F455396

General Info

Members Datasets Scaffolds Average Seq Length
499 336 436 258

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0064739|Ga0395898_0064739_446_1216
Length 256
Sequence MSRLWGVLGVGAVFLASLAAAQNGADPRRSGYQDMGPSLRKVQDDEAANPAMPYVRAGETLWKQKAGQAGKACADCHAEGSMKGVAARYPAISRGADKPVDLEGRINLCRTEHQKAGPLAAESQDLLDLTAYVALQSRGMSIAPPDDPRLAPFRAEGKKLFESREGQLNLSCAICHDNNAEKTLGGAVIPQGHPTGYPVYRIAWQALGSLKRRLRNCMIGMRAEPFDYGSPEYVDLEAYLMDRAKGMKVDAPAVRP

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
14 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
15 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
16 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
17 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
18 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
19 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
20 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
21 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
22 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
23 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
24 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
25 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
26 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
27 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
28 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
29 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
30 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
31 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
32 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
33 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
34 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
35 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
36 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
37 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
38 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
39 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
40 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
41 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
42 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
43 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
44 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
45 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
46 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
47 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
48 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
49 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
50 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
51 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
52 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
53 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
54 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
55 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
113 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
178 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
179 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
180 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
322 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
323 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
324 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
329 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
330 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
331 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
332 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
333 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
334 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
335 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
336 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 0
Isolates 12.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.22
Nodule 8.62
Rhizoplane 7.82
Rhizosphere 62.73
Stem 0
Stem Tuber 0
Unclassified 8.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10013376 3300003215 Bacteria 3468
2 JGI25160J50197_1007102 3300003354 Bacteria 4422
3 Ga0055524_1027963 3300003775 Bacteria 1699
4 Ga0065165_1010604 3300005262 Bacteria 3956
5 Ga0070683_100076181 3300005329 Bacteria 3135
6 Ga0070670_100046539 3300005331 Bacteria 3731
7 Ga0068869_100204188 3300005334 Bacteria 1559
8 Ga0070680_100023775 3300005336 Bacteria 4891
9 Ga0070680_100119741 3300005336 Bacteria 2197
10 Ga0070682_100279061 3300005337 Bacteria 1217
11 Ga0068868_100048941 3300005338 Bacteria 3317
12 Ga0070660_100037797 3300005339 Bacteria 3660
13 Ga0070689_100143561 3300005340 Bacteria 1921
14 Ga0070661_100191217 3300005344 Bacteria 1561
15 Ga0070668_100101314 3300005347 Bacteria 2282
16 Ga0070669_100156285 3300005353 Bacteria 1769
17 Ga0070671_100044655 3300005355 Bacteria 3682
18 Ga0070671_100104083 3300005355 Bacteria 2382
19 Ga0070674_100310311 3300005356 Bacteria 1261
20 Ga0070673_100106590 3300005364 Bacteria 2317
21 Ga0070714_100173277 3300005435 Bacteria 1959
22 Ga0070663_100008949 3300005455 Bacteria 6183
23 Ga0070663_100053262 3300005455 Bacteria 2888
24 Ga0070663_100065159 3300005455 Bacteria 2636
25 Ga0070678_100094705 3300005456 Bacteria 2299
26 Ga0070678_100293777 3300005456 Bacteria 1378
27 Ga0070681_10304038 3300005458 Bacteria 1504
28 Ga0070699_100326955 3300005518 Bacteria 1379
29 Ga0070679_100561983 3300005530 Bacteria 1084
30 Ga0068853_100068998 3300005539 Bacteria 3074
31 Ga0068853_100207247 3300005539 Bacteria 1786
32 Ga0068853_100252508 3300005539 Bacteria 1619
33 Ga0068853_100300458 3300005539 Bacteria 1484
34 Ga0068853_100381944 3300005539 Bacteria 1315
35 Ga0070695_100290061 3300005545 Bacteria 1206
36 Ga0070665_100021601 3300005548 Bacteria 6471
37 Ga0070665_100023384 3300005548 Bacteria 6222
38 Ga0070665_100053413 3300005548 Bacteria 4052
39 Ga0070665_100078654 3300005548 Bacteria 3304
40 Ga0070665_100099122 3300005548 Bacteria 2918
41 Ga0068855_100176362 3300005563 Bacteria 2418
42 Ga0068855_100187602 3300005563 Bacteria 2335
43 Ga0070664_100084031 3300005564 Bacteria 2747
44 Ga0068857_100276573 3300005577 Bacteria 1544
45 Ga0068857_100405401 3300005577 Bacteria 1269
46 Ga0068852_100426524 3300005616 Bacteria 1309
47 Ga0068859_100181183 3300005617 Bacteria 2189
48 Ga0068864_100058929 3300005618 Bacteria 3320
49 Ga0068864_100482813 3300005618 Bacteria 1190
50 Ga0068861_100543530 3300005719 Bacteria 1057
51 Ga0068851_10082500 3300005834 Bacteria 1681
52 Ga0068863_100168707 3300005841 Bacteria 2099
53 Ga0068858_100119984 3300005842 Bacteria 2458
54 Ga0068860_100153207 3300005843 Bacteria 2220
55 Ga0068860_100404460 3300005843 Bacteria 1351
56 Ga0068862_100215475 3300005844 Bacteria 1736
57 Ga0068862_100244654 3300005844 Bacteria 1632
58 Ga0068862_100345350 3300005844 Bacteria 1379
59 Ga0081455_10002982 3300005937 Bacteria 19755
60 Ga0081540_1003851 3300005983 Bacteria 11718
61 Ga0070717_10007544 3300006028 Bacteria 8083
62 Ga0070717_10061397 3300006028 Bacteria 3114
63 Ga0070717_10403065 3300006028 Bacteria 1229
64 Ga0075365_10229899 3300006038 Bacteria 1302
