F455358

General Info

Members Datasets Scaffolds Average Seq Length
499 269 999 206

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000059|Ga0105240_1000005949
Length 237
Sequence MKKDEKKNGGEVMKWGKERNCGEGTGIVYNKKKTMHKLQYLTAGKPVEETGKALIMIHGRGGSAEDILSLADALPVGDFTLFAPKAVSNSWYPYSFLMPPERNEPWLSSAVEVVGKLVEEIGLPKDKIWFTGFSQGACLTLEYIARNAGKYGGVSAFTGGLIGDRIYREKYKGDFGGTPVFIGTSDPDPHVPVQRVLETEKVLKELGAEVNVKVYPGMGHTITQQEIRDAVAAGVWG

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
233 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
257 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
258 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
259 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
260 2738541284 Pedobacter sp. YR016 Isolate Unclassified
261 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
262 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
263 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
264 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
265 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
266 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
267 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
268 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
269 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.59
Metatranscriptomes 1.6
Isolates 2.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 0.8
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 13.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000059 3300009093 Bacteria 219860
2 MBSR1b_contig_4232256 2162886012 Bacteria 1002
3 JGI24741J21665_1002415 3300001915 Bacteria 4854
4 JGI24740J21852_10002179 3300001979 Bacteria 8954
5 JGI25154J39366_1000042 3300002738 Bacteria 143170
6 JGI25406J46586_10076014 3300003203 Unclassified 1040
7 JGI25153J46596_10002051 3300003215 Bacteria 11869
8 rootH1_10031909 3300003316 Bacteria 4650
9 rootH1_10031909 3300003323 Bacteria 5971
10 rootH2_10001435 3300003320 Bacteria 37408
11 rootH2_10005386 3300003320 Bacteria 74798
12 rootH2_10283589 3300003320 Bacteria 2274
13 rootL2_10148078 3300003322 Bacteria 5607
14 rootH1_10218216 3300003323 Unclassified 1593
15 JGI25160J50197_1004448 3300003354 Bacteria 6063
16 Ga0055535_1009461 3300003761 Unclassified 1679
17 Ga0055534_1010825 3300003784 Bacteria 1885
18 Ga0055531_10000036 3300003794 Bacteria 147042
19 Ga0065165_1012678 3300005262 Unclassified 3414
20 Ga0065714_10005178 3300005288 Bacteria 6009
21 Ga0065712_10014257 3300005290 Bacteria 2019
22 Ga0065712_10092946 3300005290 Bacteria 2312
23 Ga0070658_10184022 3300005327 Unclassified 1759
24 Ga0070658_10275292 3300005327 Bacteria 1432
25 Ga0070658_10282394 3300005327 Bacteria 1413
26 Ga0070658_10332586 3300005327 Bacteria 1298
27 Ga0070676_10019600 3300005328 Bacteria 3767
28 Ga0070683_100001930 3300005329 Bacteria 16231
29 Ga0070683_100500327 3300005329 Bacteria 1161
30 Ga0070683_100773913 3300005329 Bacteria 920
31 Ga0070690_100024157 3300005330 Unclassified 3737
32 Ga0070670_100160506 3300005331 Bacteria 1948
33 Ga0070670_100285567 3300005331 Unclassified 1441
34 Ga0070670_100586933 3300005331 Bacteria 996
35 Ga0068869_100007600 3300005334 Bacteria 6936
36 Ga0068869_100027781 3300005334 Unclassified 3948
37 Ga0068869_100180152 3300005334 Bacteria 1656
38 Ga0070666_10092728 3300005335 Bacteria 2077
39 Ga0070680_100017905 3300005336 Bacteria 5592
40 Ga0070680_100059208 3300005336 Bacteria 3133
41 Ga0070682_100000315 3300005337 Bacteria 33359
42 Ga0070682_100337568 3300005337 Bacteria 1119
43 Ga0070682_100423679 3300005337 Bacteria 1012
44 Ga0068868_100007523 3300005338 Bacteria 7760
45 Ga0068868_100662532 3300005338 Bacteria 930
46 Ga0070660_100076322 3300005339 Bacteria 2624
47 Ga0070689_100096169 3300005340 Bacteria 2340
48 Ga0070689_100513996 3300005340 Bacteria 1027
49 Ga0070691_10000896 3300005341 Bacteria 12075
50 Ga0070661_100000371 3300005344 Bacteria 35287
51 Ga0070661_100006552 3300005344 Bacteria 8032
52 Ga0070668_100399617 3300005347 Bacteria 1173
53 Ga0070669_100050320 3300005353 Bacteria 3043
54 Ga0070669_100183720 3300005353 Bacteria 1637
55 Ga0070675_100230061 3300005354 Bacteria 1617
56 Ga0070675_100842821 3300005354 Bacteria 839
57 Ga0070671_100201736 3300005355 Bacteria 1687
58 Ga0070671_100238236 3300005355 Bacteria 1544
59 Ga0070671_100717531 3300005355 Bacteria 868
60 Ga0070673_100020102 3300005364 Bacteria 4809
61 Ga0070673_100158039 3300005364 Bacteria 1926
62 Ga0070673_100357268 3300005364 Bacteria 1298
63 Ga0070673_100483429 3300005364 Bacteria 1118
64 Ga0070688_100083901 3300005365 Bacteria 2068
65 Ga0070688_100178117 3300005365 Bacteria 1472
66 Ga0070688_100211510 3300005365 Bacteria 1362
67 Ga0070659_100002373 3300005366 Bacteria 13384
68 Ga0070659_100863446 3300005366 Bacteria 789
69 Ga0070667_100007229 3300005367 Bacteria 9224
