F455376

General Info

Members Datasets Scaffolds Average Seq Length
499 306 998 315

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1008339|Ga0182006_10083393
Length 376
Sequence MAGRDQVGNGAIPGVTKSLNRARVAHCIGLFQRVGGVFRSICHNVQIGRHCMAGPYRLNDKPGTAVSQIPTLDITRFDSDRDAFVAELGAAYRQWGFAGIRNHGIPQADIDAAYDVFKAFFALPDETKRKYHVAGSGGARGYTPFGVETAKGSKHFDLKEFWHIGREIADDSKYRDVMAPNLWPSEVEGFRERGYGLYQALDNLGSRVLSALALHIGLPEHFFADKTNFGNSILRPIHYPPITTDDIPNVRAGAHGDINFITLLVGASAAGLEVQSHDGDWVPFTSDADTIVVNIGDMLQRLTNHVYPSTIHRVVNPPGELARQPRYSVPFFLHPNPDFLIDVLPSCITEENPSRYPEPITAHGFLEERLREIKLK

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
62 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
63 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
77 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
157 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
248 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
249 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
250 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
251 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
252 2643221559 Lysobacter sp. Root559 Isolate Unclassified
253 2643221573 Lysobacter sp. Root604 Isolate Unclassified
254 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
255 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
256 2643221586 Lysobacter sp. Root667 Isolate Unclassified
257 2643221593 Lysobacter sp. Root690 Isolate Unclassified
258 2643221612 Lysobacter sp. Root76 Isolate Unclassified
259 2643221695 Lysobacter sp. Root494 Isolate Unclassified
260 2643221720 Lysobacter sp. Root916 Isolate Unclassified
261 2643221727 Lysobacter sp. Root96 Isolate Unclassified
262 2643221728 Lysobacter sp. Root983 Isolate Unclassified
263 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
264 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
265 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
266 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
267 2818991457 Xanthomonas translucens 569 Isolate Unclassified
268 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
269 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
270 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
271 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
272 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
273 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
274 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
275 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
276 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
277 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
278 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
279 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
280 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
281 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
282 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
283 2919513703 Luteimonas sp. 3794 Isolate Unclassified
284 2919675420 Luteimonas terrae 4099 Isolate Unclassified
285 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
286 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
287 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
288 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
289 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
290 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
291 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
292 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
293 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
294 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
295 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
296 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
297 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
298 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
299 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
300 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
301 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
302 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
303 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
304 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
305 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
306 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.98
Metatranscriptomes 0
Isolates 12.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 22.65
Nodule 0.2
Rhizoplane 3.01
Rhizosphere 57.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1008339 3300015261 Bacteria 4696
2 SwRhRL2b_contig_1996156 2162886007 Bacteria 1465
3 JGI24736J21556_1001670 3300001904 Bacteria 4026
4 JGI25152J39213_1000106 3300002773 Bacteria 58139
5 JGI25150J39212_1000114 3300002774 Bacteria 45745
6 JGI25151J46595_10000128 3300003187 Bacteria 102514
7 JGI25151J46595_10001018 3300003187 Bacteria 21057
8 JGI25151J46595_10017863 3300003187 Bacteria 3063
9 JGI25153J46596_10000089 3300003215 Bacteria 106651
10 rootH2_10005302 3300003320 Bacteria 6030
11 rootH1_10212468 3300003323 Bacteria 1143
12 Ga0055526_1000021 3300003771 Bacteria 180007
13 Ga0055526_1003786 3300003771 Bacteria 9423
14 Ga0055537_1000141 3300003773 Bacteria 54030
15 Ga0055537_1000215 3300003773 Bacteria 42710
16 Ga0055524_1000128 3300003775 Bacteria 88986
17 Ga0055536_1002676 3300003781 Bacteria 9889
18 Ga0055536_1002898 3300003781 Bacteria 9420
19 Ga0055536_1003007 3300003781 Bacteria 9232
20 Ga0055536_1005248 3300003781 Bacteria 6387
21 Ga0055536_1007116 3300003781 Bacteria 5073
22 Ga0055534_1000054 3300003784 Bacteria 88986
23 Ga0055534_1000086 3300003784 Bacteria 72299
