207689_10269518	Ga0207689_102695182	299
454	3300025961	Ga0207712_10189941	Ga0207712_101899412	299
455	3300025972	Ga0207668_10087404	Ga0207668_100874042	299
456	3300026089	Ga0207648_10053071	Ga0207648_100530715	299
457	3300026118	Ga0207675_100095043	Ga0207675_1000950433	299
458	3300037312	Ga0395899_0047873	Ga0395899_0047873_2188_3144	299
459	3300037466	Ga0395898_0004451	Ga0395898_0004451_12895_13851	299
460	3300037471	Ga0395905_0513526	Ga0395905_0513526_34_990	299
461	3300048904	Ga0496101_0252554	Ga0496101_0252554_56_1024	299
462	3300048908	Ga0496105_0176508	Ga0496105_0176508_215_1183	299
463	3300048909	Ga0496106_0049451	Ga0496106_0049451_705_1673	299
464	3300048910	Ga0496107_0100684	Ga0496107_0100684_901_1869	299
465	3300048911	Ga0496108_0019915	Ga0496108_0019915_435_1403	299
466	3300048912	Ga0496109_0303166	Ga0496109_0303166_402_1370	299
467	3300049575	Ga0501039_0095807	Ga0501039_0095807_990_1952	299
468	3300049578	Ga0501042_0075742	Ga0501042_0075742_622_1584	299
469	3300049582	Ga0501048_0117320	Ga0501048_0117320_33_995	299
470	3300049588	Ga0501072_0036513	Ga0501072_0036513_2717_3679	299
471	3300049592	Ga0501076_0075747	Ga0501076_0075747_493_1455	299
472	3300049741	Ga0501079_0017853	Ga0501079_0017853_4216_5178	299
473	3300049824	Ga0501045_0205074	Ga0501045_0205074_181_1167	299
474	3300046529	Ga0495652_0208882	Ga0495652_0208882_318_1319	304
475	3300025917	Ga0207660_10157006	Ga0207660_101570062	305
476	3300053117	Ga0500593_005689	Ga0500593_005689_3479_4603	305
477	3300025321	Ga0207656_10084755	Ga0207656_100847552	306
478	3300007076	Ga0075435_100119007	Ga0075435_1001190072	308
479	3300028577	Ga0265318_10028073	Ga0265318_100280733	308
480	3300031247	Ga0265340_10080854	Ga0265340_100808542	308
481	3300031712	Ga0265342_10042561	Ga0265342_100425614	308
482	3300037471	Ga0395905_0000212	Ga0395905_0000212_69097_70173	313
483	3300042532	Ga0450893_0003629	Ga0450893_0003629_992_2032	314
484	3300026041	Ga0207639_10200590	Ga0207639_102005902	315
485	iso_pu_bacteria	2919704043	2919704135	317
486	iso_pu_bacteria	2818991445	2819592803	319
487	3300002704	JGI25155J39150_1000388	JGI25155J39150_100038815	323
488	3300002705	JGI25156J39149_1000288	JGI25156J39149_100028839	323
489	3300002705	JGI25156J39149_1000503	JGI25156J39149_100050315	323
490	3300002738	JGI25154J39366_1000313	JGI25154J39366_10003133	323
491	3300002741	JGI25157J39369_1000171	JGI25157J39369_100017151	323
492	3300003758	Ga0055532_1000044	Ga0055532_100004455	323
493	3300025206	Ga0209435_100004	Ga0209435_100004463	323
494	3300025229	Ga0209147_100011	Ga0209147_100011532	323
495	3300025242	Ga0209258_100279	Ga0209258_10027946	323
496	3300025246	Ga0209646_1000140	Ga0209646_100014074	323
497	3300025250	Ga0209026_1000066	Ga0209026_1000066113	323
498	3300025256	Ga0209759_1000114	Ga0209759_100011448	323
499	3300025272	Ga0209455_1001794	Ga0209455_10017942	323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00448

SRP54

SRP54-type protein, GTPase domain

139

340

0.99 PF02881

SRP54_N

SRP54-type protein, helical bundle domain

64

123

0.86 PF06414

Zeta_toxin

Zeta toxin

127

250

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6fqd-assembly2.cif.gz_B	escherichia coli signal recognition particle receptor ftsy ngdn1	0.9667	51	321
5nco-assembly1.cif.gz_l	quaternary complex between srp, sr, and secyeg bound to the translating ribosome	0.9604	54	323
6fqd-assembly2.cif.gz_B	escherichia coli signal recognition particle receptor ftsy ngdn1	0.9597	51	321
6fqd-assembly1.cif.gz_A	escherichia coli signal recognition particle receptor ftsy ngdn1	0.9562	51	323
5gad-assembly1.cif.gz_l	rnc-srp-sr complex early state	0.9561	121	312

ID	Description	Score	Start	End	Superfamily
af_P9WGD9_219_421_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9594	122	322	3.40.50.300
4c7oD01	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain	0.9543	50	110	1.20.120.140
af_P9WGD9_219_421_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9411	122	322	3.40.50.300
af_A0A0R0L4Y4_128_288_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.933	122	266	3.40.50.300
2xxaD01	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain	0.932	46	110	1.20.120.140

ID	Description	Score	Start	End	GO Terms
AF-A0A0S4UQ60-F1-model_v4	Signal recognition particle receptor FtsY (SRP receptor) (EC 3.6.5.4)	0.9892	31	323	GO:0003924 GO:0005047 GO:0005525 GO:0005737 GO:0005886 GO:0006614 GO:0016887
AF-A0A556UPM0-F1-model_v4	deleted	0.985	15	323
AF-A0A0S4UQ60-F1-model_v4	Signal recognition particle receptor FtsY (SRP receptor) (EC 3.6.5.4)	0.9826	31	323	GO:0003924 GO:0005047 GO:0005525 GO:0005737 GO:0005886 GO:0006614 GO:0016887
AF-A0A2A4M9N9-F1-model_v4	Signal recognition particle receptor FtsY (SRP receptor) (EC 3.6.5.4)	0.9819	38	322	GO:0003924 GO:0005047 GO:0005525 GO:0005737 GO:0005886 GO:0006614 GO:0016887
AF-A0A348N1J6-F1-model_v4	Signal recognition particle-docking protein FtsY	0.9815	123	322	GO:0003924 GO:0005047 GO:0005525 GO:0005886 GO:0006614 GO:0016887

Feature Viewer

pLDDT	pTM	Quality
88.32	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455355

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00448

SRP54

SRP54-type protein, GTPase domain

139

340

0.99

PF02881

SRP54_N

SRP54-type protein, helical bundle domain

64

123

0.86

PF06414

Zeta_toxin

Zeta toxin

127

250

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map