70 Ga0070667_100118071 3300005367 Unclassified 2305
71 Ga0070667_100754052 3300005367 Bacteria 902
72 Ga0070701_10051926 3300005438 Bacteria 2128
73 Ga0070705_100266959 3300005440 Bacteria 1210
74 Ga0070663_100148292 3300005455 Bacteria 1797
75 Ga0070678_100376417 3300005456 Bacteria 1227
76 Ga0070662_100027605 3300005457 Bacteria 3943
77 Ga0070662_100038548 3300005457 Bacteria 3395
78 Ga0070662_100203219 3300005457 Bacteria 1573
79 Ga0070681_10037459 3300005458 Bacteria 4866
80 Ga0070681_10115709 3300005458 Bacteria 2619
81 Ga0070681_10125652 3300005458 Unclassified 2498
82 Ga0070681_10478802 3300005458 Bacteria 1157
83 Ga0068867_100048247 3300005459 Bacteria 3132
84 Ga0068867_100505649 3300005459 Unclassified 1039
85 Ga0070679_100000801 3300005530 Bacteria 27256
86 Ga0070679_100010126 3300005530 Bacteria 8938
87 Ga0070679_100218478 3300005530 Bacteria 1867
88 Ga0070679_100292325 3300005530 Bacteria 1581
89 Ga0070684_100006600 3300005535 Bacteria 8988
90 Ga0070684_100018783 3300005535 Bacteria 5703
91 Ga0070684_100280292 3300005535 Bacteria 1527
92 Ga0070684_101073630 3300005535 Bacteria 756
93 Ga0068853_100003435 3300005539 Bacteria 12115
94 Ga0068853_100012007 3300005539 Bacteria 7045
95 Ga0068853_100099275 3300005539 Bacteria 2572
96 Ga0068853_100387756 3300005539 Bacteria 1306
97 Ga0070686_100187805 3300005544 Bacteria 1473
98 Ga0070693_100027008 3300005547 Bacteria 3105
99 Ga0068855_100007523 3300005563 Bacteria 13184
100 Ga0068855_100016426 3300005563 Bacteria 8899
101 Ga0068855_100050561 3300005563 Bacteria 4898
102 Ga0068855_100106702 3300005563 Bacteria 3219
103 Ga0068855_100354872 3300005563 Bacteria 1615
104 Ga0068855_100761349 3300005563 Bacteria 1032
105 Ga0068855_101174234 3300005563 Unclassified 799
106 Ga0070664_100004620 3300005564 Bacteria 11055
107 Ga0070664_100071400 3300005564 Bacteria 2975
108 Ga0070664_100235103 3300005564 Bacteria 1644
109 Ga0068857_100002187 3300005577 Bacteria 15909
110 Ga0068857_100080279 3300005577 Bacteria 2913
111 Ga0068857_100123740 3300005577 Bacteria 2330
112 Ga0068857_101067093 3300005577 Bacteria 779
113 Ga0068854_100372387 3300005578 Bacteria 1175
114 Ga0068854_100541147 3300005578 Bacteria 986
115 Ga0068856_100149055 3300005614 Bacteria 2347
116 Ga0070702_100194551 3300005615 Bacteria 1337
117 Ga0068852_100002674 3300005616 Bacteria 12316
118 Ga0068852_100125036 3300005616 Bacteria 2360
119 Ga0068852_100595541 3300005616 Unclassified 1109
120 Ga0068859_100051711 3300005617 Bacteria 4130
121 Ga0068859_100117721 3300005617 Bacteria 2722
122 Ga0068864_100048356 3300005618 Bacteria 3656
123 Ga0068864_100169164 3300005618 Unclassified 1992
124 Ga0068864_100515833 3300005618 Bacteria 1152
125 Ga0068861_100014055 3300005719 Bacteria 5613
126 Ga0068861_100101765 3300005719 Bacteria 2286
127 Ga0068863_100462019 3300005841 Unclassified 1247
128 Ga0068860_100017010 3300005843 Bacteria 7087
129 Ga0068860_100230713 3300005843 Bacteria 1799
130 Ga0068862_100533100 3300005844 Bacteria 1119
131 Ga0081539_10001413 3300005985 Bacteria 41325
132 Ga0070715_10077580 3300006163 Bacteria 1500
133 Ga0068871_100009807 3300006358 Bacteria 6950
134 Ga0068871_100080318 3300006358 Unclassified 2700
135 Ga0068865_100254382 3300006881 Bacteria 1388
136 Ga0097620_100051708 3300006931 Bacteria 4130
137 Ga0097620_100117719 3300006931 Bacteria 2722
138 Ga0105240_10000100 3300009093 Bacteria 176640
139 Ga0105240_10016585 3300009093 Bacteria 9967
140 Ga0105240_10022092 3300009093 Bacteria 8444
141 Ga0105240_10251305 3300009093 Bacteria 2045
142 Ga0105240_10280281 3300009093 Bacteria 1915
143 Ga0105240_10532652 3300009093 Bacteria 1302
144 Ga0111539_10033471 3300009094 Bacteria 6239
145 Ga0111539_10844843 3300009094 Bacteria 1065
146 Ga0105247_10317654 3300009101 Bacteria 1086
147 Ga0105241_10010626 3300009174 Bacteria 6750
148 Ga0105241_10217690 3300009174 Bacteria 1603
149 Ga0105242_10468090 3300009176 Bacteria 1192
150 Ga0105248_10023968 3300009177 Bacteria 6784
151 Ga0105237_10000056 3300009545 Bacteria 151313
152 Ga0105237_10001923 3300009545 Bacteria 26509
153 Ga0105237_10002804 3300009545 Bacteria 21167
154 Ga0105237_10274277 3300009545 Bacteria 1689
155 Ga0105238_10168836 3300009551 Bacteria 2164
156 Ga0105238_11083178 3300009551 Unclassified 824
157 Ga0105249_10045858 3300009553 Bacteria 3977
158 Ga0105249_10877110 3300009553 Bacteria 964
159 Ga0105249_10964714 3300009553 Bacteria 921
160 Ga0105249_11287895 3300009553 Bacteria 802
161 Ga0105239_10000089 3300010375 Bacteria 129415
162 Ga0105239_10001735 3300010375 Bacteria 28734
163 Ga0105239_10005354 3300010375 Bacteria 15062
164 Ga0105239_10007530 3300010375 Bacteria 12486
165 Ga0105239_10751798 3300010375 Bacteria 1116
166 Ga0105239_11768218 3300010375 Bacteria 716
167 Ga0105246_10249717 3300011119 Bacteria 1407
168 Ga0157373_10000109 3300013100 Bacteria 64743