24 Ga0055534_1018470 3300003784 Bacteria 1212
25 Ga0055528_1000009 3300003790 Bacteria 224150
26 Ga0055528_1001008 3300003790 Bacteria 18690
27 Ga0055530_10000640 3300003791 Bacteria 30110
28 Ga0055530_10001109 3300003791 Bacteria 21055
29 Ga0055530_10001882 3300003791 Bacteria 14399
30 Ga0055530_10006145 3300003791 Bacteria 5452
31 Ga0055540_1019067 3300003792 Bacteria 1860
32 Ga0055531_10003059 3300003794 Bacteria 10834
33 Ga0055531_10007373 3300003794 Bacteria 6023
34 Ga0055531_10011274 3300003794 Bacteria 4333
35 Ga0055531_10016355 3300003794 Bacteria 3204
36 Ga0058692_1000011 3300003856 Bacteria 321321
37 Ga0058692_1000024 3300003856 Bacteria 219702
38 Ga0055543_1013040 3300004625 Bacteria 1653
39 Ga0065165_1002736 3300005262 Bacteria 14081
40 Ga0065165_1010939 3300005262 Bacteria 3853
41 Ga0065714_10009016 3300005288 Bacteria 4227
42 Ga0065704_10071703 3300005289 Bacteria 10200
43 Ga0065704_10076732 3300005289 Bacteria 5000
44 Ga0065704_10128408 3300005289 Bacteria 1662
45 Ga0065715_10012305 3300005293 Bacteria 3147
46 Ga0070658_10177696 3300005327 Bacteria 1791
47 Ga0070670_100100864 3300005331 Bacteria 2485
48 Ga0070670_100156956 3300005331 Bacteria 1971
49 Ga0070680_100190554 3300005336 Bacteria 1728
50 Ga0070682_100169727 3300005337 Bacteria 1515
51 Ga0070668_100000607 3300005347 Bacteria 23979
52 Ga0070668_100009092 3300005347 Bacteria 7378
53 Ga0070668_100019657 3300005347 Bacteria 5085
54 Ga0070668_100087572 3300005347 Bacteria 2450
55 Ga0070668_100420886 3300005347 Bacteria 1144
56 Ga0070669_100023797 3300005353 Bacteria 4390
57 Ga0070669_100132064 3300005353 Bacteria 1917
58 Ga0070669_100175340 3300005353 Bacteria 1674
59 Ga0070667_100000084 3300005367 Bacteria 118027
60 Ga0070667_100002831 3300005367 Bacteria 14976
61 Ga0070667_100171886 3300005367 Bacteria 1913
62 Ga0070663_100001725 3300005455 Bacteria 12128
63 Ga0070662_100331794 3300005457 Bacteria 1243
64 Ga0070681_10000099 3300005458 Bacteria 64409
65 Ga0068853_100003385 3300005539 Bacteria 12207
66 Ga0068853_100011396 3300005539 Bacteria 7221
67 Ga0070665_100000761 3300005548 Bacteria 42642
68 Ga0070665_100484567 3300005548 Bacteria 1247
69 Ga0068855_100003953 3300005563 Bacteria 18096
70 Ga0068855_100040863 3300005563 Bacteria 5500
71 Ga0068855_100243301 3300005563 Bacteria 2009
72 Ga0068857_100100071 3300005577 Bacteria 2601
73 Ga0068856_100004755 3300005614 Bacteria 13478
74 Ga0068859_100068744 3300005617 Bacteria 3577
75 Ga0068864_100104414 3300005618 Bacteria 2517
76 Ga0068851_10180523 3300005834 Bacteria 1169
77 Ga0068863_100021234 3300005841 Bacteria 6198
78 Ga0068858_100021944 3300005842 Bacteria 5962
79 Ga0068860_100000027 3300005843 Bacteria 267207
80 Ga0068860_100002090 3300005843 Bacteria 21029
81 Ga0068862_100000941 3300005844 Bacteria 28057
82 Ga0068862_100018174 3300005844 Bacteria 5853
83 Ga0068862_100053959 3300005844 Bacteria 3441
84 Ga0075363_100043438 3300006048 Bacteria 2378
85 Ga0075364_10000020 3300006051 Bacteria 54215
86 Ga0075364_10030639 3300006051 Bacteria 3453
87 Ga0075364_10190130 3300006051 Bacteria 1390
88 Ga0097621_100066959 3300006237 Bacteria 2959
89 Ga0097620_100068745 3300006931 Bacteria 3577
90 Ga0105251_10003611 3300009011 Bacteria 11123
91 Ga0105244_10066704 3300009036 Bacteria 1801
92 Ga0105240_10474464 3300009093 Bacteria 1395
93 Ga0105247_10210387 3300009101 Bacteria 1311
94 Ga0105243_10004934 3300009148 Bacteria 10454
95 Ga0105243_10208306 3300009148 Bacteria 1720
96 Ga0105241_10066212 3300009174 Bacteria 2793
97 Ga0105248_10000418 3300009177 Bacteria 48728
98 Ga0105237_10001616 3300009545 Bacteria 29259
99 Ga0105237_10056862 3300009545 Bacteria 3915
100 Ga0105238_10045322 3300009551 Bacteria 4443
101 Ga0105238_10107971 3300009551 Bacteria 2764
102 Ga0105238_10730381 3300009551 Bacteria 1003
103 Ga0105249_10049212 3300009553 Bacteria 3844
104 Ga0105032_102296 3300009979 Bacteria 1717
105 Ga0105030_103098 3300009987 Bacteria 1439
106 Ga0105028_107039 3300009993 Bacteria 1175
107 Ga0105239_10001674 3300010375 Bacteria 29219
108 Ga0105239_10036560 3300010375 Bacteria 5391
109 Ga0105239_10038333 3300010375 Bacteria 5252
110 Ga0157371_10000154 3300013102 Bacteria 100237
111 Ga0157371_10194713 3300013102 Bacteria 1452
112 Ga0157370_10006946 3300013104 Bacteria 12369
113 Ga0157370_10012599 3300013104 Bacteria 8763
114 Ga0157370_10079575 3300013104 Bacteria 3086
115 Ga0157369_10010793 3300013105 Bacteria 10401
116 Ga0163162_10304141 3300013306 Bacteria 1727
117 Ga0157372_10082779 3300013307 Bacteria 3634
118 Ga0163163_10433990 3300014325 Bacteria 1373
119 Ga0182008_10000142 3300014497 Bacteria 55320
120 Ga0157379_10116700 3300014968 Bacteria 2401
121 Ga0157376_10077876 3300014969 Bacteria 2837
122 Ga0157376_10317136 3300014969 Bacteria 1481
123 Ga0182006_1015218 3300015261 Bacteria 3300
124 Ga0182006_1036886 3300015261 Bacteria 1942
125 Ga0182007_10000287 3300015262 Bacteria 33403
126 Ga0182005_1000388 3300015265 Bacteria 24055
127 Ga0182005_1003131 3300015265 Bacteria 5689
128 Ga0183365_10001 3300015684 Bacteria 2090444
129 Ga0183360_10001 3300015689 Bacteria 3943671
130 Ga0163161_10001350 3300017792 Bacteria 18251
131 Ga0209674_102876 3300025226 Bacteria 3421
132 Ga0209437_101300 3300025233 Bacteria 6698
133 Ga0207425_1000030 3300025245 Bacteria 268200
134 Ga0209026_1000638 3300025250 Bacteria 21767
135 Ga0209148_1007868 3300025254 Bacteria 2179
136 Ga0209129_1000063 3300025258 Bacteria 240205
137 Ga0209565_1000022 3300025263 Bacteria 390888
138 Ga0209565_1000048 3300025263 Bacteria 224961
139 Ga0209673_1000001 3300025273 Bacteria 3176258