65 Ga0075368_10011424 3300006042 Bacteria 3231
66 Ga0075363_100002488 3300006048 Bacteria 7545
67 Ga0075363_100026304 3300006048 Bacteria 2976
68 Ga0075364_10024940 3300006051 Bacteria 3802
69 Ga0075364_10181953 3300006051 Bacteria 1422
70 Ga0070715_10001127 3300006163 Bacteria 7613
71 Ga0075362_10052802 3300006177 Bacteria 1823
72 Ga0075369_10032260 3300006186 Bacteria 2215
73 Ga0075369_10033876 3300006186 Bacteria 2166
74 Ga0075369_10034387 3300006186 Bacteria 2151
75 Ga0075366_10033470 3300006195 Bacteria 3027
76 Ga0075370_10031839 3300006353 Bacteria 2945
77 Ga0068871_100069423 3300006358 Bacteria 2894
78 Ga0075428_100101949 3300006844 Bacteria 3129
79 Ga0075429_100227680 3300006880 Bacteria 1633
80 Ga0068865_100311655 3300006881 Bacteria 1263
81 Ga0097620_100181187 3300006931 Bacteria 2189
82 Ga0099824_1011502 3300006942 Bacteria 9987
83 Ga0099822_1021826 3300006943 Bacteria 6137
84 Ga0105240_10024721 3300009093 Bacteria 7912
85 Ga0105240_10084695 3300009093 Bacteria 3887
86 Ga0105245_10137591 3300009098 Bacteria 2297
87 Ga0105245_10754062 3300009098 Bacteria 1009
88 Ga0105247_10034754 3300009101 Bacteria 3070
89 Ga0105247_10100789 3300009101 Bacteria 1846
90 Ga0105247_10136111 3300009101 Bacteria 1605
91 Ga0105247_10234014 3300009101 Bacteria 1249
92 Ga0114129_10414231 3300009147 Bacteria 1774
93 Ga0105243_10267575 3300009148 Bacteria 1533
94 Ga0105241_10100450 3300009174 Bacteria 2299
95 Ga0105248_10130483 3300009177 Bacteria 2835
96 Ga0105248_10194824 3300009177 Bacteria 2283
97 Ga0105248_10260394 3300009177 Bacteria 1953
98 Ga0105237_10009950 3300009545 Bacteria 10145
99 Ga0105237_10021234 3300009545 Bacteria 6678
100 Ga0105237_10047158 3300009545 Bacteria 4332
101 Ga0105238_10027647 3300009551 Bacteria 5781
102 Ga0105238_10151847 3300009551 Bacteria 2291
103 Ga0105238_10256812 3300009551 Bacteria 1727
104 Ga0105239_10127564 3300010375 Bacteria 2829
105 Ga0105239_10267093 3300010375 Bacteria 1924
106 Ga0105239_10431855 3300010375 Bacteria 1493
107 Ga0105239_10807034 3300010375 Bacteria 1075
108 Ga0105239_11041703 3300010375 Bacteria 941
109 Ga0105246_10013775 3300011119 Bacteria 5074
110 Ga0157370_10057618 3300013104 Bacteria 3693
111 Ga0157370_10178217 3300013104 Bacteria 1975
112 Ga0157369_10012423 3300013105 Bacteria 9667
113 Ga0157369_10064867 3300013105 Bacteria 3932
114 Ga0157369_10433652 3300013105 Bacteria 1362
115 Ga0157369_10661448 3300013105 Bacteria 1077
116 Ga0157374_10024785 3300013296 Bacteria 5379
117 Ga0157374_10040321 3300013296 Bacteria 4299
118 Ga0157374_10179291 3300013296 Bacteria 2069
119 Ga0157378_10004961 3300013297 Bacteria 11667
120 Ga0157378_10278553 3300013297 Bacteria 1611
121 Ga0163162_10060239 3300013306 Bacteria 3831
122 Ga0163162_10390454 3300013306 Bacteria 1524
123 Ga0163162_10740909 3300013306 Bacteria 1102
124 Ga0157375_10105710 3300013308 Bacteria 2906
125 Ga0157375_10644025 3300013308 Bacteria 1216
126 Ga0163163_10009852 3300014325 Bacteria 8564
127 Ga0163163_10060452 3300014325 Bacteria 3752
128 Ga0163163_10124811 3300014325 Bacteria 2611
129 Ga0163163_10814217 3300014325 Bacteria 997
130 Ga0157380_10245136 3300014326 Bacteria 1618
131 Ga0157377_10063726 3300014745 Bacteria 2112
132 Ga0157377_10351293 3300014745 Bacteria 989
133 Ga0157379_10100952 3300014968 Bacteria 2590
134 Ga0157376_10053421 3300014969 Bacteria 3364
135 Ga0157376_10259121 3300014969 Bacteria 1628
136 Ga0157376_10724361 3300014969 Bacteria 1002
137 Ga0163161_10563434 3300017792 Bacteria 935
138 Ga0209563_100325 3300025230 Bacteria 18742
139 Ga0209677_102346 3300025253 Bacteria 7251
140 Ga0209233_1010275 3300025261 Bacteria 2815
141 Ga0209233_1017593 3300025261 Bacteria 1944
142 Ga0209564_1005325 3300025295 Bacteria 7407
143 Ga0209758_1000011 3300025297 Bacteria 1049685
144 Ga0209758_1000120 3300025297 Bacteria 192212
145 Ga0209758_1001848 3300025297 Bacteria 23245
146 Ga0209758_1008838 3300025297 Bacteria 6412
147 Ga0209256_1010441 3300025299 Bacteria 3886
148 Ga0207426_1006703 3300025302 Bacteria 4942
149 Ga0209051_1060292 3300025303 Bacteria 1198
150 Ga0209257_1001101 3300025304 Bacteria 35153
151 Ga0207647_10008820 3300025904 Bacteria 7199
152 Ga0207705_10199849 3300025909 Bacteria 1514
153 Ga0207654_10020891 3300025911 Bacteria 3476
154 Ga0207671_10212161 3300025914 Bacteria 1515
155 Ga0207671_10245556 3300025914 Bacteria 1407
156 Ga0207693_10007874 3300025915 Bacteria 8752
157 Ga0207657_10421943 3300025919 Bacteria 1048
158 Ga0207649_10163987 3300025920 Bacteria 1542
159 Ga0207652_10304152 3300025921 Bacteria 1439
160 Ga0207694_10040173 3300025924 Bacteria 3601
161 Ga0207700_10172042 3300025928 Bacteria 1807
162 Ga0207644_10386177 3300025931 Bacteria 1142
163 Ga0207644_10409285 3300025931 Bacteria 1110
164 Ga0207669_10157627 3300025937 Bacteria 1599
165 Ga0207665_10001385 3300025939 Bacteria 16335
166 Ga0207665_10402319 3300025939 Bacteria 1043
167 Ga0207691_10661332 3300025940 Bacteria 882
168 Ga0207689_10019353 3300025942 Bacteria 5738
169 Ga0207689_10167098 3300025942 Bacteria 1813
170 Ga0207661_10040025 3300025944 Bacteria 3683
171 Ga0207661_10254792 3300025944 Bacteria 1561
172 Ga0207661_10491514 3300025944 Bacteria 1121
173 Ga0207679_10465174 3300025945 Bacteria 1123
174 Ga0207667_10168621 3300025949 Bacteria 2250
175 Ga0207667_10172122 3300025949 Bacteria 2225
176 Ga0207667_10492745 3300025949 Bacteria 1243
177 Ga0207668_10318838 3300025972 Bacteria 1289
178 Ga0207640_10103726 3300025981 Bacteria 2000
179 Ga0207658_10097909 3300025986 Bacteria 2291
180 Ga0207658_10109147 3300025986 Bacteria 2184
181 Ga0207658_10374355 3300025986 Bacteria 1246
182 Ga0207677_10073769 3300026023 Bacteria 2418
183 Ga0207703_10129128 3300026035 Bacteria 2180
184 Ga0207703_10302095 3300026035 Bacteria 1460
185 Ga0207639_10089016 3300026041 Bacteria 2465
186 Ga0207639_10151261 3300026041 Bacteria 1944
187 Ga0207639_10266205 3300026041 Bacteria 1501
188 Ga0207678_10017857 3300026067 Bacteria 6231
189 Ga0207678_10022393 3300026067 Bacteria 5534
190 Ga0207678_10026311 3300026067 Bacteria 5076
191 Ga0207678_10033211 3300026067 Bacteria 4496
192 Ga0207708_10147525 3300026075 Bacteria 1849
193 Ga0207676_10068020 3300026095 Bacteria 2847
194 Ga0207674_10007720 3300026116 Bacteria 12520
195 Ga0207674_10167564 3300026116 Bacteria 2150
196 Ga0207675_100048212 3300026118 Bacteria 3977
197 Ga0207675_100058719 3300026118 Bacteria 3590
198 Ga0207683_10003797 3300026121 Bacteria 13083
199 Ga0207698_10132646 3300026142 Bacteria 2132
200 Ga0207698_10383176 3300026142 Bacteria 1338
201 Ga0207698_10390739 3300026142 Bacteria 1326
202 Ga0209389_1000043 3300027296 Bacteria 123224
203 Ga0209589_1000011 3300027357 Bacteria 236981
204 Ga0209589_1000047 3300027357 Bacteria 118659
205 Ga0209489_100012 3300027361 Bacteria 236981
206 Ga0209489_100075 3300027361 Bacteria 136991
207 Ga0209700_100019 3300027363 Bacteria 236981
208 Ga0209179_1003275 3300027512 Bacteria 2312
209 Ga0209813_10013523 3300027866 Bacteria 2181
210 Ga0268266_10007625 3300028379 Bacteria 9734