169 Ga0157371_10001101 3300013102 Bacteria 29303
170 Ga0157371_10001447 3300013102 Bacteria 24637
171 Ga0157371_10006737 3300013102 Bacteria 9393
172 Ga0157371_10092494 3300013102 Bacteria 2143
173 Ga0157371_10189942 3300013102 Unclassified 1470
174 Ga0157370_10004214 3300013104 Bacteria 16631
175 Ga0157370_10008579 3300013104 Bacteria 11009
176 Ga0157370_10037665 3300013104 Bacteria 4686
177 Ga0157370_10073128 3300013104 Bacteria 3234
178 Ga0157370_10141758 3300013104 Bacteria 2239
179 Ga0157370_10156986 3300013104 Unclassified 2117
180 Ga0157370_10197046 3300013104 Bacteria 1869
181 Ga0157370_10539128 3300013104 Bacteria 1070
182 Ga0157369_10116548 3300013105 Bacteria 2836
183 Ga0157369_10267765 3300013105 Bacteria 1781
184 Ga0157374_10000004 3300013296 Bacteria 759774
185 Ga0157374_10002092 3300013296 Bacteria 16798
186 Ga0157374_10024304 3300013296 Bacteria 5432
187 Ga0157374_10238513 3300013296 Unclassified 1788
188 Ga0157374_10339299 3300013296 Bacteria 1491
189 Ga0157374_11074546 3300013296 Bacteria 825
190 Ga0157378_10102525 3300013297 Bacteria 2614
191 Ga0157378_10561332 3300013297 Bacteria 1148
192 Ga0157378_10670902 3300013297 Bacteria 1054
193 Ga0163162_10006282 3300013306 Bacteria 11507
194 Ga0163162_10010632 3300013306 Bacteria 8950
195 Ga0163162_10046477 3300013306 Bacteria 4351
196 Ga0163162_10350164 3300013306 Bacteria 1610
197 Ga0163162_11741385 3300013306 Unclassified 712
198 Ga0157372_10005508 3300013307 Bacteria 13458
199 Ga0157372_10005758 3300013307 Bacteria 13205
200 Ga0157372_10086529 3300013307 Bacteria 3555
201 Ga0157372_10338761 3300013307 Unclassified 1752
202 Ga0157372_10379411 3300013307 Bacteria 1647
203 Ga0157372_10399750 3300013307 Bacteria 1601
204 Ga0157372_10692133 3300013307 Bacteria 1186
205 Ga0157372_11060612 3300013307 Bacteria 938
206 Ga0157372_11364051 3300013307 Bacteria 818
207 Ga0157375_10016546 3300013308 Bacteria 6630
208 Ga0157375_10065729 3300013308 Unclassified 3617
209 Ga0157375_10127820 3300013308 Bacteria 2658
210 Ga0157375_10248283 3300013308 Unclassified 1940
211 Ga0163163_10000606 3300014325 Bacteria 31173
212 Ga0163163_10103518 3300014325 Bacteria 2871
213 Ga0163163_10196656 3300014325 Bacteria 2064
214 Ga0157380_10000383 3300014326 Bacteria 26712
215 Ga0157380_10003189 3300014326 Bacteria 11193
216 Ga0157380_10036906 3300014326 Bacteria 3785
217 Ga0157380_11016551 3300014326 Bacteria 863
218 Ga0182008_10000010 3300014497 Bacteria 301527
219 Ga0182008_10000015 3300014497 Bacteria 243121
220 Ga0157377_10007984 3300014745 Bacteria 5141
221 Ga0157377_10026570 3300014745 Bacteria 3099
222 Ga0157377_10181673 3300014745 Bacteria 1323
223 Ga0157379_10090901 3300014968 Bacteria 2739
224 Ga0157379_10292469 3300014968 Bacteria 1484
225 Ga0157379_11269845 3300014968 Bacteria 710
226 Ga0157376_10331133 3300014969 Bacteria 1451
227 Ga0157376_10400960 3300014969 Bacteria 1326
228 Ga0163161_10018889 3300017792 Bacteria 4832
229 Ga0213876_10062842 3300021384 Bacteria 1960
230 Ga0209646_1000017 3300025246 Bacteria 488265
231 Ga0209026_1000721 3300025250 Bacteria 19458
232 Ga0209675_1000094 3300025291 Bacteria 138083
233 Ga0209758_1003933 3300025297 Bacteria 12944
234 Ga0207426_1000530 3300025302 Bacteria 55033
235 Ga0209257_1000008 3300025304 Bacteria 1294570
236 Ga0207697_10037335 3300025315 Bacteria 1990
237 Ga0207697_10194413 3300025315 Bacteria 891
238 Ga0207642_10592092 3300025899 Bacteria 689
239 Ga0207647_10039264 3300025904 Bacteria 2988
240 Ga0207647_10095992 3300025904 Bacteria 1765
241 Ga0207685_10061768 3300025905 Bacteria 1486
242 Ga0207645_10012688 3300025907 Bacteria 5713
243 Ga0207705_10024376 3300025909 Bacteria 4318
244 Ga0207654_10005551 3300025911 Bacteria 6379
245 Ga0207707_10000456 3300025912 Bacteria 42593
246 Ga0207707_10028529 3300025912 Unclassified 4878
247 Ga0207707_10412734 3300025912 Bacteria 1158
248 Ga0207695_10000027 3300025913 Bacteria 612456
249 Ga0207695_10000039 3300025913 Bacteria 454801
250 Ga0207695_10025913 3300025913 Bacteria 6554
251 Ga0207695_10115842 3300025913 Bacteria 2654
252 Ga0207695_10426003 3300025913 Bacteria 1211
253 Ga0207695_11117564 3300025913 Bacteria 668
254 Ga0207671_10002703 3300025914 Bacteria 18595
255 Ga0207671_10004148 3300025914 Bacteria 14008
256 Ga0207671_10017778 3300025914 Bacteria 5472
257 Ga0207671_10173727 3300025914 Unclassified 1674
258 Ga0207660_10017838 3300025917 Bacteria 4723
259 Ga0207660_10021995 3300025917 Bacteria 4294
260 Ga0207660_10066404 3300025917 Bacteria 2609
261 Ga0207657_10094570 3300025919 Unclassified 2488
262 Ga0207657_10132637 3300025919 Bacteria 2041
263 Ga0207657_10137050 3300025919 Bacteria 2002
264 Ga0207657_10434832 3300025919 Unclassified 1030
265 Ga0207649_10007956 3300025920 Bacteria 5770
266 Ga0207649_10025781 3300025920 Unclassified 3432
267 Ga0207652_10000383 3300025921 Bacteria 46096