140 Ga0209673_1000104 3300025273 Bacteria 186569
141 Ga0209130_1017803 3300025284 Bacteria 1683
142 Ga0209675_1000045 3300025291 Bacteria 225750
143 Ga0209675_1000048 3300025291 Bacteria 221457
144 Ga0209675_1007905 3300025291 Bacteria 3990
145 Ga0209676_1000024 3300025292 Bacteria 578839
146 Ga0209676_1000091 3300025292 Bacteria 251328
147 Ga0209676_1000117 3300025292 Bacteria 203251
148 Ga0209676_1001624 3300025292 Bacteria 19895
149 Ga0209676_1002128 3300025292 Bacteria 15135
150 Ga0209676_1002569 3300025292 Bacteria 12546
151 Ga0209025_1000005 3300025294 Bacteria 1272149
152 Ga0209025_1000013 3300025294 Bacteria 871757
153 Ga0209025_1004696 3300025294 Bacteria 11657
154 Ga0209025_1005156 3300025294 Bacteria 10822
155 Ga0209025_1022446 3300025294 Bacteria 3344
156 Ga0209564_1000001 3300025295 Bacteria 3176258
157 Ga0209564_1000213 3300025295 Bacteria 132985
158 Ga0209564_1003044 3300025295 Bacteria 11921
159 Ga0209758_1000014 3300025297 Bacteria 871757
160 Ga0209758_1000404 3300025297 Bacteria 74016
161 Ga0209758_1034841 3300025297 Bacteria 1995
162 Ga0209758_1045019 3300025297 Bacteria 1606
163 Ga0209050_1000603 3300025298 Bacteria 57120
164 Ga0209050_1001495 3300025298 Bacteria 24789
165 Ga0209050_1001888 3300025298 Bacteria 20105
166 Ga0209050_1001947 3300025298 Bacteria 19566
167 Ga0209050_1008671 3300025298 Bacteria 5368
168 Ga0209050_1025533 3300025298 Bacteria 2003
169 Ga0209256_1000002 3300025299 Bacteria 1906740
170 Ga0209256_1002292 3300025299 Bacteria 16094
171 Ga0209256_1004724 3300025299 Bacteria 8337
172 Ga0209256_1007389 3300025299 Bacteria 5432
173 Ga0209051_1001112 3300025303 Bacteria 24636
174 Ga0209051_1005932 3300025303 Bacteria 7012
175 Ga0209257_1000062 3300025304 Bacteria 362413
176 Ga0209257_1000122 3300025304 Bacteria 219678
177 Ga0209257_1000217 3300025304 Bacteria 136049
178 Ga0209257_1000227 3300025304 Bacteria 133512
179 Ga0209257_1000243 3300025304 Bacteria 126291
180 Ga0209257_1000507 3300025304 Bacteria 68362
181 Ga0209257_1001747 3300025304 Bacteria 24118
182 Ga0209257_1002061 3300025304 Bacteria 21277
183 Ga0209257_1002924 3300025304 Bacteria 15742
184 Ga0207713_1000327 3300025735 Bacteria 53351
185 Ga0207647_10000190 3300025904 Bacteria 49689
186 Ga0207707_10000128 3300025912 Bacteria 78104
187 Ga0207671_10002248 3300025914 Bacteria 20904
188 Ga0207671_10054672 3300025914 Bacteria 2957
189 Ga0207681_10010879 3300025923 Bacteria 5589
190 Ga0207694_10111863 3300025924 Bacteria 2173
191 Ga0207650_10153192 3300025925 Bacteria 1821
192 Ga0207644_10001122 3300025931 Bacteria 17189
193 Ga0207644_10001250 3300025931 Bacteria 16343
194 Ga0207644_10044268 3300025931 Bacteria 3162
195 Ga0207709_10000562 3300025935 Bacteria 31535
196 Ga0207709_10017660 3300025935 Bacteria 3984
197 Ga0207704_10000424 3300025938 Bacteria 18950
198 Ga0207691_10115826 3300025940 Bacteria 2379
199 Ga0207711_10000503 3300025941 Bacteria 40349
200 Ga0207712_10000699 3300025961 Bacteria 25897
201 Ga0207668_10000042 3300025972 Bacteria 103877
202 Ga0207668_10002020 3300025972 Bacteria 11843
203 Ga0207668_10005431 3300025972 Bacteria 7500
204 Ga0207668_10038238 3300025972 Bacteria 3218
205 Ga0207658_10000286 3300025986 Bacteria 52832
206 Ga0207658_10000979 3300025986 Bacteria 23565
207 Ga0207658_10031728 3300025986 Bacteria 3754
208 Ga0207639_10012801 3300026041 Bacteria 5853
209 Ga0207639_10051268 3300026041 Bacteria 3138
210 Ga0207639_10055470 3300026041 Bacteria 3033
211 Ga0207639_10387895 3300026041 Bacteria 1256
212 Ga0207678_10000645 3300026067 Bacteria 32076
213 Ga0207702_10010075 3300026078 Bacteria 7922
214 Ga0207641_10026303 3300026088 Bacteria 4802
215 Ga0207641_10037118 3300026088 Bacteria 4068
216 Ga0207641_10056692 3300026088 Bacteria 3330
217 Ga0207675_100006868 3300026118 Bacteria 10775
218 Ga0207675_100028844 3300026118 Bacteria 5170
219 Ga0209371_1000007 3300027312 Bacteria 1050654
220 Ga0209371_1000016 3300027312 Bacteria 646301
221 Ga0209969_1000949 3300027360 Bacteria 3938
222 Ga0209970_1014492 3300027614 Bacteria 1310
223 Ga0209970_1019480 3300027614 Bacteria 1143
224 Ga0209983_1008052 3300027665 Bacteria 2155
225 Ga0209974_10016387 3300027876 Bacteria 2461
226 Ga0268266_10006936 3300028379 Bacteria 10302
227 Ga0268266_10074189 3300028379 Bacteria 2954
228 Ga0268265_10000705 3300028380 Bacteria 32878
229 Ga0268265_10003476 3300028380 Bacteria 11311
230 Ga0268265_10019323 3300028380 Bacteria 4733
231 Ga0268265_10036833 3300028380 Bacteria 3586
232 Ga0268264_10000181 3300028381 Bacteria 134092
233 Ga0268264_10022217 3300028381 Bacteria 5179
234 Ga0268256_1000008 3300030500 Bacteria 1050654
235 Ga0268256_1000015 3300030500 Bacteria 646300
236 Ga0307511_10007848 3300030521 Bacteria 10716
237 Ga0314311_1188486 3300030733 Bacteria 7455
238 Ga0316183_1212845 3300030742 Bacteria 5989
239 Ga0316182_1072001 3300030745 Bacteria 1767
240 Ga0265327_10002110 3300031251 Bacteria 22060
241 Ga0316575_10091131 3300031665 Bacteria 1235
242 Ga0316578_10189053 3300031728 Bacteria 1241
243 Ga0307516_10244635 3300031730 Bacteria 1491
244 Ga0307413_10006930 3300031824 Bacteria 5218
245 Ga0307413_10025394 3300031824 Bacteria 3248
246 Ga0307413_10055227 3300031824 Bacteria 2415
247 Ga0307413_10134662 3300031824 Bacteria 1697
248 Ga0307413_10233751 3300031824 Bacteria 1352
249 Ga0307410_10076723 3300031852 Bacteria 2333
250 Ga0307410_10204050 3300031852 Bacteria 1511
251 Ga0307406_10041460 3300031901 Bacteria 2868
252 Ga0307406_10144363 3300031901 Bacteria 1689
253 Ga0307412_10003533 3300031911 Bacteria 8679
254 Ga0307414_10001661 3300032004 Bacteria 11568