211 Ga0268266_10013446 3300028379 Bacteria 7047
212 Ga0268266_10020198 3300028379 Bacteria 5678
213 Ga0268266_10056470 3300028379 Bacteria 3377
214 Ga0268266_10078485 3300028379 Bacteria 2873
215 Ga0268266_10079803 3300028379 Bacteria 2850
216 Ga0268266_10243092 3300028379 Bacteria 1662
217 Ga0268264_10140299 3300028381 Bacteria 2154
218 Ga0268264_10380531 3300028381 Bacteria 1351
219 Ga0307517_10000279 3300028786 Bacteria 88025
220 Ga0307515_10163370 3300028794 Bacteria 2258
221 Ga0265316_10246791 3300031344 Bacteria 1312
222 Ga0307509_10098111 3300031507 Bacteria 2976
223 Ga0265314_10076536 3300031711 Bacteria 2222
224 Ga0265342_10080689 3300031712 Bacteria 1879
225 Ga0307405_10457121 3300031731 Bacteria 1014
226 Ga0307409_100320888 3300031995 Bacteria 1449
227 Ga0307416_100343260 3300032002 Bacteria 1507
228 Ga0307415_100149979 3300032126 Bacteria 1793
229 Ga0307510_10006305 3300033180 Bacteria 14151
230 Ga0307510_10041581 3300033180 Bacteria 5022
231 Ga0315911_1000003 3300033442 Bacteria 502217
232 Ga0373923_0000267 3300035111 Bacteria 11360
233 Ga0373957_0022105 3300035120 Bacteria 2263
234 Ga0373943_0000795 3300035170 Bacteria 13844
235 Ga0373946_0006225 3300035171 Bacteria 4322
236 Ga0373955_0021671 3300035172 Bacteria 3248
237 Ga0373924_0009206 3300035410 Bacteria 3615
238 Ga0373924_0017906 3300035410 Bacteria 2724
239 Ga0373931_0023469 3300035691 Bacteria 3114
240 Ga0373935_0000536 3300035692 Bacteria 19758
241 Ga0373927_0000898 3300035695 Bacteria 22620
242 Ga0373927_0149061 3300035695 Bacteria 1532
243 Ga0373933_0066575 3300035724 Bacteria 2183
244 Ga0373947_0010479 3300035725 Bacteria 5318
245 Ga0373947_0171304 3300035725 Bacteria 1409
246 Ga0373937_0064227 3300036401 Bacteria 3377
247 Ga0373937_0095987 3300036401 Bacteria 2749
248 Ga0373937_0151428 3300036401 Bacteria 2173
249 Ga0373937_0297000 3300036401 Bacteria 1526
250 Ga0373925_0001796 3300037068 Bacteria 17888
251 Ga0395899_0177879 3300037312 Bacteria 1495
252 Ga0395900_0111107 3300037418 Bacteria 2815
253 Ga0395898_0064739 3300037466 Bacteria 3545
254 Ga0395905_0386390 3300037471 Bacteria 1294
255 Ga0395901_0137905 3300038443 Bacteria 2564
256 Ga0395901_0204268 3300038443 Bacteria 2070
257 Ga0439465_0055995 3300041413 Bacteria 1299
258 Ga0451849_0432353 3300041505 Bacteria 989
259 Ga0451853_2433109 3300041512 Bacteria 1741
260 Ga0466972_0000079 3300044658 Bacteria 90348
261 Ga0466963_0031606 3300044694 Bacteria 3423
262 Ga0466957_0027162 3300044842 Bacteria 3400
263 Ga0466960_0060690 3300044901 Bacteria 1854
264 Ga0466967_0006352 3300045976 Bacteria 8348
265 Ga0495617_058666 3300046452 Bacteria 1275
266 Ga0495603_0000046 3300046455 Bacteria 53187
267 Ga0495603_0002778 3300046455 Bacteria 10319
268 Ga0495603_0180555 3300046455 Bacteria 1221
269 Ga0495603_0240584 3300046455 Bacteria 1042
270 Ga0495629_0000071 3300046459 Bacteria 88879
271 Ga0495629_0065563 3300046459 Bacteria 2535
272 Ga0495641_0009896 3300046461 Bacteria 5611
273 Ga0495651_0227558 3300046462 Bacteria 1286
274 Ga0495650_0121172 3300046471 Bacteria 963
275 Ga0495580_0000057 3300046472 Bacteria 64650
276 Ga0495582_0000111 3300046473 Bacteria 42751
277 Ga0495639_0000108 3300046475 Bacteria 41656
278 Ga0495639_0083076 3300046475 Bacteria 1494
279 Ga0495662_0000992 3300046476 Bacteria 13882
280 Ga0495664_0002718 3300046477 Bacteria 9505
281 Ga0495585_0070948 3300046492 Bacteria 1899
282 Ga0495594_0000133 3300046499 Bacteria 34897
283 Ga0495594_0237949 3300046499 Bacteria 1038
284 Ga0495606_0006998 3300046507 Bacteria 10238
285 Ga0495606_0136524 3300046507 Bacteria 1452
286 Ga0495608_0023395 3300046511 Bacteria 4234
287 Ga0495616_0081220 3300046513 Bacteria 1551
288 Ga0495618_0064992 3300046514 Bacteria 2318
289 Ga0495620_0077867 3300046515 Bacteria 1345
290 Ga0495620_0091398 3300046515 Bacteria 1221
291 Ga0495630_0000959 3300046517 Bacteria 20201
292 Ga0495630_0077623 3300046517 Bacteria 2504
293 Ga0495631_0036622 3300046518 Bacteria 2190
294 Ga0495632_0056495 3300046519 Bacteria 1918
295 Ga0495643_0042317 3300046522 Bacteria 2481
296 Ga0495648_0014927 3300046524 Bacteria 5658
297 Ga0495648_0041864 3300046524 Bacteria 2888
298 Ga0495666_0078399 3300046526 Bacteria 1565
299 Ga0495652_0042099 3300046529 Bacteria 3939
300 Ga0495665_0000001 3300046531 Bacteria 156121
301 Ga0495640_0012179 3300046533 Bacteria 6583
302 Ga0495586_0168797 3300046535 Bacteria 1236
303 Ga0495587_0202775 3300046536 Bacteria 1121
304 Ga0495609_0072783 3300046538 Bacteria 1509
305 Ga0495645_0058108 3300046543 Bacteria 2806
306 Ga0495622_0001363 3300046557 Bacteria 12492
307 Ga0495633_0148817 3300046558 Bacteria 1082
308 Ga0495667_0032071 3300046559 Bacteria 3523
309 Ga0495667_0206994 3300046559 Bacteria 1254
310 Ga0495656_0002642 3300046615 Bacteria 5973
311 Ga0495656_0126518 3300046615 Bacteria 1212
312 Ga0495656_0141170 3300046615 Bacteria 1155
313 Ga0495668_0055701 3300046616 Bacteria 2183
314 Ga0495634_0000046 3300046642 Bacteria 97947
315 Ga0495634_0123320 3300046642 Bacteria 1658
316 Ga0495625_0116759 3300046660 Bacteria 1820
317 Ga0495635_0000338 3300046663 Bacteria 29955
318 Ga0495659_0009434 3300046664 Bacteria 3114
319 Ga0495588_0001464 3300046674 Bacteria 10138
320 Ga0495588_0112999 3300046674 Bacteria 1431
321 Ga0495599_0086294 3300046678 Bacteria 1960
322 Ga0495623_0091416 3300046679 Bacteria 1867
323 Ga0495646_0008580 3300046680 Bacteria 6490
324 Ga0495647_0000754 3300046681 Bacteria 9612
325 Ga0495647_0037982 3300046681 Bacteria 1820
326 Ga0495658_0000994 3300046683 Bacteria 14995
327 Ga0495658_0096530 3300046683 Bacteria 1758
328 Ga0495613_0000928 3300046689 Bacteria 22495
329 Ga0495624_0003652 3300046690 Bacteria 11380
330 Ga0495624_0245547 3300046690 Bacteria 1083
331 Ga0495649_0015884 3300046694 Bacteria 4277
332 Ga0495649_0093239 3300046694 Bacteria 1603
333 Ga0495600_0189485 3300046809 Bacteria 1323
334 Ga0495581_0000012 3300047315 Bacteria 62886
335 Ga0495581_0104891 3300047315 Bacteria 1643
336 Ga0495581_0168311 3300047315 Bacteria 1282
337 Ga0495604_0071062 3300047317 Bacteria 2634
338 Ga0495604_0238673 3300047317 Bacteria 1244
339 Ga0495636_0043671 3300047318 Bacteria 1866
340 Ga0495674_0000031 3300047319 Bacteria 115867
341 Ga0495672_0078591 3300047320 Bacteria 1845
342 Ga0495676_0201835 3300047321 Bacteria 1381
343 Ga0495687_006694 3300047443 Bacteria 6990
344 Ga0495673_0045802 3300047469 Bacteria 1942
345 Ga0495686_0182057 3300047472 Bacteria 1217
346 Ga0495686_0191125 3300047472 Bacteria 1180
347 Ga0495593_0000008 3300047673 Bacteria 87310
348 Ga0495602_0177171 3300048088 Bacteria 1648
349 Ga0495602_0386165 3300048088 Bacteria 1002
350 Ga0495614_0009666 3300048089 Bacteria 4262
351 Ga0496100_0081519 3300048903 Bacteria 2186
352 Ga0496100_0139144 3300048903 Bacteria 1718
353 Ga0496101_0183070 3300048904 Bacteria 1614
354 Ga0496102_0003595 3300048905 Bacteria 13132
355 Ga0496102_0072804 3300048905 Bacteria 3158
356 Ga0496102_0106267 3300048905 Bacteria 2612
357 Ga0496103_0004751 3300048906 Bacteria 8214
358 Ga0496104_0056792 3300048907 Bacteria 3703