268 Ga0207652_10000939 3300025921 Bacteria 27425
269 Ga0207652_10003129 3300025921 Bacteria 13799
270 Ga0207681_10114881 3300025923 Bacteria 1965
271 Ga0207694_10293397 3300025924 Bacteria 1338
272 Ga0207694_10313233 3300025924 Bacteria 1294
273 Ga0207650_10059844 3300025925 Bacteria 2841
274 Ga0207650_10133792 3300025925 Bacteria 1943
275 Ga0207650_10437072 3300025925 Bacteria 1087
276 Ga0207659_10235158 3300025926 Bacteria 1480
277 Ga0207644_10371219 3300025931 Bacteria 1165
278 Ga0207690_10083595 3300025932 Bacteria 2235
279 Ga0207706_10016991 3300025933 Bacteria 6565
280 Ga0207706_10029733 3300025933 Bacteria 4876
281 Ga0207706_10036114 3300025933 Bacteria 4391
282 Ga0207706_10110313 3300025933 Bacteria 2420
283 Ga0207686_10359223 3300025934 Unclassified 1099
284 Ga0207670_10159410 3300025936 Bacteria 1683
285 Ga0207670_10356656 3300025936 Bacteria 1159
286 Ga0207704_10245298 3300025938 Bacteria 1341
287 Ga0207691_10137896 3300025940 Bacteria 2151
288 Ga0207691_10218125 3300025940 Bacteria 1655
289 Ga0207711_10305252 3300025941 Bacteria 1468
290 Ga0207711_10585121 3300025941 Bacteria 1041
291 Ga0207689_10011066 3300025942 Bacteria 7754
292 Ga0207689_10028372 3300025942 Bacteria 4683
293 Ga0207689_10073444 3300025942 Bacteria 2810
294 Ga0207689_10160558 3300025942 Bacteria 1852
295 Ga0207661_10000993 3300025944 Bacteria 18764
296 Ga0207661_10062067 3300025944 Bacteria 3022
297 Ga0207661_10240061 3300025944 Bacteria 1608
298 Ga0207661_10370033 3300025944 Bacteria 1296
299 Ga0207679_10001245 3300025945 Bacteria 16182
300 Ga0207679_10135065 3300025945 Unclassified 1985
301 Ga0207667_10013719 3300025949 Bacteria 9262
302 Ga0207667_10061637 3300025949 Bacteria 3924
303 Ga0207667_10111786 3300025949 Bacteria 2817
304 Ga0207667_10197199 3300025949 Bacteria 2066
305 Ga0207667_10658833 3300025949 Bacteria 1052
306 Ga0207667_10770425 3300025949 Bacteria 960
307 Ga0207651_10152199 3300025960 Bacteria 1802
308 Ga0207712_10326188 3300025961 Bacteria 1268
309 Ga0207658_10021579 3300025986 Unclassified 4474
310 Ga0207658_10088534 3300025986 Bacteria 2394
311 Ga0207658_10720393 3300025986 Bacteria 902
312 Ga0207658_10751201 3300025986 Bacteria 883
313 Ga0207677_10788856 3300026023 Bacteria 850
314 Ga0207639_10022628 3300026041 Bacteria 4529
315 Ga0207639_10492184 3300026041 Bacteria 1119
316 Ga0207639_10538388 3300026041 Bacteria 1071
317 Ga0207639_11101211 3300026041 Bacteria 745
318 Ga0207678_10142701 3300026067 Bacteria 2044
319 Ga0207702_10091336 3300026078 Bacteria 2666
320 Ga0207702_10140983 3300026078 Unclassified 2181
321 Ga0207641_10294684 3300026088 Bacteria 1530
322 Ga0207648_10040469 3300026089 Bacteria 4095
323 Ga0207648_10066166 3300026089 Bacteria 3152
324 Ga0207676_10007575 3300026095 Bacteria 7702
325 Ga0207676_10085759 3300026095 Unclassified 2571
326 Ga0207676_10275310 3300026095 Unclassified 1526
327 Ga0207674_10001501 3300026116 Bacteria 30115
328 Ga0207674_10020503 3300026116 Bacteria 7141
329 Ga0207674_10021608 3300026116 Bacteria 6928
330 Ga0207674_10040676 3300026116 Bacteria 4814
331 Ga0207674_10143813 3300026116 Bacteria 2344
332 Ga0207675_100001355 3300026118 Bacteria 24522
333 Ga0207675_100066043 3300026118 Bacteria 3381
334 Ga0207675_100707198 3300026118 Bacteria 1017
335 Ga0207683_10209086 3300026121 Bacteria 1775
336 Ga0207683_10652041 3300026121 Bacteria 975
337 Ga0207698_10013387 3300026142 Bacteria 5410
338 Ga0207698_10091630 3300026142 Bacteria 2489
339 Ga0207698_10390735 3300026142 Unclassified 1326
340 Ga0207698_10414445 3300026142 Bacteria 1291
341 Ga0207698_10445596 3300026142 Bacteria 1248
342 Ga0207698_10466615 3300026142 Bacteria 1222
343 Ga0268264_10012030 3300028381 Bacteria 7124
344 Ga0268264_11152480 3300028381 Unclassified 784
345 Ga0307517_10086139 3300028786 Bacteria 2625
346 Ga0307515_10000135 3300028794 Bacteria 175323
347 Ga0307515_10228761 3300028794 Unclassified 1658
348 Ga0307509_10091452 3300031507 Unclassified 3114
349 Ga0307408_100065859 3300031548 Unclassified 2659
350 Ga0307408_100131804 3300031548 Unclassified 1951
351 Ga0307514_10099823 3300031649 Unclassified 2088
352 Ga0307516_10002011 3300031730 Bacteria 27743
353 Ga0307516_10054653 3300031730 Bacteria 3901
354 Ga0307407_10232066 3300031903 Bacteria 1254
355 Ga0307416_100176554 3300032002 Bacteria 1996
356 Ga0307510_10008138 3300033180 Bacteria 12485
357 Ga0373935_0325313 3300035692 Bacteria 1092
358 Ga0373933_0044863 3300035724 Bacteria 2620
359 Ga0373937_0001105 3300036401 Bacteria 22721
360 Ga0373925_0245904 3300037068 Bacteria 1434
361 Ga0395899_0001461 3300037312 Bacteria 20134
362 Ga0395899_0006917 3300037312 Bacteria 8785
363 Ga0395899_0194216 3300037312 Unclassified 1419
364 Ga0395900_0002994 3300037418 Bacteria 18381
365 Ga0395900_0107406 3300037418 Bacteria 2867
366 Ga0395900_0449900 3300037418 Unclassified 1244
367 Ga0395898_0001093 3300037466 Bacteria 41845