255 Ga0307414_10005182 3300032004 Bacteria 7154
256 Ga0307414_10005983 3300032004 Bacteria 6741
257 Ga0307414_10053980 3300032004 Bacteria 2806
258 Ga0307414_10089784 3300032004 Bacteria 2278
259 Ga0307411_10027429 3300032005 Bacteria 3446
260 Ga0307411_10099365 3300032005 Bacteria 2054
261 Ga0373935_0242761 3300035692 Bacteria 1258
262 Ga0373947_0046522 3300035725 Bacteria 2599
263 Ga0373925_0094190 3300037068 Bacteria 2293
264 Ga0395899_0002440 3300037312 Bacteria 15116
265 Ga0395899_0033132 3300037312 Bacteria 3881
266 Ga0395900_0005519 3300037418 Bacteria 13242
267 Ga0395900_0097546 3300037418 Bacteria 3020
268 Ga0395898_0003119 3300037466 Bacteria 18715
269 Ga0395898_0218014 3300037466 Bacteria 1820
270 Ga0395905_0000306 3300037471 Bacteria 71299
271 Ga0395905_0003431 3300037471 Bacteria 16959
272 Ga0395905_0017994 3300037471 Bacteria 6709
273 Ga0395905_0115456 3300037471 Bacteria 2523
274 Ga0395901_0000008 3300038443 Bacteria 495962
275 Ga0395901_0085927 3300038443 Bacteria 3289
276 Ga0395901_0116952 3300038443 Bacteria 2801
277 Ga0237819_00617 3300038705 Bacteria 11655
278 Ga0439447_014994 3300041407 Bacteria 2160
279 Ga0439461_0001515 3300041410 Bacteria 3598
280 Ga0439466_0080247 3300041411 Bacteria 1030
281 Ga0439465_0001771 3300041413 Bacteria 7065
282 Ga0451789_1097732 3300041443 Bacteria 1230
283 Ga0451791_0323233 3300041451 Bacteria 2775
284 Ga0451800_0256372 3300041459 Bacteria 2584
285 Ga0451806_443465 3300041462 Bacteria 2552
286 Ga0451804_0805076 3300041463 Bacteria 2122
287 Ga0451807_0834515 3300041486 Bacteria 1163
288 Ga0451807_0894115 3300041486 Bacteria 2501
289 Ga0451837_0914410 3300041494 Bacteria 5007
290 Ga0451837_1799586 3300041494 Bacteria 1206
291 Ga0439432_007727 3300042006 Bacteria 3799
292 Ga0439449_0025171 3300042007 Bacteria 2224
293 Ga0439449_0033924 3300042007 Bacteria 1901
294 Ga0439457_021330 3300042014 Bacteria 1437
295 Ga0450911_000694 3300042115 Bacteria 9910
296 Ga0451577_0038271 3300042876 Bacteria 4314
297 Ga0466972_0003140 3300044658 Bacteria 8202
298 Ga0466982_0000071 3300044672 Bacteria 27759
299 Ga0453684_0072777 3300044712 Bacteria 4337
300 Ga0453684_0075938 3300044712 Bacteria 4221
301 Ga0466970_0005210 3300044765 Bacteria 6434
302 Ga0466957_0129763 3300044842 Bacteria 1614
303 Ga0466959_0029308 3300045049 Bacteria 4078
304 Ga0466959_0138055 3300045049 Bacteria 1724
305 Ga0495629_0024037 3300046459 Bacteria 4340
306 Ga0495638_0001842 3300046460 Bacteria 18352
307 Ga0495607_0013742 3300046501 Bacteria 5292
308 Ga0495606_0015036 3300046507 Bacteria 5994
309 Ga0495606_0117762 3300046507 Bacteria 1594
310 Ga0495610_0004733 3300046512 Bacteria 9931
311 Ga0495628_0200604 3300046516 Bacteria 1503
312 Ga0495631_0002006 3300046518 Bacteria 11866
313 Ga0495643_0001695 3300046522 Bacteria 19192
314 Ga0495643_0047457 3300046522 Bacteria 2325
315 Ga0495663_0001507 3300046525 Bacteria 7317
316 Ga0495663_0001522 3300046525 Bacteria 7294
317 Ga0495609_0071507 3300046538 Bacteria 1524
318 Ga0495597_0001334 3300046542 Bacteria 17978
319 Ga0495645_0071775 3300046543 Bacteria 2496
320 Ga0495622_0001841 3300046557 Bacteria 10466
321 Ga0495633_0011620 3300046558 Bacteria 4735
322 Ga0495633_0084000 3300046558 Bacteria 1481
323 Ga0495656_0005708 3300046615 Bacteria 4314
324 Ga0495668_0003826 3300046616 Bacteria 11022
325 Ga0495668_0026908 3300046616 Bacteria 3261
326 Ga0495625_0036689 3300046660 Bacteria 3601
327 Ga0495669_0012354 3300046684 Bacteria 3635
328 Ga0495671_0010539 3300046692 Bacteria 5113
329 Ga0495636_0035328 3300047318 Bacteria 2058
330 Ga0495672_0000073 3300047320 Bacteria 179398
331 Ga0495686_0006390 3300047472 Bacteria 9035
332 Ga0495686_0014183 3300047472 Bacteria 5494
333 Ga0495686_0018283 3300047472 Bacteria 4708
334 Ga0496109_0038143 3300048912 Bacteria 4343
335 Ga0496112_0013813 3300048915 Bacteria 7470
336 Ga0496112_0247456 3300048915 Bacteria 1734
337 Ga0496113_0030177 3300048916 Bacteria 3922
338 Ga0496114_0006407 3300048917 Bacteria 9269
339 Ga0496114_0344446 3300048917 Bacteria 1318
340 Ga0496114_0503803 3300048917 Bacteria 1071
341 Ga0496115_0000065 3300048918 Bacteria 98148
342 Ga0496116_0006364 3300048919 Bacteria 10740
343 Ga0496117_0002324 3300048920 Bacteria 24332
344 Ga0496117_0002722 3300048920 Bacteria 21720
345 Ga0496117_0004814 3300048920 Bacteria 14614
346 Ga0496117_0025051 3300048920 Bacteria 4700
347 Ga0496118_0000344 3300048921 Bacteria 78989
348 Ga0496118_0001379 3300048921 Bacteria 36605
349 Ga0496118_0002063 3300048921 Bacteria 28310
350 Ga0496118_0003656 3300048921 Bacteria 19100
351 Ga0496118_0010479 3300048921 Bacteria 9176
352 Ga0496118_0106270 3300048921 Bacteria 1878
353 Ga0496118_0136338 3300048921 Bacteria 1565
354 Ga0496119_0014839 3300048922 Bacteria 6059
355 Ga0496119_0016283 3300048922 Bacteria 5667
356 Ga0496120_0002285 3300048923 Bacteria 19880
357 Ga0496121_0000035 3300048924 Bacteria 374316
358 Ga0496121_0000524 3300048924 Bacteria 73122
359 Ga0496121_0008043 3300048924 Bacteria 12572
360 Ga0496121_0096858 3300048924 Bacteria 2288
361 Ga0496122_0000440 3300048925 Bacteria 87364
362 Ga0496122_0003858 3300048925 Bacteria 19242
363 Ga0496122_0008107 3300048925 Bacteria 11448
364 Ga0496122_0017263 3300048925 Bacteria 6761
365 Ga0496122_0028905 3300048925 Bacteria 4688
366 Ga0496123_0000407 3300048926 Bacteria 78763
367 Ga0496123_0000669 3300048926 Bacteria 56717
368 Ga0496123_0072013 3300048926 Bacteria 2152
369 Ga0496124_0000009 3300048927 Bacteria 734820
370 Ga0496124_0003480 3300048927 Bacteria 19168
371 Ga0496124_0004112 3300048927 Bacteria 17192