359 Ga0496104_0341279 3300048907 Bacteria 1411
360 Ga0496105_0116561 3300048908 Bacteria 2203
361 Ga0496105_0157034 3300048908 Bacteria 1868
362 Ga0496106_0029456 3300048909 Bacteria 4091
363 Ga0496106_0031714 3300048909 Bacteria 3938
364 Ga0496106_0233068 3300048909 Bacteria 1470
365 Ga0496106_0585026 3300048909 Bacteria 895
366 Ga0496107_0000947 3300048910 Bacteria 17177
367 Ga0496108_0013705 3300048911 Bacteria 6616
368 Ga0496108_0028679 3300048911 Bacteria 4606
369 Ga0496108_0053689 3300048911 Bacteria 3380
370 Ga0496108_0094617 3300048911 Bacteria 2543
371 Ga0496108_0229456 3300048911 Bacteria 1614
372 Ga0496109_0008951 3300048912 Bacteria 8527
373 Ga0496109_0110861 3300048912 Bacteria 2551
374 Ga0496109_0196509 3300048912 Bacteria 1896
375 Ga0496110_0047060 3300048913 Bacteria 3775
376 Ga0496110_0164218 3300048913 Bacteria 2013
377 Ga0496110_0329716 3300048913 Bacteria 1390
378 Ga0496111_0015443 3300048914 Bacteria 5242
379 Ga0496111_0028576 3300048914 Bacteria 3953
380 Ga0496112_0012760 3300048915 Bacteria 7731
381 Ga0496112_0027701 3300048915 Bacteria 5465
382 Ga0496112_0132201 3300048915 Bacteria 2466
383 Ga0496113_0001327 3300048916 Bacteria 13676
384 Ga0496113_0039228 3300048916 Bacteria 3485
385 Ga0496113_0111008 3300048916 Bacteria 2134
386 Ga0496114_0024353 3300048917 Bacteria 4940
387 Ga0496115_0000604 3300048918 Bacteria 27391
388 Ga0496115_0033862 3300048918 Bacteria 4036
389 Ga0496115_0365576 3300048918 Bacteria 1175
390 Ga0496117_0068811 3300048920 Bacteria 2388
391 Ga0496118_0092830 3300048921 Bacteria 2070
392 Ga0496119_0057406 3300048922 Bacteria 2352
393 Ga0496121_0062307 3300048924 Bacteria 3056
394 Ga0496125_0067022 3300048928 Bacteria 2832
395 Ga0496126_0008677 3300048929 Bacteria 10918
396 Ga0496126_0173025 3300048929 Bacteria 1838
397 Ga0496126_0296898 3300048929 Bacteria 1334
398 nmdc:mga03683_55344_c1 3300050489 Bacteria 1666
399 nmdc:mga03n38_106390_c1 3300050490 Bacteria 1360
400 nmdc:mga03n38_1351_c1 3300050490 Bacteria 6942
401 nmdc:mga03n38_44340_c1 3300050490 Bacteria 1953
402 nmdc:mga00v17_4146_c1 3300050491 Bacteria 7505
403 nmdc:mga0yw44_47972_c1 3300050492 Bacteria 2574
404 nmdc:mga0yw44_5233_c1 3300050492 Bacteria 6085
405 nmdc:mga0yw44_70100_c1 3300050492 Bacteria 1396
406 nmdc:mga06z11_61386_c1 3300050494 Bacteria 1960
407 nmdc:mga04h51_36493_c1 3300050495 Bacteria 1582
408 nmdc:mga07m45_44129_c1 3300050496 Bacteria 2501
409 nmdc:mga07m45_82651_c1 3300050496 Bacteria 1834
410 nmdc:mga05p37_40049_c1 3300050507 Bacteria 5754
411 nmdc:mga0sz30_184682_c1 3300050516 Bacteria 926
412 nmdc:mga0sz30_31337_c1 3300050516 Bacteria 1830
413 Ga0495601_0167446 3300053077 Bacteria 1436
414 Ga0495612_0021447 3300053078 Bacteria 2592
415 Ga0495612_0026650 3300053078 Bacteria 2323
416 Ga0500635_0017787 3300053080 Bacteria 2135
417 Ga0495595_0031623 3300053084 Bacteria 2380
418 Ga0495619_0022726 3300053085 Bacteria 4016
419 Ga0495619_0036652 3300053085 Bacteria 3194
420 Ga0495619_0232266 3300053085 Bacteria 1278
421 Ga0500578_0235792 3300053086 Bacteria 1107
422 Ga0500566_0000293 3300053094 Bacteria 26861
423 Ga0500566_0000412 3300053094 Bacteria 23818
424 Ga0500641_0009681 3300053096 Bacteria 3467
425 Ga0500554_004219 3300053102 Bacteria 3025
426 Ga0500554_032547 3300053102 Bacteria 1548
427 Ga0500595_000395 3300053119 Bacteria 28044
428 Ga0500595_016246 3300053119 Bacteria 2776
429 Ga0500642_0000127 3300053130 Bacteria 34341
430 Ga0500658_0212920 3300053134 Bacteria 885
431 Ga0500603_006349 3300053150 Bacteria 2567
432 Ga0500622_0063763 3300053156 Bacteria 1875
433 Ga0500638_000370 3300053162 Bacteria 10477
434 Ga0500637_0000026 3300053178 Bacteria 59050
435 Ga0500637_0079586 3300053178 Bacteria 1892
436 Ga0500637_0305746 3300053178 Bacteria 865

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048088 Ga0495602_0386165 Ga0495602_0386165_104_895 239
2 iso_pu_bacteria 2824644064 2824652637 244
3 3300031344 Ga0265316_10246791 Ga0265316_102467912 245
4 3300046507 Ga0495606_0136524 Ga0495606_0136524_698_1441 247
5 iso_pu_bacteria 2844315083 2844320216 247
6 iso_pu_bacteria 2881364244 2881370118 247
7 iso_pu_bacteria 2903727486 2903731194 247
8 iso_pu_bacteria 2906602504 2906610039 247
9 3300044694 Ga0466963_0031606 Ga0466963_0031606_638_1384 248
10 3300044842 Ga0466957_0027162 Ga0466957_0027162_452_1198 248
11 3300045976 Ga0466967_0006352 Ga0466967_0006352_4017_4763 248
12 3300037418 Ga0395900_0111107 Ga0395900_0111107_875_1627 249
13 3300038443 Ga0395901_0204268 Ga0395901_0204268_895_1647 249
14 3300044658 Ga0466972_0000079 Ga0466972_0000079_67099_67848 249
15 3300047315 Ga0495581_0168311 Ga0495581_0168311_22_774 249
16 3300053080 Ga0500635_0017787 Ga0500635_0017787_814_1572 249
17 3300053102 Ga0500554_004219 Ga0500554_004219_1023_1781 249
18 3300053150 Ga0500603_006349 Ga0500603_006349_99_857 249
19 3300005577 Ga0068857_100405401 Ga0068857_1004054012 250
20 3300047320 Ga0495672_0078591 Ga0495672_0078591_149_901 250
21 3300050516 nmdc:mga0sz30_184682_c1 nmdc:mga0sz30_184682_c1_13_768 251
22 iso_pu_bacteria 2513237137 2513857031 253
23 iso_pu_bacteria 2517572143 2517891155 253
24 iso_pu_bacteria 2524023228 2524533661 253
25 iso_pu_bacteria 2728368998 2728755520 253
26 iso_pu_bacteria 2791355197 2793066498 253
27 iso_pu_bacteria 2903748898 2903752226 253
28 iso_pu_bacteria 2904699407 2904701034 253
29 iso_pu_bacteria 2906610324 2906616335 253
30 iso_pu_bacteria 2908739725 2908741473 253
31 iso_pu_bacteria 2908756301 2908758742 253
32 iso_pu_bacteria 2922425934 2922431667 253
33 iso_pu_bacteria 2935630451 2935635783 253
34 iso_pu_bacteria 2941507105 2941512380 253
35 iso_pu_bacteria 2941515067 2941520115 253
36 iso_pu_bacteria 2941523033 2941528264 253
37 iso_pu_bacteria 3005474847 3005481466 253
38 iso_pu_bacteria 8006933436 8006939251 253
39 iso_pu_bacteria 8006973647 8006978909 253
40 iso_pu_bacteria 8019555841 8019565112 253
41 iso_pu_bacteria 8019565922 8019575214 253
42 3300009148 Ga0105243_10267575 Ga0105243_102675752 255
43 3300013105 Ga0157369_10064867 Ga0157369_100648676 255
44 3300013297 Ga0157378_10004961 Ga0157378_100049613 255
45 3300014745 Ga0157377_10351293 Ga0157377_103512931 255
46 3300025986 Ga0207658_10374355 Ga0207658_103743552 255
47 3300028379 Ga0268266_10078485 Ga0268266_100784853 255
48 3300035724 Ga0373933_0066575 Ga0373933_0066575_1234_2025 255
49 3300037312 Ga0395899_0177879 Ga0395899_0177879_560_1330 255
50 3300037466 Ga0395898_0064739 Ga0395898_0064739_446_1216 255
51 3300046559 Ga0495667_0206994 Ga0495667_0206994_223_1014 255
52 3300046674 Ga0495588_0112999 Ga0495588_0112999_413_1180 255
53 iso_pu_bacteria 2511231028 2511398975 255
54 iso_pu_bacteria 2513237092 2513621665 255
55 iso_pu_bacteria 2513237095 2513651149 255
56 iso_pu_bacteria 2513237102 2513700652 255
57 iso_pu_bacteria 2513237139 2513878362 255
58 iso_pu_bacteria 2513237161 2514011711 255
59 iso_pu_bacteria 2617270735 2617352714 255
60 iso_pu_bacteria 2802429603 2805920585 255
61 iso_pu_bacteria 2816332527 2818236771 255