368 Ga0395905_0606025 3300037471 Bacteria 997
369 Ga0395901_0009207 3300038443 Bacteria 10003
370 Ga0395901_0435722 3300038443 Bacteria 1342
371 Ga0436365_0215388 3300039437 Bacteria 20742
372 Ga0436365_0784655 3300039437 Bacteria 1013
373 Ga0439436_0018858 3300041404 Bacteria 2062
374 Ga0439462_0005021 3300042015 Bacteria 3247
375 Ga0466969_0000191 3300044656 Bacteria 32966
376 Ga0466965_0093554 3300044683 Unclassified 1531
377 Ga0466966_0000341 3300044684 Bacteria 30134
378 Ga0466961_0356148 3300044693 Bacteria 890
379 Ga0453684_1160436 3300044712 Unclassified 813
380 Ga0466971_0080459 3300044719 Bacteria 1485
381 Ga0466971_0104662 3300044719 Bacteria 1303
382 Ga0466968_0025388 3300044735 Bacteria 2427
383 Ga0466968_0164129 3300044735 Unclassified 1026
384 Ga0466968_0171303 3300044735 Unclassified 1006
385 Ga0466970_0088829 3300044765 Bacteria 1676
386 Ga0466957_0036419 3300044842 Bacteria 2958
387 Ga0466959_0000010 3300045049 Bacteria 176306
388 Ga0466959_0054516 3300045049 Bacteria 2921
389 Ga0495592_0015029 3300046454 Bacteria 5878
390 Ga0495606_0027531 3300046507 Bacteria 4028
391 Ga0495628_0013949 3300046516 Bacteria 6748
392 Ga0495630_0016817 3300046517 Bacteria 5350
393 Ga0495632_0005404 3300046519 Bacteria 8453
394 Ga0495632_0098858 3300046519 Bacteria 1377
395 Ga0495648_0002512 3300046524 Bacteria 16839
396 Ga0495640_0138073 3300046533 Bacteria 1573
397 Ga0495609_0000025 3300046538 Bacteria 256898
398 Ga0495645_0202845 3300046543 Unclassified 1344
399 Ga0495668_0005139 3300046616 Bacteria 8995
400 Ga0495634_0041456 3300046642 Bacteria 3126
401 Ga0495611_0000046 3300046648 Bacteria 88300
402 Ga0495611_0073318 3300046648 Bacteria 1567
403 Ga0495625_0001869 3300046660 Bacteria 23924
404 Ga0495657_0628457 3300046675 Unclassified 620
405 Ga0495604_0211293 3300047317 Unclassified 1341
406 Ga0495674_0161295 3300047319 Bacteria 1876
407 Ga0495672_0005880 3300047320 Bacteria 9618
408 Ga0495687_000006 3300047443 Bacteria 571936
409 Ga0495684_0287152 3300047471 Unclassified 1185
410 Ga0495686_0000151 3300047472 Bacteria 135048
411 Ga0495686_0015316 3300047472 Bacteria 5242
412 Ga0496102_0007675 3300048905 Bacteria 9218
413 Ga0496105_0371165 3300048908 Bacteria 1140
414 Ga0496110_0136959 3300048913 Bacteria 2213
415 Ga0496111_0137840 3300048914 Bacteria 1808
416 Ga0496116_0000006 3300048919 Bacteria 811937
417 Ga0496116_0002191 3300048919 Bacteria 20815
418 Ga0496117_0000023 3300048920 Bacteria 438585
419 Ga0496117_0004744 3300048920 Bacteria 14761
420 Ga0496118_0000388 3300048921 Bacteria 74358
421 Ga0496118_0264036 3300048921 Bacteria 969
422 Ga0496119_0000010 3300048922 Bacteria 438534
423 Ga0496122_0000458 3300048925 Bacteria 84794
424 Ga0496122_0003230 3300048925 Bacteria 21662
425 Ga0496122_0003582 3300048925 Bacteria 20269
426 Ga0496122_0010627 3300048925 Bacteria 9456
427 Ga0496123_0000294 3300048926 Bacteria 97574
428 Ga0496123_0014857 3300048926 Bacteria 6426
429 Ga0496123_0145351 3300048926 Bacteria 1289
430 Ga0496124_0000418 3300048927 Bacteria 76015
431 Ga0496125_0000181 3300048928 Bacteria 138133
432 Ga0496125_0007980 3300048928 Bacteria 11181
433 Ga0496125_0301239 3300048928 Unclassified 982
434 Ga0496126_0001022 3300048929 Bacteria 47547
435 Ga0496126_0030212 3300048929 Bacteria 5136
436 Ga0501306_001766 3300049127 Bacteria 2103
437 Ga0501309_023033 3300049129 Bacteria 883
438 Ga0501305_020088 3300049161 Bacteria 979
439 Ga0501305_023989 3300049161 Bacteria 916
440 Ga0501312_003693 3300049528 Bacteria 1757
441 Ga0501313_004711 3300049529 Bacteria 1414
442 Ga0501321_020902 3300049537 Bacteria 813
443 Ga0501323_016008 3300049539 Bacteria 952
444 Ga0501037_0329718 3300049573 Bacteria 1056
445 Ga0501043_0347447 3300049579 Bacteria 1127
446 Ga0501047_0759832 3300049581 Unclassified 785
447 Ga0501068_0133418 3300049584 Unclassified 1554
448 Ga0501069_0045738 3300049585 Unclassified 2425
449 Ga0501070_0093230 3300049586 Unclassified 2491
450 Ga0501223_030090 3300049663 Unclassified 1056
451 Ga0501257_002770 3300049686 Unclassified 3708
452 Ga0501257_128809 3300049686 Bacteria 683
453 Ga0501219_000779 3300049703 Bacteria 4257
454 Ga0501225_0011824 3300049705 Bacteria 2455
455 Ga0501080_0067443 3300049742 Unclassified 3327
456 Ga0501083_0017225 3300049744 Bacteria 5037
457 Ga0501241_000127 3300049758 Bacteria 16544
458 Ga0501264_000156 3300049761 Bacteria 10906
459 Ga0501044_0306585 3300049823 Unclassified 1515
460 Ga0501044_0332369 3300049823 Unclassified 1442
461 Ga0501284_00181 3300050005 Bacteria 4901
462 nmdc:mga0k408_229095_c1 3300050493 Bacteria 1109
463 nmdc:mga08y16_46180_c1 3300050511 Unclassified 4560
464 nmdc:mga08y16_664573_c1 3300050511 Bacteria 1045
465 Ga0500644_0001116 3300053088 Bacteria 7906
466 Ga0500646_0123784 3300053090 Bacteria 834
467 Ga0500583_0005775 3300053092 Bacteria 4186