372 Ga0496124_0007146 3300048927 Bacteria 11949
373 Ga0496124_0022002 3300048927 Bacteria 5860
374 Ga0496124_0027564 3300048927 Bacteria 5097
375 Ga0496124_0286301 3300048927 Bacteria 1198
376 Ga0496125_0042641 3300048928 Bacteria 3862
377 Ga0496125_0056501 3300048928 Bacteria 3186
378 Ga0496125_0119568 3300048928 Bacteria 1883
379 Ga0496126_0000185 3300048929 Bacteria 140051
380 Ga0496126_0078108 3300048929 Bacteria 2934
381 Ga0501032_0004802 3300049569 Bacteria 10133
382 Ga0501033_0000632 3300049570 Bacteria 32512
383 Ga0501034_0001021 3300049571 Bacteria 40111
384 Ga0501034_0002909 3300049571 Bacteria 19882
385 Ga0501034_0007089 3300049571 Bacteria 11958
386 Ga0501034_0007363 3300049571 Bacteria 11724
387 Ga0501037_0001300 3300049573 Bacteria 18362
388 Ga0501043_0001641 3300049579 Bacteria 19430
389 Ga0501043_0006239 3300049579 Bacteria 9571
390 Ga0501047_0005066 3300049581 Bacteria 12366
391 Ga0501047_0008914 3300049581 Bacteria 9469
392 Ga0501047_0089378 3300049581 Bacteria 2957
393 Ga0501048_0167821 3300049582 Bacteria 1554
394 Ga0501068_0008100 3300049584 Bacteria 5833
395 Ga0501068_0045474 3300049584 Bacteria 2645
396 Ga0501069_0035695 3300049585 Bacteria 2740
397 Ga0501070_0016485 3300049586 Bacteria 6207
398 Ga0501070_0052716 3300049586 Bacteria 3376
399 Ga0501072_0013583 3300049588 Bacteria 6233
400 Ga0501073_0004874 3300049589 Bacteria 10072
401 Ga0501073_0005150 3300049589 Bacteria 9810
402 Ga0501073_0089365 3300049589 Bacteria 2141
403 Ga0501074_0039435 3300049590 Bacteria 3421
404 Ga0501257_000397 3300049686 Bacteria 8488
405 Ga0501080_0015527 3300049742 Bacteria 7022
406 Ga0501080_0034962 3300049742 Bacteria 4691
407 Ga0501080_0089295 3300049742 Bacteria 2862
408 Ga0501080_0331845 3300049742 Bacteria 1375
409 Ga0501035_0017292 3300049822 Bacteria 6648
410 Ga0501044_0007196 3300049823 Bacteria 12237
411 Ga0501044_0020080 3300049823 Bacteria 7133
412 Ga0501044_0046980 3300049823 Bacteria 4467
413 Ga0501044_0285967 3300049823 Bacteria 1581
414 Ga0501045_0176436 3300049824 Bacteria 1592
415 nmdc:mga00v17_124837_c1 3300050491 Bacteria 1642
416 nmdc:mga00v17_202_c2 3300050491 Bacteria 31082
417 nmdc:mga00v17_60541_c1 3300050491 Bacteria 2326
418 Ga0500635_0000239 3300053080 Bacteria 24302
419 Ga0500643_005240 3300053087 Bacteria 5635
420 Ga0500643_057354 3300053087 Bacteria 1099
421 Ga0500651_0016628 3300053093 Bacteria 4529
422 Ga0500641_0000870 3300053096 Bacteria 10789
423 Ga0500555_000733 3300053103 Bacteria 12145
424 Ga0500556_0005726 3300053104 Bacteria 3516
425 Ga0500562_000233 3300053108 Bacteria 14584
426 Ga0500562_004437 3300053108 Bacteria 3551
427 Ga0500569_002879 3300053109 Bacteria 3447
428 Ga0500595_004941 3300053119 Bacteria 5889
429 Ga0500608_029015 3300053122 Bacteria 2614
430 Ga0500642_0004345 3300053130 Bacteria 4425
431 Ga0500559_0015905 3300053136 Bacteria 3176
432 Ga0500559_0025849 3300053136 Bacteria 2500
433 Ga0500568_0001533 3300053139 Bacteria 14697
434 Ga0500590_008448 3300053148 Bacteria 5141
435 Ga0500634_0000048 3300053161 Bacteria 55497
436 Ga0500637_0045985 3300053178 Bacteria 2477
437 Ga0500645_006423 3300053730 Bacteria 4198
438 Ga0500596_000589 3300053735 Bacteria 6959
439 Ga0501082_0000606 3300060353 Bacteria 31610
440 2525556914 2524614729 Bacteria 3091755
441 2547500012 2547132130 Bacteria 4660562
442 2572253564 2571042365 Bacteria 3289345
443 2578457598 2576861471 Bacteria 4648976
444 2630648510 2627854209 Bacteria 3093011
445 2643815265 2643221559 Bacteria 4424915
446 2643879304 2643221573 Bacteria 4784121
447 2643908754 2643221579 Bacteria 4443405
448 2643916182 2643221581 Bacteria 3893603
449 2643939943 2643221586 Bacteria 4446529
450 2643976196 2643221593 Bacteria 6296053
451 2644077001 2643221612 Bacteria 4361984
452 2644528900 2643221695 Bacteria 3441323
453 2644660603 2643221720 Bacteria 4694283
454 2644695315 2643221727 Bacteria 4415595
455 2644697964 2643221728 Bacteria 4797149
456 2747948109 2747842428 Bacteria 4689383
457 2748018287 2747842501 Bacteria 5293829
458 2765579884 2765235840 Bacteria 4663337
459 2816519073 2816332141 Bacteria 4436036
460 2819660073 2818991457 Bacteria 5323295
461 2842394846 2842391507 Bacteria 4486072
462 2842760621 2842757796 Bacteria 3981385
463 2842781105 2842780639 Bacteria 4337790
464 2852650014 2852649853 Bacteria 4036942
465 2852685112 2852684882 Bacteria 5463342
466 2857445545 2857442823 Bacteria 4562550
467 2874222566 2874220319 Bacteria 4594709
468 2894415892 2894414249 Bacteria 4405451
469 2895500815 2895498888 Bacteria 5283788
470 2895516315 2895511927 Bacteria 6802080
471 2895523766 2895522137 Bacteria 3284416
472 2895526653 2895525241 Bacteria 3388457
473 2919090507 2919089067 Bacteria 4560942
474 2919130652 2919130084 Bacteria 5301837
475 2919137559 2919134579 Bacteria 4480386
476 2919516120 2919513703 Bacteria 3844312
477 2919677952 2919675420 Bacteria 3969095
478 2923517964 2923516293 Bacteria 3716336
479 2928498342 2928496128 Bacteria 4631123
480 2929198345 2929195423 Bacteria 5325372
481 2931383977 2931380184 Bacteria 4455911
482 2937614463 2937610967 Bacteria 4618818
483 2939591110 2939589442 Bacteria 4214238
484 2939624603 2939622612 Bacteria 4698046
485 2939628323 2939626828 Bacteria 4695272
486 2941476642 2941475908 Bacteria 4145589
487 2941491137 2941489479 Bacteria 6313767
488 2961049331 2961047084 Bacteria 4594415
489 2961065977 2961064222 Bacteria 4749990
490 2974308218 2974307012 Bacteria 4172388
491 2977248976 2977247770 Bacteria 4160543
492 2984516573 2984514374 Bacteria 4172479
493 2987607368 2987605356 Bacteria 4187822