62 iso_pu_bacteria 2824617872 2824622031 255
63 iso_pu_bacteria 2824626560 2824629295 255
64 iso_pu_bacteria 2824671348 2824675203 255
65 iso_pu_bacteria 2824687955 2824690049 255
66 iso_pu_bacteria 2824696289 2824701154 255
67 iso_pu_bacteria 2824723954 2824731757 255
68 iso_pu_bacteria 2824773399 2824776681 255
69 iso_pu_bacteria 2838122688 2838127369 255
70 iso_pu_bacteria 2841941048 2841946388 255
71 iso_pu_bacteria 2841949485 2841957107 255
72 iso_pu_bacteria 2841966195 2841972898 255
73 iso_pu_bacteria 2841974524 2841978430 255
74 iso_pu_bacteria 2841983080 2841987468 255
75 iso_pu_bacteria 2847939898 2847947966 255
76 iso_pu_bacteria 2874612657 2874616760 255
77 iso_pu_bacteria 2874620515 2874628290 255
78 iso_pu_bacteria 2879083081 2879084951 255
79 iso_pu_bacteria 2881665667 2881670118 255
80 iso_pu_bacteria 2885366525 2885370183 255
81 iso_pu_bacteria 2888388044 2888392573 255
82 iso_pu_bacteria 2904666416 2904674091 255
83 iso_pu_bacteria 2906643746 2906651213 255
84 iso_pu_bacteria 2935883170 2935885691 255
85 iso_pu_bacteria 3005483717 3005488446 255
86 iso_pu_bacteria 3005506211 3005508227 255
87 iso_pu_bacteria 3005587118 3005588271 255
88 iso_pu_bacteria 3005594810 3005600529 255
89 iso_pu_bacteria 8016622563 8016625421 255
90 3300005548 Ga0070665_100021601 Ga0070665_1000216015 256
91 3300028379 Ga0268266_10013446 Ga0268266_100134465 256
92 3300028379 Ga0268266_10079803 Ga0268266_100798032 256
93 3300036401 Ga0373937_0151428 Ga0373937_0151428_86_859 256
94 3300038443 Ga0395901_0137905 Ga0395901_0137905_990_1760 256
95 3300053134 Ga0500658_0212920 Ga0500658_0212920_20_793 256
96 3300005334 Ga0068869_100204188 Ga0068869_1002041882 257
97 3300005336 Ga0070680_100119741 Ga0070680_1001197413 257
98 3300005337 Ga0070682_100279061 Ga0070682_1002790612 257
99 3300005338 Ga0068868_100048941 Ga0068868_1000489411 257
100 3300005344 Ga0070661_100191217 Ga0070661_1001912173 257
101 3300005353 Ga0070669_100156285 Ga0070669_1001562853 257
102 3300005355 Ga0070671_100104083 Ga0070671_1001040832 257
103 3300005356 Ga0070674_100310311 Ga0070674_1003103112 257
104 3300005364 Ga0070673_100106590 Ga0070673_1001065902 257
105 3300005455 Ga0070663_100008949 Ga0070663_1000089497 257
106 3300005455 Ga0070663_100053262 Ga0070663_1000532623 257
107 3300005456 Ga0070678_100094705 Ga0070678_1000947052 257
108 3300005456 Ga0070678_100293777 Ga0070678_1002937773 257
109 3300005458 Ga0070681_10304038 Ga0070681_103040381 257
110 3300005518 Ga0070699_100326955 Ga0070699_1003269551 257
111 3300005530 Ga0070679_100561983 Ga0070679_1005619831 257
112 3300005539 Ga0068853_100207247 Ga0068853_1002072472 257
113 3300005539 Ga0068853_100300458 Ga0068853_1003004583 257
114 3300005545 Ga0070695_100290061 Ga0070695_1002900612 257
115 3300005548 Ga0070665_100023384 Ga0070665_1000233844 257
116 3300005548 Ga0070665_100078654 Ga0070665_1000786543 257
117 3300005548 Ga0070665_100099122 Ga0070665_1000991223 257
118 3300005564 Ga0070664_100084031 Ga0070664_1000840313 257
119 3300005616 Ga0068852_100426524 Ga0068852_1004265241 257
120 3300005617 Ga0068859_100181183 Ga0068859_1001811834 257
121 3300005618 Ga0068864_100058929 Ga0068864_1000589292 257
122 3300005618 Ga0068864_100482813 Ga0068864_1004828132 257
123 3300005719 Ga0068861_100543530 Ga0068861_1005435301 257
124 3300005842 Ga0068858_100119984 Ga0068858_1001199842 257
125 3300005843 Ga0068860_100153207 Ga0068860_1001532074 257
126 3300005844 Ga0068862_100215475 Ga0068862_1002154753 257
127 3300005844 Ga0068862_100244654 Ga0068862_1002446542 257
128 3300005844 Ga0068862_100345350 Ga0068862_1003453501 257
129 3300005937 Ga0081455_10002982 Ga0081455_100029829 257
130 3300006028 Ga0070717_10007544 Ga0070717_100075442 257
131 3300006038 Ga0075365_10229899 Ga0075365_102298992 257
132 3300006048 Ga0075363_100026304 Ga0075363_1000263044 257
133 3300006051 Ga0075364_10024940 Ga0075364_100249405 257
134 3300006186 Ga0075369_10032260 Ga0075369_100322602 257
135 3300006358 Ga0068871_100069423 Ga0068871_1000694233 257
136 3300006844 Ga0075428_100101949 Ga0075428_1001019492 257
137 3300006880 Ga0075429_100227680 Ga0075429_1002276803 257
138 3300006881 Ga0068865_100311655 Ga0068865_1003116552 257
139 3300006931 Ga0097620_100181187 Ga0097620_1001811872 257
140 3300006943 Ga0099822_1021826 Ga0099822_10218264 257
141 3300009093 Ga0105240_10024721 Ga0105240_100247212 257
142 3300009098 Ga0105245_10137591 Ga0105245_101375914 257
143 3300009098 Ga0105245_10754062 Ga0105245_107540621 257
144 3300009101 Ga0105247_10100789 Ga0105247_101007892 257
145 3300009101 Ga0105247_10136111 Ga0105247_101361113 257
146 3300009101 Ga0105247_10234014 Ga0105247_102340142 257
147 3300009147 Ga0114129_10414231 Ga0114129_104142312 257
148 3300009177 Ga0105248_10194824 Ga0105248_101948243 257
149 3300009177 Ga0105248_10260394 Ga0105248_102603944 257
150 3300010375 Ga0105239_11041703 Ga0105239_110417032 257
151 3300013104 Ga0157370_10178217 Ga0157370_101782172 257
152 3300013296 Ga0157374_10024785 Ga0157374_100247856 257
153 3300013297 Ga0157378_10278553 Ga0157378_102785533 257
154 3300013306 Ga0163162_10060239 Ga0163162_100602391 257
155 3300013306 Ga0163162_10740909 Ga0163162_107409092 257
156 3300013308 Ga0157375_10105710 Ga0157375_101057104 257
157 3300013308 Ga0157375_10644025 Ga0157375_106440251 257
158 3300014325 Ga0163163_10060452 Ga0163163_100604522 257
159 3300014325 Ga0163163_10814217 Ga0163163_108142172 257
160 3300014326 Ga0157380_10245136 Ga0157380_102451362 257
161 3300014745 Ga0157377_10063726 Ga0157377_100637262 257
162 3300014969 Ga0157376_10053421 Ga0157376_100534214 257
163 3300014969 Ga0157376_10259121 Ga0157376_102591212 257
164 3300014969 Ga0157376_10724361 Ga0157376_107243612 257
165 3300017792 Ga0163161_10563434 Ga0163161_105634341 257
166 3300025261 Ga0209233_1017593 Ga0209233_10175931 257
167 3300025909 Ga0207705_10199849 Ga0207705_101998492 257
168 3300025919 Ga0207657_10421943 Ga0207657_104219431 257
169 3300025920 Ga0207649_10163987 Ga0207649_101639872 257
170 3300025921 Ga0207652_10304152 Ga0207652_103041522 257
171 3300025931 Ga0207644_10409285 Ga0207644_104092851 257
172 3300025937 Ga0207669_10157627 Ga0207669_101576272 257
173 3300025940 Ga0207691_10661332 Ga0207691_106613321 257
174 3300025942 Ga0207689_10019353 Ga0207689_100193535 257
175 3300025944 Ga0207661_10040025 Ga0207661_100400254 257
176 3300025944 Ga0207661_10491514 Ga0207661_104915142 257
177 3300025945 Ga0207679_10465174 Ga0207679_104651742 257
178 3300025972 Ga0207668_10318838 Ga0207668_103188381 257
179 3300025981 Ga0207640_10103726 Ga0207640_101037262 257
180 3300025986 Ga0207658_10109147 Ga0207658_101091472 257
181 3300026023 Ga0207677_10073769 Ga0207677_100737692 257
182 3300026035 Ga0207703_10129128 Ga0207703_101291282 257
183 3300026035 Ga0207703_10302095 Ga0207703_103020952 257
184 3300026041 Ga0207639_10151261 Ga0207639_101512613 257
185 3300026041 Ga0207639_10266205 Ga0207639_102662052 257
186 3300026067 Ga0207678_10017857 Ga0207678_100178574 257
187 3300026067 Ga0207678_10026311 Ga0207678_100263115 257