468 Ga0500556_0043197 3300053104 Bacteria 1599
469 Ga0500569_000883 3300053109 Bacteria 5351
470 Ga0500594_0017279 3300053118 Bacteria 1764
471 Ga0500655_020378 3300053133 Bacteria 1238
472 Ga0500658_0006853 3300053134 Bacteria 4217
473 Ga0500568_0028367 3300053139 Bacteria 2334
474 Ga0500577_0002677 3300053142 Bacteria 4566
475 Ga0500604_0003768 3300053151 Unclassified 4057
476 Ga0500616_0005533 3300053153 Bacteria 8557
477 Ga0500616_0027720 3300053153 Bacteria 3126
478 Ga0500622_0000016 3300053156 Bacteria 337983
479 Ga0500622_0000305 3300053156 Bacteria 50294
480 Ga0500622_0005725 3300053156 Bacteria 7383
481 Ga0500622_0011595 3300053156 Bacteria 4795
482 Ga0500627_0231132 3300053158 Bacteria 823
483 Ga0500633_0004685 3300053160 Bacteria 3170
484 Ga0501084_0206059 3300054114 Bacteria 1659
485 Ga0501082_0598803 3300060353 Unclassified 964
486 Ga0466962_0222439 3300061719 Bacteria 925
487 2588209811 2585428182 Bacteria 5007281
488 2588215036 2585428183 Bacteria 5166119
489 2588222457 2585428185 Bacteria 4969476
490 2588234002 2585428187 Bacteria 4629388
491 2738760736 2738541284 Bacteria 5199923
492 2772605934 2772190705 Bacteria 4666226
493 2776612935 2775506987 Bacteria 5373360
494 2816873928 2816332188 Bacteria 5133218
495 2819681468 2818991460 Bacteria 7595395
496 2910246834 2910245624 Bacteria 6935613
497 2929244169 2929239360 Bacteria 7745570
498 2929925337 2929921140 Bacteria 8649150
499 2946022150 2946019816 Bacteria 4621265
500 8003154174 8003151029 Bacteria 8187759
501 Ga0105240_10000059
502 MBSR1b_contig_4232256
503 JGI24741J21665_1002415
504 JGI24740J21852_10002179
505 JGI25154J39366_1000042
506 JGI25406J46586_10076014
507 JGI25153J46596_10002051
508 rootH1_10031909
509 rootH2_10001435
510 rootH2_10005386
511 rootH2_10283589
512 rootL2_10148078
513 rootH1_10218216
514 JGI25160J50197_1004448
515 Ga0055535_1009461
516 Ga0055534_1010825
517 Ga0055531_10000036
518 Ga0065165_1012678
519 Ga0065714_10005178
520 Ga0065712_10014257
521 Ga0065712_10092946
522 Ga0070658_10184022
523 Ga0070658_10275292
524 Ga0070658_10282394
525 Ga0070658_10332586
526 Ga0070676_10019600
527 Ga0070683_100001930
528 Ga0070683_100500327
529 Ga0070683_100773913
530 Ga0070690_100024157
531 Ga0070670_100160506
532 Ga0070670_100285567
533 Ga0070670_100586933
534 Ga0068869_100007600
535 Ga0068869_100027781
536 Ga0068869_100180152
537 Ga0070666_10092728
538 Ga0070680_100017905
539 Ga0070680_100059208
540 Ga0070682_100000315
541 Ga0070682_100337568
542 Ga0070682_100423679
543 Ga0068868_100007523
544 Ga0068868_100662532
545 Ga0070660_100076322
546 Ga0070689_100096169
547 Ga0070689_100513996
548 Ga0070691_10000896
549 Ga0070661_100000371
550 Ga0070661_100006552
551 Ga0070668_100399617
552 Ga0070669_100050320
553 Ga0070669_100183720
554 Ga0070675_100230061
555 Ga0070675_100842821
556 Ga0070671_100201736
557 Ga0070671_100238236
558 Ga0070671_100717531
559 Ga0070673_100020102
560 Ga0070673_100158039
561 Ga0070673_100357268
562 Ga0070673_100483429
563 Ga0070688_100083901
564 Ga0070688_100178117
565 Ga0070688_100211510
566 Ga0070659_100002373
567 Ga0070659_100863446
568 Ga0070667_100007229
569 Ga0070667_100118071
570 Ga0070667_100754052
571 Ga0070701_10051926
572 Ga0070705_100266959
573 Ga0070663_100148292
574 Ga0070678_100376417
575 Ga0070662_100027605
576 Ga0070662_100038548
577 Ga0070662_100203219
578 Ga0070681_10037459
579 Ga0070681_10115709
580 Ga0070681_10125652
581 Ga0070681_10478802
582 Ga0068867_100048247
583 Ga0068867_100505649
584 Ga0070679_100000801
585 Ga0070679_100010126
586 Ga0070679_100218478
587 Ga0070679_100292325
588 Ga0070684_100006600
589 Ga0070684_100018783
590 Ga0070684_100280292
591 Ga0070684_101073630
592 Ga0068853_100003435
593 Ga0068853_100012007
594 Ga0068853_100099275
595 Ga0068853_100387756
596 Ga0070686_100187805
597 Ga0070693_100027008
598 Ga0068855_100007523
599 Ga0068855_100016426
600 Ga0068855_100050561
601 Ga0068855_100106702
602 Ga0068855_100354872
603 Ga0068855_100761349
604 Ga0068855_101174234
605 Ga0070664_100004620
606 Ga0070664_100071400
607 Ga0070664_100235103
608 Ga0068857_100002187
609 Ga0068857_100080279
610 Ga0068857_100123740
611 Ga0068857_101067093
612 Ga0068854_100372387
613 Ga0068854_100541147
614 Ga0068856_100149055
615 Ga0070702_100194551
616 Ga0068852_100002674
617 Ga0068852_100125036
618 Ga0068852_100595541
619 Ga0068859_100051711
620 Ga0068859_100117721
621 Ga0068864_100048356
622 Ga0068864_100169164
623 Ga0068864_100515833
624 Ga0068861_100014055
625 Ga0068861_100101765
626 Ga0068863_100462019
627 Ga0068860_100017010
628 Ga0068860_100230713
629 Ga0068862_100533100
630 Ga0081539_10001413
631 Ga0070715_10077580
632 Ga0068871_100009807
633 Ga0068871_100080318
634 Ga0068865_100254382
635 Ga0097620_100051708
636 Ga0097620_100117719
637 Ga0105240_10000100
638 Ga0105240_10016585
639 Ga0105240_10022092
640 Ga0105240_10251305