494 2995952068 2995948881 Bacteria 6358104
495 8002872535 8002869464 Bacteria 3588529
496 8003014574 8003014200 Bacteria 4059994
497 8021624517 8021622325 Bacteria 4844743
498 8021627615 8021626552 Bacteria 4665214
499 8021650738 8021648035 Bacteria 4772378
500 Ga0182006_1008339
501 SwRhRL2b_contig_1996156
502 JGI24736J21556_1001670
503 JGI25152J39213_1000106
504 JGI25150J39212_1000114
505 JGI25151J46595_10000128
506 JGI25151J46595_10001018
507 JGI25151J46595_10017863
508 JGI25153J46596_10000089
509 rootH2_10005302
510 rootH1_10212468
511 Ga0055526_1000021
512 Ga0055526_1003786
513 Ga0055537_1000141
514 Ga0055537_1000215
515 Ga0055524_1000128
516 Ga0055536_1002676
517 Ga0055536_1002898
518 Ga0055536_1003007
519 Ga0055536_1005248
520 Ga0055536_1007116
521 Ga0055534_1000054
522 Ga0055534_1000086
523 Ga0055534_1018470
524 Ga0055528_1000009
525 Ga0055528_1001008
526 Ga0055530_10000640
527 Ga0055530_10001109
528 Ga0055530_10001882
529 Ga0055530_10006145
530 Ga0055540_1019067
531 Ga0055531_10003059
532 Ga0055531_10007373
533 Ga0055531_10011274
534 Ga0055531_10016355
535 Ga0058692_1000011
536 Ga0058692_1000024
537 Ga0055543_1013040
538 Ga0065165_1002736
539 Ga0065165_1010939
540 Ga0065714_10009016
541 Ga0065704_10071703
542 Ga0065704_10076732
543 Ga0065704_10128408
544 Ga0065715_10012305
545 Ga0070658_10177696
546 Ga0070670_100100864
547 Ga0070670_100156956
548 Ga0070680_100190554
549 Ga0070682_100169727
550 Ga0070668_100000607
551 Ga0070668_100009092
552 Ga0070668_100019657
553 Ga0070668_100087572
554 Ga0070668_100420886
555 Ga0070669_100023797
556 Ga0070669_100132064
557 Ga0070669_100175340
558 Ga0070667_100000084
559 Ga0070667_100002831
560 Ga0070667_100171886
561 Ga0070663_100001725
562 Ga0070662_100331794
563 Ga0070681_10000099
564 Ga0068853_100003385
565 Ga0068853_100011396
566 Ga0070665_100000761
567 Ga0070665_100484567
568 Ga0068855_100003953
569 Ga0068855_100040863
570 Ga0068855_100243301
571 Ga0068857_100100071
572 Ga0068856_100004755
573 Ga0068859_100068744
574 Ga0068864_100104414
575 Ga0068851_10180523
576 Ga0068863_100021234
577 Ga0068858_100021944
578 Ga0068860_100000027
579 Ga0068860_100002090
580 Ga0068862_100000941
581 Ga0068862_100018174
582 Ga0068862_100053959
583 Ga0075363_100043438
584 Ga0075364_10000020
585 Ga0075364_10030639
586 Ga0075364_10190130
587 Ga0097621_100066959
588 Ga0097620_100068745
589 Ga0105251_10003611
590 Ga0105244_10066704
591 Ga0105240_10474464
592 Ga0105247_10210387
593 Ga0105243_10004934
594 Ga0105243_10208306
595 Ga0105241_10066212
596 Ga0105248_10000418
597 Ga0105237_10001616
598 Ga0105237_10056862
599 Ga0105238_10045322
600 Ga0105238_10107971
601 Ga0105238_10730381
602 Ga0105249_10049212
603 Ga0105032_102296
604 Ga0105030_103098
605 Ga0105028_107039
606 Ga0105239_10001674
607 Ga0105239_10036560
608 Ga0105239_10038333
609 Ga0157371_10000154
610 Ga0157371_10194713
611 Ga0157370_10006946
612 Ga0157370_10012599
613 Ga0157370_10079575
614 Ga0157369_10010793
615 Ga0163162_10304141
616 Ga0157372_10082779
617 Ga0163163_10433990
618 Ga0182008_10000142
619 Ga0157379_10116700
620 Ga0157376_10077876
621 Ga0157376_10317136
622 Ga0182006_1015218
623 Ga0182006_1036886
624 Ga0182007_10000287
625 Ga0182005_1000388
626 Ga0182005_1003131
627 Ga0183365_10001
628 Ga0183360_10001
629 Ga0163161_10001350
630 Ga0209674_102876
631 Ga0209437_101300
632 Ga0207425_1000030
633 Ga0209026_1000638
634 Ga0209148_1007868
635 Ga0209129_1000063
636 Ga0209565_1000022
637 Ga0209565_1000048
638 Ga0209673_1000001
639 Ga0209673_1000104
640 Ga0209130_1017803
641 Ga0209675_1000045
642 Ga0209675_1000048
643 Ga0209675_1007905
644 Ga0209676_1000024
645 Ga0209676_1000091
646 Ga0209676_1000117
647 Ga0209676_1001624
648 Ga0209676_1002128
649 Ga0209676_1002569
650 Ga0209025_1000005
651 Ga0209025_1000013
652 Ga0209025_1004696
653 Ga0209025_1005156
654 Ga0209025_1022446
655 Ga0209564_1000001
656 Ga0209564_1000213
657 Ga0209564_1003044
658 Ga0209758_1000014
659 Ga0209758_1000404
660 Ga0209758_1034841
661 Ga0209758_1045019
662 Ga0209050_1000603
663 Ga0209050_1001495
664 Ga0209050_1001888
665 Ga0209050_1001947
666 Ga0209050_1008671
667 Ga0209050_1025533
668 Ga0209256_1000002
669 Ga0209256_1002292
670 Ga0209256_1004724
671 Ga0209256_1007389
672 Ga0209051_1001112
673 Ga0209051_1005932
674 Ga0209257_1000062
675 Ga0209257_1000122
676 Ga0209257_1000217
677 Ga0209257_1000227
678 Ga0209257_1000243
679 Ga0209257_1000507
680 Ga0209257_1001747
681 Ga0209257_1002061
682 Ga0209257_1002924
683 Ga0207713_1000327
684 Ga0207647_10000190
685 Ga0207707_10000128
686 Ga0207671_10002248
687 Ga0207671_10054672
688 Ga0207681_10010879
689 Ga0207694_10111863
690 Ga0207650_10153192
691 Ga0207644_10001122
692 Ga0207644_10001250
693 Ga0207644_10044268
694 Ga0207709_10000562
695 Ga0207709_10017660
696 Ga0207704_10000424
697 Ga0207691_10115826
698 Ga0207711_10000503
699 Ga0207712_10000699
700 Ga0207668_10000042
701 Ga0207668_10002020
702 Ga0207668_10005431
703 Ga0207668_10038238
704 Ga0207658_10000286
705 Ga0207658_10000979
706 Ga0207658_10031728
707 Ga0207639_10012801
708 Ga0207639_10051268
709 Ga0207639_10055470
710 Ga0207639_10387895
711 Ga0207678_10000645
712 Ga0207702_10010075
713 Ga0207641_10026303
714 Ga0207641_10037118
715 Ga0207641_10056692
716 Ga0207675_100006868
717 Ga0207675_100028844
718 Ga0209371_1000007
719 Ga0209371_1000016
720 Ga0209969_1000949
721 Ga0209970_1014492
722 Ga0209970_1019480
723 Ga0209983_1008052
724 Ga0209974_10016387
725 Ga0268266_10006936
726 Ga0268266_10074189
727 Ga0268265_10000705
728 Ga0268265_10003476
729 Ga0268265_10019323
730 Ga0268265_10036833