188 3300026067 Ga0207678_10033211 Ga0207678_100332113 257
189 3300026075 Ga0207708_10147525 Ga0207708_101475252 257
190 3300026095 Ga0207676_10068020 Ga0207676_100680204 257
191 3300026118 Ga0207675_100048212 Ga0207675_1000482125 257
192 3300026118 Ga0207675_100058719 Ga0207675_1000587195 257
193 3300026121 Ga0207683_10003797 Ga0207683_100037977 257
194 3300026142 Ga0207698_10390739 Ga0207698_103907392 257
195 3300027357 Ga0209589_1000011 Ga0209589_100001137 257
196 3300027361 Ga0209489_100012 Ga0209489_10001237 257
197 3300027363 Ga0209700_100019 Ga0209700_10001937 257
198 3300028379 Ga0268266_10007625 Ga0268266_100076253 257
199 3300028379 Ga0268266_10020198 Ga0268266_100201984 257
200 3300028379 Ga0268266_10056470 Ga0268266_100564703 257
201 3300028381 Ga0268264_10140299 Ga0268264_101402992 257
202 3300028786 Ga0307517_10000279 Ga0307517_1000027920 257
203 3300028794 Ga0307515_10163370 Ga0307515_101633702 257
204 3300031507 Ga0307509_10098111 Ga0307509_100981115 257
205 3300031731 Ga0307405_10457121 Ga0307405_104571211 257
206 3300031995 Ga0307409_100320888 Ga0307409_1003208882 257
207 3300032002 Ga0307416_100343260 Ga0307416_1003432602 257
208 3300032126 Ga0307415_100149979 Ga0307415_1001499792 257
209 3300033180 Ga0307510_10006305 Ga0307510_1000630512 257
210 3300033180 Ga0307510_10041581 Ga0307510_100415815 257
211 3300033442 Ga0315911_1000003 Ga0315911_1000003443 257
212 3300035111 Ga0373923_0000267 Ga0373923_0000267_406_1182 257
213 3300035120 Ga0373957_0022105 Ga0373957_0022105_89_880 257
214 3300035410 Ga0373924_0017906 Ga0373924_0017906_319_1110 257
215 3300035691 Ga0373931_0023469 Ga0373931_0023469_1383_2156 257
216 3300035695 Ga0373927_0149061 Ga0373927_0149061_237_1010 257
217 3300035725 Ga0373947_0171304 Ga0373947_0171304_265_1041 257
218 3300036401 Ga0373937_0297000 Ga0373937_0297000_469_1260 257
219 3300041413 Ga0439465_0055995 Ga0439465_0055995_138_911 257
220 3300041505 Ga0451849_0432353 Ga0451849_0432353_176_949 257
221 3300041512 Ga0451853_2433109 Ga0451853_2433109_428_1204 257
222 3300046452 Ga0495617_058666 Ga0495617_058666_256_1029 257
223 3300046455 Ga0495603_0002778 Ga0495603_0002778_5773_6546 257
224 3300046455 Ga0495603_0180555 Ga0495603_0180555_64_837 257
225 3300046459 Ga0495629_0065563 Ga0495629_0065563_237_1010 257
226 3300046462 Ga0495651_0227558 Ga0495651_0227558_176_967 257
227 3300046471 Ga0495650_0121172 Ga0495650_0121172_156_929 257
228 3300046492 Ga0495585_0070948 Ga0495585_0070948_664_1437 257
229 3300046499 Ga0495594_0237949 Ga0495594_0237949_121_894 257
230 3300046511 Ga0495608_0023395 Ga0495608_0023395_2970_3761 257
231 3300046514 Ga0495618_0064992 Ga0495618_0064992_191_982 257
232 3300046517 Ga0495630_0077623 Ga0495630_0077623_180_953 257
233 3300046518 Ga0495631_0036622 Ga0495631_0036622_596_1369 257
234 3300046519 Ga0495632_0056495 Ga0495632_0056495_549_1322 257
235 3300046536 Ga0495587_0202775 Ga0495587_0202775_294_1085 257
236 3300046543 Ga0495645_0058108 Ga0495645_0058108_1456_2247 257
237 3300046558 Ga0495633_0148817 Ga0495633_0148817_64_837 257
238 3300046615 Ga0495656_0002642 Ga0495656_0002642_610_1383 257
239 3300046615 Ga0495656_0126518 Ga0495656_0126518_61_834 257
240 3300046615 Ga0495656_0141170 Ga0495656_0141170_301_1074 257
241 3300046616 Ga0495668_0055701 Ga0495668_0055701_852_1625 257
242 3300046642 Ga0495634_0123320 Ga0495634_0123320_113_904 257
243 3300046664 Ga0495659_0009434 Ga0495659_0009434_201_974 257
244 3300046678 Ga0495599_0086294 Ga0495599_0086294_672_1463 257
245 3300046679 Ga0495623_0091416 Ga0495623_0091416_319_1110 257
246 3300046683 Ga0495658_0096530 Ga0495658_0096530_722_1495 257
247 3300046690 Ga0495624_0245547 Ga0495624_0245547_14_787 257
248 3300046809 Ga0495600_0189485 Ga0495600_0189485_74_847 257
249 3300047315 Ga0495581_0104891 Ga0495581_0104891_430_1203 257
250 3300047317 Ga0495604_0238673 Ga0495604_0238673_161_934 257
251 3300047318 Ga0495636_0043671 Ga0495636_0043671_447_1220 257
252 3300047321 Ga0495676_0201835 Ga0495676_0201835_534_1307 257
253 3300047472 Ga0495686_0182057 Ga0495686_0182057_247_1020 257
254 3300048088 Ga0495602_0177171 Ga0495602_0177171_448_1239 257
255 3300048903 Ga0496100_0139144 Ga0496100_0139144_459_1235 257
256 3300048905 Ga0496102_0003595 Ga0496102_0003595_4394_5170 257
257 3300048907 Ga0496104_0341279 Ga0496104_0341279_471_1244 257
258 3300048908 Ga0496105_0116561 Ga0496105_0116561_919_1695 257
259 3300048909 Ga0496106_0029456 Ga0496106_0029456_2545_3321 257
260 3300048909 Ga0496106_0585026 Ga0496106_0585026_11_784 257
261 3300048910 Ga0496107_0000947 Ga0496107_0000947_4887_5663 257
262 3300048911 Ga0496108_0013705 Ga0496108_0013705_1910_2686 257
263 3300048911 Ga0496108_0053689 Ga0496108_0053689_514_1287 257
264 3300048911 Ga0496108_0094617 Ga0496108_0094617_185_958 257
265 3300048911 Ga0496108_0229456 Ga0496108_0229456_783_1556 257
266 3300048912 Ga0496109_0008951 Ga0496109_0008951_6754_7530 257
267 3300048912 Ga0496109_0196509 Ga0496109_0196509_567_1340 257
268 3300048913 Ga0496110_0047060 Ga0496110_0047060_886_1662 257
269 3300048913 Ga0496110_0329716 Ga0496110_0329716_414_1187 257
270 3300048914 Ga0496111_0015443 Ga0496111_0015443_4017_4793 257
271 3300048915 Ga0496112_0012760 Ga0496112_0012760_4970_5746 257
272 3300048916 Ga0496113_0001327 Ga0496113_0001327_7607_8383 257
273 3300048917 Ga0496114_0024353 Ga0496114_0024353_4026_4802 257
274 3300048918 Ga0496115_0000604 Ga0496115_0000604_4927_5703 257
275 3300048918 Ga0496115_0365576 Ga0496115_0365576_64_837 257
276 3300048924 Ga0496121_0062307 Ga0496121_0062307_759_1532 257
277 3300048928 Ga0496125_0067022 Ga0496125_0067022_1674_2447 257
278 3300048929 Ga0496126_0008677 Ga0496126_0008677_5023_5796 257
279 3300048929 Ga0496126_0173025 Ga0496126_0173025_78_851 257
280 3300048929 Ga0496126_0296898 Ga0496126_0296898_103_876 257
281 3300050490 nmdc:mga03n38_106390_c1 nmdc:mga03n38_106390_c1_45_818 257
282 3300050490 nmdc:mga03n38_1351_c1 nmdc:mga03n38_1351_c1_4258_5031 257
283 3300050491 nmdc:mga00v17_4146_c1 nmdc:mga00v17_4146_c1_1985_2758 257
284 3300050492 nmdc:mga0yw44_5233_c1 nmdc:mga0yw44_5233_c1_3972_4745 257
285 3300050492 nmdc:mga0yw44_70100_c1 nmdc:mga0yw44_70100_c1_198_971 257
286 3300050494 nmdc:mga06z11_61386_c1 nmdc:mga06z11_61386_c1_351_1124 257
287 3300050496 nmdc:mga07m45_82651_c1 nmdc:mga07m45_82651_c1_379_1152 257
288 3300050507 nmdc:mga05p37_40049_c1 nmdc:mga05p37_40049_c1_2533_3306 257
289 3300050516 nmdc:mga0sz30_31337_c1 nmdc:mga0sz30_31337_c1_385_1158 257
290 3300053077 Ga0495601_0167446 Ga0495601_0167446_216_989 257
291 3300053078 Ga0495612_0021447 Ga0495612_0021447_1264_2055 257
292 3300053084 Ga0495595_0031623 Ga0495595_0031623_357_1130 257
293 3300053085 Ga0495619_0036652 Ga0495619_0036652_2225_2998 257
294 3300053085 Ga0495619_0232266 Ga0495619_0232266_63_836 257
295 3300053094 Ga0500566_0000293 Ga0500566_0000293_13207_13980 257
296 3300053096 Ga0500641_0009681 Ga0500641_0009681_762_1535 257
297 3300053102 Ga0500554_032547 Ga0500554_032547_717_1490 257