641 Ga0105240_10280281
642 Ga0105240_10532652
643 Ga0111539_10033471
644 Ga0111539_10844843
645 Ga0105247_10317654
646 Ga0105241_10010626
647 Ga0105241_10217690
648 Ga0105242_10468090
649 Ga0105248_10023968
650 Ga0105237_10000056
651 Ga0105237_10001923
652 Ga0105237_10002804
653 Ga0105237_10274277
654 Ga0105238_10168836
655 Ga0105238_11083178
656 Ga0105249_10045858
657 Ga0105249_10877110
658 Ga0105249_10964714
659 Ga0105249_11287895
660 Ga0105239_10000089
661 Ga0105239_10001735
662 Ga0105239_10005354
663 Ga0105239_10007530
664 Ga0105239_10751798
665 Ga0105239_11768218
666 Ga0105246_10249717
667 Ga0157373_10000109
668 Ga0157371_10001101
669 Ga0157371_10001447
670 Ga0157371_10006737
671 Ga0157371_10092494
672 Ga0157371_10189942
673 Ga0157370_10004214
674 Ga0157370_10008579
675 Ga0157370_10037665
676 Ga0157370_10073128
677 Ga0157370_10141758
678 Ga0157370_10156986
679 Ga0157370_10197046
680 Ga0157370_10539128
681 Ga0157369_10116548
682 Ga0157369_10267765
683 Ga0157374_10000004
684 Ga0157374_10002092
685 Ga0157374_10024304
686 Ga0157374_10238513
687 Ga0157374_10339299
688 Ga0157374_11074546
689 Ga0157378_10102525
690 Ga0157378_10561332
691 Ga0157378_10670902
692 Ga0163162_10006282
693 Ga0163162_10010632
694 Ga0163162_10046477
695 Ga0163162_10350164
696 Ga0163162_11741385
697 Ga0157372_10005508
698 Ga0157372_10005758
699 Ga0157372_10086529
700 Ga0157372_10338761
701 Ga0157372_10379411
702 Ga0157372_10399750
703 Ga0157372_10692133
704 Ga0157372_11060612
705 Ga0157372_11364051
706 Ga0157375_10016546
707 Ga0157375_10065729
708 Ga0157375_10127820
709 Ga0157375_10248283
710 Ga0163163_10000606
711 Ga0163163_10103518
712 Ga0163163_10196656
713 Ga0157380_10000383
714 Ga0157380_10003189
715 Ga0157380_10036906
716 Ga0157380_11016551
717 Ga0182008_10000010
718 Ga0182008_10000015
719 Ga0157377_10007984
720 Ga0157377_10026570
721 Ga0157377_10181673
722 Ga0157379_10090901
723 Ga0157379_10292469
724 Ga0157379_11269845
725 Ga0157376_10331133
726 Ga0157376_10400960
727 Ga0163161_10018889
728 Ga0213876_10062842
729 Ga0209646_1000017
730 Ga0209026_1000721
731 Ga0209675_1000094
732 Ga0209758_1003933
733 Ga0207426_1000530
734 Ga0209257_1000008
735 Ga0207697_10037335
736 Ga0207697_10194413
737 Ga0207642_10592092
738 Ga0207647_10039264
739 Ga0207647_10095992
740 Ga0207685_10061768
741 Ga0207645_10012688
742 Ga0207705_10024376
743 Ga0207654_10005551
744 Ga0207707_10000456
745 Ga0207707_10028529
746 Ga0207707_10412734
747 Ga0207695_10000027
748 Ga0207695_10000039
749 Ga0207695_10025913
750 Ga0207695_10115842
751 Ga0207695_10426003
752 Ga0207695_11117564
753 Ga0207671_10002703
754 Ga0207671_10004148
755 Ga0207671_10017778
756 Ga0207671_10173727
757 Ga0207660_10017838
758 Ga0207660_10021995
759 Ga0207660_10066404
760 Ga0207657_10094570
761 Ga0207657_10132637
762 Ga0207657_10137050
763 Ga0207657_10434832
764 Ga0207649_10007956
765 Ga0207649_10025781
766 Ga0207652_10000383
767 Ga0207652_10000939
768 Ga0207652_10003129
769 Ga0207681_10114881
770 Ga0207694_10293397
771 Ga0207694_10313233
772 Ga0207650_10059844
773 Ga0207650_10133792
774 Ga0207650_10437072
775 Ga0207659_10235158
776 Ga0207644_10371219
777 Ga0207690_10083595
778 Ga0207706_10016991
779 Ga0207706_10029733
780 Ga0207706_10036114
781 Ga0207706_10110313
782 Ga0207686_10359223
783 Ga0207670_10159410
784 Ga0207670_10356656
785 Ga0207704_10245298
786 Ga0207691_10137896
787 Ga0207691_10218125
788 Ga0207711_10305252
789 Ga0207711_10585121
790 Ga0207689_10011066
791 Ga0207689_10028372
792 Ga0207689_10073444
793 Ga0207689_10160558
794 Ga0207661_10000993
795 Ga0207661_10062067
796 Ga0207661_10240061
797 Ga0207661_10370033
798 Ga0207679_10001245
799 Ga0207679_10135065
800 Ga0207667_10013719
801 Ga0207667_10061637
802 Ga0207667_10111786
803 Ga0207667_10197199
804 Ga0207667_10658833
805 Ga0207667_10770425
806 Ga0207651_10152199
807 Ga0207712_10326188
808 Ga0207658_10021579
809 Ga0207658_10088534
810 Ga0207658_10720393
811 Ga0207658_10751201
812 Ga0207677_10788856
813 Ga0207639_10022628
814 Ga0207639_10492184
815 Ga0207639_10538388
816 Ga0207639_11101211
817 Ga0207678_10142701
818 Ga0207702_10091336
819 Ga0207702_10140983
820 Ga0207641_10294684
821 Ga0207648_10040469
822 Ga0207648_10066166
823 Ga0207676_10007575
824 Ga0207676_10085759
825 Ga0207676_10275310
826 Ga0207674_10001501
827 Ga0207674_10020503
828 Ga0207674_10021608
829 Ga0207674_10040676
830 Ga0207674_10143813
831 Ga0207675_100001355
832 Ga0207675_100066043
833 Ga0207675_100707198
834 Ga0207683_10209086
835 Ga0207683_10652041
836 Ga0207698_10013387
837 Ga0207698_10091630
838 Ga0207698_10390735
839 Ga0207698_10414445
840 Ga0207698_10445596
841 Ga0207698_10466615
842 Ga0268264_10012030
843 Ga0268264_11152480
844 Ga0307517_10086139
845 Ga0307515_10000135
846 Ga0307515_10228761
847 Ga0307509_10091452
848 Ga0307408_100065859
849 Ga0307408_100131804
850 Ga0307514_10099823