731 Ga0268264_10000181
732 Ga0268264_10022217
733 Ga0268256_1000008
734 Ga0268256_1000015
735 Ga0307511_10007848
736 Ga0314311_1188486
737 Ga0316183_1212845
738 Ga0316182_1072001
739 Ga0265327_10002110
740 Ga0316575_10091131
741 Ga0316578_10189053
742 Ga0307516_10244635
743 Ga0307413_10006930
744 Ga0307413_10025394
745 Ga0307413_10055227
746 Ga0307413_10134662
747 Ga0307413_10233751
748 Ga0307410_10076723
749 Ga0307410_10204050
750 Ga0307406_10041460
751 Ga0307406_10144363
752 Ga0307412_10003533
753 Ga0307414_10001661
754 Ga0307414_10005182
755 Ga0307414_10005983
756 Ga0307414_10053980
757 Ga0307414_10089784
758 Ga0307411_10027429
759 Ga0307411_10099365
760 Ga0373935_0242761
761 Ga0373947_0046522
762 Ga0373925_0094190
763 Ga0395899_0002440
764 Ga0395899_0033132
765 Ga0395900_0005519
766 Ga0395900_0097546
767 Ga0395898_0003119
768 Ga0395898_0218014
769 Ga0395905_0000306
770 Ga0395905_0003431
771 Ga0395905_0017994
772 Ga0395905_0115456
773 Ga0395901_0000008
774 Ga0395901_0085927
775 Ga0395901_0116952
776 Ga0237819_00617
777 Ga0439447_014994
778 Ga0439461_0001515
779 Ga0439466_0080247
780 Ga0439465_0001771
781 Ga0451789_1097732
782 Ga0451791_0323233
783 Ga0451800_0256372
784 Ga0451806_443465
785 Ga0451804_0805076
786 Ga0451807_0834515
787 Ga0451807_0894115
788 Ga0451837_0914410
789 Ga0451837_1799586
790 Ga0439432_007727
791 Ga0439449_0025171
792 Ga0439449_0033924
793 Ga0439457_021330
794 Ga0450911_000694
795 Ga0451577_0038271
796 Ga0466972_0003140
797 Ga0466982_0000071
798 Ga0453684_0072777
799 Ga0453684_0075938
800 Ga0466970_0005210
801 Ga0466957_0129763
802 Ga0466959_0029308
803 Ga0466959_0138055
804 Ga0495629_0024037
805 Ga0495638_0001842
806 Ga0495607_0013742
807 Ga0495606_0015036
808 Ga0495606_0117762
809 Ga0495610_0004733
810 Ga0495628_0200604
811 Ga0495631_0002006
812 Ga0495643_0001695
813 Ga0495643_0047457
814 Ga0495663_0001507
815 Ga0495663_0001522
816 Ga0495609_0071507
817 Ga0495597_0001334
818 Ga0495645_0071775
819 Ga0495622_0001841
820 Ga0495633_0011620
821 Ga0495633_0084000
822 Ga0495656_0005708
823 Ga0495668_0003826
824 Ga0495668_0026908
825 Ga0495625_0036689
826 Ga0495669_0012354
827 Ga0495671_0010539
828 Ga0495636_0035328
829 Ga0495672_0000073
830 Ga0495686_0006390
831 Ga0495686_0014183
832 Ga0495686_0018283
833 Ga0496109_0038143
834 Ga0496112_0013813
835 Ga0496112_0247456
836 Ga0496113_0030177
837 Ga0496114_0006407
838 Ga0496114_0344446
839 Ga0496114_0503803
840 Ga0496115_0000065
841 Ga0496116_0006364
842 Ga0496117_0002324
843 Ga0496117_0002722
844 Ga0496117_0004814
845 Ga0496117_0025051
846 Ga0496118_0000344
847 Ga0496118_0001379
848 Ga0496118_0002063
849 Ga0496118_0003656
850 Ga0496118_0010479
851 Ga0496118_0106270
852 Ga0496118_0136338
853 Ga0496119_0014839
854 Ga0496119_0016283
855 Ga0496120_0002285
856 Ga0496121_0000035
857 Ga0496121_0000524
858 Ga0496121_0008043
859 Ga0496121_0096858
860 Ga0496122_0000440
861 Ga0496122_0003858
862 Ga0496122_0008107
863 Ga0496122_0017263
864 Ga0496122_0028905
865 Ga0496123_0000407
866 Ga0496123_0000669
867 Ga0496123_0072013
868 Ga0496124_0000009
869 Ga0496124_0003480
870 Ga0496124_0004112
871 Ga0496124_0007146
872 Ga0496124_0022002
873 Ga0496124_0027564
874 Ga0496124_0286301
875 Ga0496125_0042641
876 Ga0496125_0056501
877 Ga0496125_0119568
878 Ga0496126_0000185
879 Ga0496126_0078108
880 Ga0501032_0004802
881 Ga0501033_0000632
882 Ga0501034_0001021
883 Ga0501034_0002909
884 Ga0501034_0007089
885 Ga0501034_0007363
886 Ga0501037_0001300
887 Ga0501043_0001641
888 Ga0501043_0006239
889 Ga0501047_0005066
890 Ga0501047_0008914
891 Ga0501047_0089378
892 Ga0501048_0167821
893 Ga0501068_0008100
894 Ga0501068_0045474
895 Ga0501069_0035695
896 Ga0501070_0016485
897 Ga0501070_0052716
898 Ga0501072_0013583
899 Ga0501073_0004874
900 Ga0501073_0005150
901 Ga0501073_0089365
902 Ga0501074_0039435
903 Ga0501257_000397
904 Ga0501080_0015527
905 Ga0501080_0034962
906 Ga0501080_0089295
907 Ga0501080_0331845
908 Ga0501035_0017292
909 Ga0501044_0007196
910 Ga0501044_0020080
911 Ga0501044_0046980
912 Ga0501044_0285967
913 Ga0501045_0176436
914 nmdc:mga00v17_124837_c1
915 nmdc:mga00v17_202_c2
916 nmdc:mga00v17_60541_c1
917 Ga0500635_0000239
918 Ga0500643_005240
919 Ga0500643_057354
920 Ga0500651_0016628
921 Ga0500641_0000870
922 Ga0500555_000733
923 Ga0500556_0005726
924 Ga0500562_000233
925 Ga0500562_004437
926 Ga0500569_002879
927 Ga0500595_004941
928 Ga0500608_029015
929 Ga0500642_0004345
930 Ga0500559_0015905
931 Ga0500559_0025849
932 Ga0500568_0001533
933 Ga0500590_008448
934 Ga0500634_0000048
935 Ga0500637_0045985
936 Ga0500645_006423
937 Ga0500596_000589
938 Ga0501082_0000606
939 2525556914
940 2547500012
941 2572253564
942 2578457598
943 2630648510
944 2643815265
945 2643879304
946 2643908754
947 2643916182
948 2643939943
949 2643976196
950 2644077001
951 2644528900
952 2644660603
953 2644695315
954 2644697964
955 2747948109
956 2748018287
957 2765579884
958 2816519073
959 2819660073
960 2842394846
961 2842760621
962 2842781105
963 2852650014
964 2852685112
965 2857445545
966 2874222566
967 2894415892
968 2895500815
969 2895516315
970 2895523766
971 2895526653
972 2919090507
973 2919130652
974 2919137559
975 2919516120
976 2919677952
977 2923517964
978 2928498342
979 2929198345
980 2931383977
981 2937614463
982 2939591110
983 2939624603
984 2939628323
985 2941476642
986 2941491137
987 2961049331
988 2961065977
989 2974308218
990 2977248976
991 2984516573
992 2987607368
993 2995952068
994 8002872535
995 8003014574
996 8021624517
997 8021627615
998 8021650738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14226