298 3300053119 Ga0500595_000395 Ga0500595_000395_24659_25432 257
299 3300053156 Ga0500622_0063763 Ga0500622_0063763_1078_1851 257
300 3300053162 Ga0500638_000370 Ga0500638_000370_6623_7396 257
301 3300053178 Ga0500637_0000026 Ga0500637_0000026_35461_36234 257
302 3300053178 Ga0500637_0079586 Ga0500637_0079586_997_1770 257
303 3300005331 Ga0070670_100046539 Ga0070670_1000465394 258
304 3300005539 Ga0068853_100068998 Ga0068853_1000689984 258
305 3300005548 Ga0070665_100053413 Ga0070665_1000534132 258
306 3300005563 Ga0068855_100187602 Ga0068855_1001876023 258
307 3300005983 Ga0081540_1003851 Ga0081540_10038513 258
308 3300006028 Ga0070717_10403065 Ga0070717_104030652 258
309 3300009545 Ga0105237_10021234 Ga0105237_100212347 258
310 3300009551 Ga0105238_10027647 Ga0105238_100276473 258
311 3300010375 Ga0105239_10267093 Ga0105239_102670933 258
312 3300013105 Ga0157369_10661448 Ga0157369_106614481 258
313 3300013296 Ga0157374_10179291 Ga0157374_101792912 258
314 3300013306 Ga0163162_10390454 Ga0163162_103904542 258
315 3300025914 Ga0207671_10245556 Ga0207671_102455563 258
316 3300025924 Ga0207694_10040173 Ga0207694_100401735 258
317 3300025949 Ga0207667_10168621 Ga0207667_101686212 258
318 3300026041 Ga0207639_10089016 Ga0207639_100890164 258
319 3300026116 Ga0207674_10167564 Ga0207674_101675642 258
320 3300026142 Ga0207698_10383176 Ga0207698_103831761 258
321 3300028379 Ga0268266_10243092 Ga0268266_102430922 258
322 3300046455 Ga0495603_0240584 Ga0495603_0240584_102_878 258
323 3300046475 Ga0495639_0083076 Ga0495639_0083076_91_867 258
324 3300046681 Ga0495647_0037982 Ga0495647_0037982_97_873 258
325 3300048916 Ga0496113_0039228 Ga0496113_0039228_956_1732 258
326 3300003215 JGI25153J46596_10013376 JGI25153J46596_100133763 259
327 3300003354 JGI25160J50197_1007102 JGI25160J50197_10071023 259
328 3300003775 Ga0055524_1027963 Ga0055524_10279633 259
329 3300005262 Ga0065165_1010604 Ga0065165_10106044 259
330 3300005329 Ga0070683_100076181 Ga0070683_1000761815 259
331 3300005336 Ga0070680_100023775 Ga0070680_1000237753 259
332 3300005339 Ga0070660_100037797 Ga0070660_1000377972 259
333 3300005340 Ga0070689_100143561 Ga0070689_1001435613 259
334 3300005347 Ga0070668_100101314 Ga0070668_1001013142 259
335 3300005355 Ga0070671_100044655 Ga0070671_1000446552 259
336 3300005435 Ga0070714_100173277 Ga0070714_1001732773 259
337 3300005455 Ga0070663_100065159 Ga0070663_1000651592 259
338 3300005539 Ga0068853_100252508 Ga0068853_1002525083 259
339 3300005539 Ga0068853_100381944 Ga0068853_1003819442 259
340 3300005563 Ga0068855_100176362 Ga0068855_1001763623 259
341 3300005577 Ga0068857_100276573 Ga0068857_1002765732 259
342 3300005834 Ga0068851_10082500 Ga0068851_100825001 259
343 3300005841 Ga0068863_100168707 Ga0068863_1001687071 259
344 3300005843 Ga0068860_100404460 Ga0068860_1004044602 259
345 3300006028 Ga0070717_10061397 Ga0070717_100613973 259
346 3300006042 Ga0075368_10011424 Ga0075368_100114242 259
347 3300006048 Ga0075363_100002488 Ga0075363_1000024884 259
348 3300006051 Ga0075364_10181953 Ga0075364_101819533 259
349 3300006163 Ga0070715_10001127 Ga0070715_100011276 259
350 3300006177 Ga0075362_10052802 Ga0075362_100528022 259
351 3300006186 Ga0075369_10033876 Ga0075369_100338762 259
352 3300006186 Ga0075369_10034387 Ga0075369_100343872 259
353 3300006195 Ga0075366_10033470 Ga0075366_100334704 259
354 3300006353 Ga0075370_10031839 Ga0075370_100318393 259
355 3300006942 Ga0099824_1011502 Ga0099824_10115029 259
356 3300009093 Ga0105240_10084695 Ga0105240_100846955 259
357 3300009101 Ga0105247_10034754 Ga0105247_100347542 259
358 3300009174 Ga0105241_10100450 Ga0105241_101004503 259
359 3300009177 Ga0105248_10130483 Ga0105248_101304832 259
360 3300009545 Ga0105237_10009950 Ga0105237_1000995010 259
361 3300009545 Ga0105237_10047158 Ga0105237_100471584 259
362 3300009551 Ga0105238_10151847 Ga0105238_101518474 259
363 3300009551 Ga0105238_10256812 Ga0105238_102568122 259
364 3300010375 Ga0105239_10127564 Ga0105239_101275643 259
365 3300010375 Ga0105239_10431855 Ga0105239_104318552 259
366 3300010375 Ga0105239_10807034 Ga0105239_108070342 259
367 3300011119 Ga0105246_10013775 Ga0105246_100137756 259
368 3300013104 Ga0157370_10057618 Ga0157370_100576185 259
369 3300013105 Ga0157369_10012423 Ga0157369_100124233 259
370 3300013105 Ga0157369_10433652 Ga0157369_104336522 259
371 3300013296 Ga0157374_10040321 Ga0157374_100403215 259
372 3300014325 Ga0163163_10009852 Ga0163163_100098522 259
373 3300014325 Ga0163163_10124811 Ga0163163_101248112 259
374 3300014968 Ga0157379_10100952 Ga0157379_101009524 259
375 3300025230 Ga0209563_100325 Ga0209563_1003256 259
376 3300025253 Ga0209677_102346 Ga0209677_1023464 259
377 3300025261 Ga0209233_1010275 Ga0209233_10102753 259
378 3300025295 Ga0209564_1005325 Ga0209564_10053256 259
379 3300025297 Ga0209758_1000011 Ga0209758_1000011539 259
380 3300025297 Ga0209758_1000120 Ga0209758_100012038 259
381 3300025297 Ga0209758_1001848 Ga0209758_100184816 259
382 3300025297 Ga0209758_1008838 Ga0209758_10088385 259
383 3300025299 Ga0209256_1010441 Ga0209256_10104415 259
384 3300025302 Ga0207426_1006703 Ga0207426_10067035 259
385 3300025303 Ga0209051_1060292 Ga0209051_10602922 259
386 3300025304 Ga0209257_1001101 Ga0209257_10011017 259
387 3300025904 Ga0207647_10008820 Ga0207647_100088206 259
388 3300025911 Ga0207654_10020891 Ga0207654_100208913 259
389 3300025914 Ga0207671_10212161 Ga0207671_102121612 259
390 3300025915 Ga0207693_10007874 Ga0207693_100078743 259
391 3300025928 Ga0207700_10172042 Ga0207700_101720423 259
392 3300025931 Ga0207644_10386177 Ga0207644_103861772 259
393 3300025939 Ga0207665_10001385 Ga0207665_100013854 259
394 3300025939 Ga0207665_10402319 Ga0207665_104023192 259
395 3300025942 Ga0207689_10167098 Ga0207689_101670982 259
396 3300025944 Ga0207661_10254792 Ga0207661_102547923 259
397 3300025949 Ga0207667_10172122 Ga0207667_101721223 259
398 3300025949 Ga0207667_10492745 Ga0207667_104927452 259
399 3300025986 Ga0207658_10097909 Ga0207658_100979092 259
400 3300026067 Ga0207678_10022393 Ga0207678_100223936 259
401 3300026116 Ga0207674_10007720 Ga0207674_100077204 259
402 3300026142 Ga0207698_10132646 Ga0207698_101326462 259
403 3300027296 Ga0209389_1000043 Ga0209389_100004320 259
404 3300027357 Ga0209589_1000047 Ga0209589_100004791 259
405 3300027361 Ga0209489_100075 Ga0209489_100075123 259
406 3300027512 Ga0209179_1003275 Ga0209179_10032751 259
407 3300027866 Ga0209813_10013523 Ga0209813_100135233 259
408 3300028381 Ga0268264_10380531 Ga0268264_103805312 259
409 3300031711 Ga0265314_10076536 Ga0265314_100765363 259
410 3300031712 Ga0265342_10080689 Ga0265342_100806892 259
411 3300035170 Ga0373943_0000795 Ga0373943_0000795_10080_10868 259
412 3300035171 Ga0373946_0006225 Ga0373946_0006225_1794_2582 259
413 3300035172 Ga0373955_0021671 Ga0373955_0021671_62_850 259
414 3300035410 Ga0373924_0009206 Ga0373924_0009206_1784_2572 259
415 3300035692 Ga0373935_0000536 Ga0373935_0000536_9020_9808 259
416 3300035695 Ga0373927_0000898 Ga0373927_0000898_6132_6920 259