851 Ga0307516_10002011
852 Ga0307516_10054653
853 Ga0307407_10232066
854 Ga0307416_100176554
855 Ga0307510_10008138
856 Ga0373935_0325313
857 Ga0373933_0044863
858 Ga0373937_0001105
859 Ga0373925_0245904
860 Ga0395899_0001461
861 Ga0395899_0006917
862 Ga0395899_0194216
863 Ga0395900_0002994
864 Ga0395900_0107406
865 Ga0395900_0449900
866 Ga0395898_0001093
867 Ga0395905_0606025
868 Ga0395901_0009207
869 Ga0395901_0435722
870 Ga0436365_0215388
871 Ga0436365_0784655
872 Ga0439436_0018858
873 Ga0439462_0005021
874 Ga0466969_0000191
875 Ga0466965_0093554
876 Ga0466966_0000341
877 Ga0466961_0356148
878 Ga0453684_1160436
879 Ga0466971_0080459
880 Ga0466971_0104662
881 Ga0466968_0025388
882 Ga0466968_0164129
883 Ga0466968_0171303
884 Ga0466970_0088829
885 Ga0466957_0036419
886 Ga0466959_0000010
887 Ga0466959_0054516
888 Ga0495592_0015029
889 Ga0495606_0027531
890 Ga0495628_0013949
891 Ga0495630_0016817
892 Ga0495632_0005404
893 Ga0495632_0098858
894 Ga0495648_0002512
895 Ga0495640_0138073
896 Ga0495609_0000025
897 Ga0495645_0202845
898 Ga0495668_0005139
899 Ga0495634_0041456
900 Ga0495611_0000046
901 Ga0495611_0073318
902 Ga0495625_0001869
903 Ga0495657_0628457
904 Ga0495604_0211293
905 Ga0495674_0161295
906 Ga0495672_0005880
907 Ga0495687_000006
908 Ga0495684_0287152
909 Ga0495686_0000151
910 Ga0495686_0015316
911 Ga0496102_0007675
912 Ga0496105_0371165
913 Ga0496110_0136959
914 Ga0496111_0137840
915 Ga0496116_0000006
916 Ga0496116_0002191
917 Ga0496117_0000023
918 Ga0496117_0004744
919 Ga0496118_0000388
920 Ga0496118_0264036
921 Ga0496119_0000010
922 Ga0496122_0000458
923 Ga0496122_0003230
924 Ga0496122_0003582
925 Ga0496122_0010627
926 Ga0496123_0000294
927 Ga0496123_0014857
928 Ga0496123_0145351
929 Ga0496124_0000418
930 Ga0496125_0000181
931 Ga0496125_0007980
932 Ga0496125_0301239
933 Ga0496126_0001022
934 Ga0496126_0030212
935 Ga0501306_001766
936 Ga0501309_023033
937 Ga0501305_020088
938 Ga0501305_023989
939 Ga0501312_003693
940 Ga0501313_004711
941 Ga0501321_020902
942 Ga0501323_016008
943 Ga0501037_0329718
944 Ga0501043_0347447
945 Ga0501047_0759832
946 Ga0501068_0133418
947 Ga0501069_0045738
948 Ga0501070_0093230
949 Ga0501223_030090
950 Ga0501257_002770
951 Ga0501257_128809
952 Ga0501219_000779
953 Ga0501225_0011824
954 Ga0501080_0067443
955 Ga0501083_0017225
956 Ga0501241_000127
957 Ga0501264_000156
958 Ga0501044_0306585
959 Ga0501044_0332369
960 Ga0501284_00181
961 nmdc:mga0k408_229095_c1
962 nmdc:mga08y16_46180_c1
963 nmdc:mga08y16_664573_c1
964 Ga0500644_0001116
965 Ga0500646_0123784
966 Ga0500583_0005775
967 Ga0500556_0043197
968 Ga0500569_000883
969 Ga0500594_0017279
970 Ga0500655_020378
971 Ga0500658_0006853
972 Ga0500568_0028367
973 Ga0500577_0002677
974 Ga0500604_0003768
975 Ga0500616_0005533
976 Ga0500616_0027720
977 Ga0500622_0000016
978 Ga0500622_0000305
979 Ga0500622_0005725
980 Ga0500622_0011595
981 Ga0500627_0231132
982 Ga0500633_0004685
983 Ga0501084_0206059
984 Ga0501082_0598803
985 Ga0466962_0222439
986 2588209811
987 2588215036
988 2588222457
989 2588234002
990 2738760736
991 2772605934
992 2776612935
993 2816873928
994 2819681468
995 2910246834
996 2929244169
997 2929925337
998 2946022150
999 8003154174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

102

235

0.88

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

40

232

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h0c-assembly2.cif.gz_B crystal structure of phospholipase/carboxylesterase from dyadobacter fermentans dsm 18053 0.9876 2 201
4h0c-assembly2.cif.gz_B crystal structure of phospholipase/carboxylesterase from dyadobacter fermentans dsm 18053 0.9409 2 201
6bje-assembly1.cif.gz_A crystal structure of lysophospholipase a2 conjugated with phenylmethylsulfonyl fluoride 0.8371 5 201
4ftw-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution 0.8339 5 208
6avx-assembly1.cif.gz_A crystal structure of arabidopsis thaliana sober1 f65l 0.8302 19 201
ID Description Score Start End Superfamily
4h0cB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9772 2 201 3.40.50.1820
4h0cB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9348 2 201 3.40.50.1820
af_Q12354_5_226_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8347 10 201 3.40.50.1820
4ftwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8339 5 208 3.40.50.1820
af_O42881_1_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8276 1 201 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q5Y9U3-F1-model_v4 Phospholipase 0.9997 1 136 GO:0016787
AF-A0A6J4JJH2-F1-model_v4 Phospholipase/carboxylesterase 0.9895 2 186 GO:0016787
AF-A0A520HRT6-F1-model_v4 Phospholipase 0.9893 91 204 GO:0005737
GO:0008474
GO:0052689
AF-A0A2P8G8S6-F1-model_v4 Phospholipase/carboxylesterase 0.9889 2 204 GO:0016787
AF-A0A1G6WXL7-F1-model_v4 Phospholipase/carboxylesterase 0.9871 2 204 GO:0016787

Map