DIOX_N

non-haem dioxygenase in morphine synthesis N-terminal

69

186

0.96

PF03171

2OG-FeII_Oxy

2OG-Fe(II) oxygenase superfamily

230

335

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oox-assembly1.cif.gz_A crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9574 10 314
3oox-assembly2.cif.gz_B crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9574 10 313
3oox-assembly1.cif.gz_A crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9422 10 314
3oox-assembly2.cif.gz_B crystal structure of a putative 2og-fe(ii) oxygenase family protein (cc_0200) from caulobacter crescentus at 1.44 a resolution 0.9421 10 313
5c3p-assembly4.cif.gz_D crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg 0.9101 10 312
ID Description Score Start End Superfamily
3ooxB00 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9567 10 313 2.60.120.330
3ooxB00 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9412 10 313 2.60.120.330
af_K7KER3_4_212_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9158 124 308 2.60.120.330
af_A4I478_1_315_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9107 10 313 2.60.120.330
af_A0A1D6N231_8_340_2.60.120.330 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.9005 8 311 2.60.120.330
ID Description Score Start End GO Terms
AF-A0A0M8MHY5-F1-model_v4 Flavonol synthase 0.9808 119 317
AF-M5D0U2-F1-model_v4 deleted 0.9806 2 305
AF-A0A0P7VAI2-F1-model_v4 2-oxoglutarate-dependent ethylene/succinate-forming enzyme (EC 1.13.12.19) (EC 1.14.20.7) (2-oxoglutarate dioxygenase (ethylene-forming)) (2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming)) 0.9797 10 317 GO:0016491
GO:0046872
AF-A0A432VY05-F1-model_v4 Flavonol synthase 0.9791 10 316 GO:0009693
GO:0016491
GO:0046872
AF-A0A261GKW3-F1-model_v4 Flavonol synthase 0.9789 9 317 GO:0009693
GO:0016491
GO:0046872

Map