417 3300035725 Ga0373947_0010479 Ga0373947_0010479_1612_2400 259
418 3300036401 Ga0373937_0064227 Ga0373937_0064227_2294_3082 259
419 3300036401 Ga0373937_0095987 Ga0373937_0095987_1941_2732 259
420 3300037068 Ga0373925_0001796 Ga0373925_0001796_285_1073 259
421 3300037471 Ga0395905_0386390 Ga0395905_0386390_265_1044 259
422 3300044901 Ga0466960_0060690 Ga0466960_0060690_41_820 259
423 3300046455 Ga0495603_0000046 Ga0495603_0000046_46660_47448 259
424 3300046459 Ga0495629_0000071 Ga0495629_0000071_23241_24029 259
425 3300046461 Ga0495641_0009896 Ga0495641_0009896_3101_3889 259
426 3300046472 Ga0495580_0000057 Ga0495580_0000057_38873_39661 259
427 3300046473 Ga0495582_0000111 Ga0495582_0000111_17132_17920 259
428 3300046475 Ga0495639_0000108 Ga0495639_0000108_14754_15542 259
429 3300046476 Ga0495662_0000992 Ga0495662_0000992_301_1089 259
430 3300046477 Ga0495664_0002718 Ga0495664_0002718_5154_5942 259
431 3300046499 Ga0495594_0000133 Ga0495594_0000133_9773_10561 259
432 3300046507 Ga0495606_0006998 Ga0495606_0006998_2666_3445 259
433 3300046513 Ga0495616_0081220 Ga0495616_0081220_409_1188 259
434 3300046515 Ga0495620_0077867 Ga0495620_0077867_431_1210 259
435 3300046515 Ga0495620_0091398 Ga0495620_0091398_206_985 259
436 3300046517 Ga0495630_0000959 Ga0495630_0000959_9582_10370 259
437 3300046522 Ga0495643_0042317 Ga0495643_0042317_1550_2329 259
438 3300046524 Ga0495648_0014927 Ga0495648_0014927_1205_1996 259
439 3300046524 Ga0495648_0041864 Ga0495648_0041864_1818_2597 259
440 3300046526 Ga0495666_0078399 Ga0495666_0078399_426_1214 259
441 3300046529 Ga0495652_0042099 Ga0495652_0042099_403_1191 259
442 3300046531 Ga0495665_0000001 Ga0495665_0000001_56251_57039 259
443 3300046533 Ga0495640_0012179 Ga0495640_0012179_3538_4326 259
444 3300046535 Ga0495586_0168797 Ga0495586_0168797_114_902 259
445 3300046538 Ga0495609_0072783 Ga0495609_0072783_241_1020 259
446 3300046557 Ga0495622_0001363 Ga0495622_0001363_8194_8982 259
447 3300046559 Ga0495667_0032071 Ga0495667_0032071_93_881 259
448 3300046642 Ga0495634_0000046 Ga0495634_0000046_24783_25571 259
449 3300046660 Ga0495625_0116759 Ga0495625_0116759_899_1678 259
450 3300046663 Ga0495635_0000338 Ga0495635_0000338_26247_27035 259
451 3300046674 Ga0495588_0001464 Ga0495588_0001464_4126_4914 259
452 3300046680 Ga0495646_0008580 Ga0495646_0008580_2118_2906 259
453 3300046681 Ga0495647_0000754 Ga0495647_0000754_6140_6928 259
454 3300046683 Ga0495658_0000994 Ga0495658_0000994_2417_3205 259
455 3300046689 Ga0495613_0000928 Ga0495613_0000928_617_1405 259
456 3300046690 Ga0495624_0003652 Ga0495624_0003652_8883_9671 259
457 3300046694 Ga0495649_0015884 Ga0495649_0015884_729_1508 259
458 3300046694 Ga0495649_0093239 Ga0495649_0093239_336_1115 259
459 3300047315 Ga0495581_0000012 Ga0495581_0000012_16328_17116 259
460 3300047317 Ga0495604_0071062 Ga0495604_0071062_326_1114 259
461 3300047319 Ga0495674_0000031 Ga0495674_0000031_23858_24646 259
462 3300047443 Ga0495687_006694 Ga0495687_006694_5884_6663 259
463 3300047469 Ga0495673_0045802 Ga0495673_0045802_148_939 259
464 3300047472 Ga0495686_0191125 Ga0495686_0191125_178_957 259
465 3300047673 Ga0495593_0000008 Ga0495593_0000008_31258_32046 259
466 3300048089 Ga0495614_0009666 Ga0495614_0009666_798_1586 259
467 3300048903 Ga0496100_0081519 Ga0496100_0081519_828_1607 259
468 3300048904 Ga0496101_0183070 Ga0496101_0183070_239_1018 259
469 3300048905 Ga0496102_0072804 Ga0496102_0072804_572_1351 259
470 3300048905 Ga0496102_0106267 Ga0496102_0106267_233_1108 259
471 3300048906 Ga0496103_0004751 Ga0496103_0004751_695_1474 259
472 3300048907 Ga0496104_0056792 Ga0496104_0056792_1487_2362 259
473 3300048908 Ga0496105_0157034 Ga0496105_0157034_161_982 259
474 3300048909 Ga0496106_0031714 Ga0496106_0031714_1382_2203 259
475 3300048909 Ga0496106_0233068 Ga0496106_0233068_98_877 259
476 3300048911 Ga0496108_0028679 Ga0496108_0028679_1687_2466 259
477 3300048912 Ga0496109_0110861 Ga0496109_0110861_1302_2081 259
478 3300048913 Ga0496110_0164218 Ga0496110_0164218_345_1124 259
479 3300048914 Ga0496111_0028576 Ga0496111_0028576_2030_2809 259
480 3300048915 Ga0496112_0027701 Ga0496112_0027701_4092_4913 259
481 3300048915 Ga0496112_0132201 Ga0496112_0132201_132_911 259
482 3300048916 Ga0496113_0111008 Ga0496113_0111008_997_1872 259
483 3300048918 Ga0496115_0033862 Ga0496115_0033862_1880_2755 259
484 3300048920 Ga0496117_0068811 Ga0496117_0068811_1300_2079 259
485 3300048921 Ga0496118_0092830 Ga0496118_0092830_98_877 259
486 3300048922 Ga0496119_0057406 Ga0496119_0057406_1397_2176 259
487 3300050489 nmdc:mga03683_55344_c1 nmdc:mga03683_55344_c1_296_1075 259
488 3300050490 nmdc:mga03n38_44340_c1 nmdc:mga03n38_44340_c1_768_1547 259
489 3300050492 nmdc:mga0yw44_47972_c1 nmdc:mga0yw44_47972_c1_1199_1978 259
490 3300050495 nmdc:mga04h51_36493_c1 nmdc:mga04h51_36493_c1_131_910 259
491 3300050496 nmdc:mga07m45_44129_c1 nmdc:mga07m45_44129_c1_1676_2455 259
492 3300053078 Ga0495612_0026650 Ga0495612_0026650_166_945 259
493 3300053085 Ga0495619_0022726 Ga0495619_0022726_2282_3061 259
494 3300053086 Ga0500578_0235792 Ga0500578_0235792_40_819 259
495 3300053094 Ga0500566_0000412 Ga0500566_0000412_13884_14663 259
496 3300053119 Ga0500595_016246 Ga0500595_016246_587_1366 259
497 3300053130 Ga0500642_0000127 Ga0500642_0000127_21425_22204 259
498 3300053178 Ga0500637_0305746 Ga0500637_0305746_28_819 259
499 iso_pu_bacteria 2824714736 2824723191 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

57

142

0.97

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

156

249

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h31-assembly3.cif.gz_E oxidised soxax complex from rhodovulum sulfidophilum 0.8693 30 259
2c1d-assembly4.cif.gz_G crystal structure of soxxa from p. pantotrophus 0.8554 31 258
3ocd-assembly2.cif.gz_C diheme soxax - c236m mutant 0.7936 50 255
1h31-assembly3.cif.gz_E oxidised soxax complex from rhodovulum sulfidophilum 0.7704 30 259
3oa8-assembly1.cif.gz_E diheme soxax 0.7679 50 255
ID Description Score Start End Superfamily
1h31A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.958 53 140 1.10.760.10
1h31A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9476 53 140 1.10.760.10
2c1dG02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9226 53 142 1.10.760.10
2c1dG02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9129 53 142 1.10.760.10
3oa8A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8152 54 142 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A389MKJ9-F1-model_v4 Cytochrome c domain-containing protein 0.9639 29 152 GO:0009055
GO:0020037
GO:0046872
AF-A0A537QI86-F1-model_v4 Sulfur oxidation c-type cytochrome SoxA 0.9516 18 126 GO:0009055
GO:0020037
GO:0046872
AF-A0A848T643-F1-model_v4 Sulfur oxidation c-type cytochrome SoxA 0.9497 31 175 GO:0009055
GO:0020037
GO:0046872
AF-A0A2R4D2R5-F1-model_v4 deleted 0.9426 83 147
AF-A0A690A064-F1-model_v4 deleted 0.9408 83 141

Feature Viewer

pLDDT pTM Quality
81.29 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map