F455396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 499 | 336 | 436 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0064739|Ga0395898_0064739_446_1216 |
| Length | 256 |
| Sequence | MSRLWGVLGVGAVFLASLAAAQNGADPRRSGYQDMGPSLRKVQDDEAANPAMPYVRAGETLWKQKAGQAGKACADCHAEGSMKGVAARYPAISRGADKPVDLEGRINLCRTEHQKAGPLAAESQDLLDLTAYVALQSRGMSIAPPDDPRLAPFRAEGKKLFESREGQLNLSCAICHDNNAEKTLGGAVIPQGHPTGYPVYRIAWQALGSLKRRLRNCMIGMRAEPFDYGSPEYVDLEAYLMDRAKGMKVDAPAVRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 10 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 13 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 14 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 15 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 16 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 17 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 18 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 19 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 20 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 21 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 22 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 23 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 24 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 25 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 26 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 27 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 28 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 29 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 30 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 31 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 32 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 33 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 34 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 35 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 36 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 37 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 38 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 39 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 40 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 41 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 42 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 43 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 44 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 45 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 46 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 47 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 48 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 49 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 50 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 51 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 52 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 53 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 54 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 55 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 56 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 57 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 60 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 113 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 216 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 319 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 322 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 324 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 325 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 327 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 330 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 332 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 333 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 334 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 335 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 336 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.9 |
| Metatranscriptomes | 0 |
| Isolates | 12.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.22 |
| Nodule | 8.62 |
| Rhizoplane | 7.82 |
| Rhizosphere | 62.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10013376 | 3300003215 | Bacteria | 3468 |
| 2 | JGI25160J50197_1007102 | 3300003354 | Bacteria | 4422 |
| 3 | Ga0055524_1027963 | 3300003775 | Bacteria | 1699 |
| 4 | Ga0065165_1010604 | 3300005262 | Bacteria | 3956 |
| 5 | Ga0070683_100076181 | 3300005329 | Bacteria | 3135 |
| 6 | Ga0070670_100046539 | 3300005331 | Bacteria | 3731 |
| 7 | Ga0068869_100204188 | 3300005334 | Bacteria | 1559 |
| 8 | Ga0070680_100023775 | 3300005336 | Bacteria | 4891 |
| 9 | Ga0070680_100119741 | 3300005336 | Bacteria | 2197 |
| 10 | Ga0070682_100279061 | 3300005337 | Bacteria | 1217 |
| 11 | Ga0068868_100048941 | 3300005338 | Bacteria | 3317 |
| 12 | Ga0070660_100037797 | 3300005339 | Bacteria | 3660 |
| 13 | Ga0070689_100143561 | 3300005340 | Bacteria | 1921 |
| 14 | Ga0070661_100191217 | 3300005344 | Bacteria | 1561 |
| 15 | Ga0070668_100101314 | 3300005347 | Bacteria | 2282 |
| 16 | Ga0070669_100156285 | 3300005353 | Bacteria | 1769 |
| 17 | Ga0070671_100044655 | 3300005355 | Bacteria | 3682 |
| 18 | Ga0070671_100104083 | 3300005355 | Bacteria | 2382 |
| 19 | Ga0070674_100310311 | 3300005356 | Bacteria | 1261 |
| 20 | Ga0070673_100106590 | 3300005364 | Bacteria | 2317 |
| 21 | Ga0070714_100173277 | 3300005435 | Bacteria | 1959 |
| 22 | Ga0070663_100008949 | 3300005455 | Bacteria | 6183 |
| 23 | Ga0070663_100053262 | 3300005455 | Bacteria | 2888 |
| 24 | Ga0070663_100065159 | 3300005455 | Bacteria | 2636 |
| 25 | Ga0070678_100094705 | 3300005456 | Bacteria | 2299 |
| 26 | Ga0070678_100293777 | 3300005456 | Bacteria | 1378 |
| 27 | Ga0070681_10304038 | 3300005458 | Bacteria | 1504 |
| 28 | Ga0070699_100326955 | 3300005518 | Bacteria | 1379 |
| 29 | Ga0070679_100561983 | 3300005530 | Bacteria | 1084 |
| 30 | Ga0068853_100068998 | 3300005539 | Bacteria | 3074 |
| 31 | Ga0068853_100207247 | 3300005539 | Bacteria | 1786 |
| 32 | Ga0068853_100252508 | 3300005539 | Bacteria | 1619 |
| 33 | Ga0068853_100300458 | 3300005539 | Bacteria | 1484 |
| 34 | Ga0068853_100381944 | 3300005539 | Bacteria | 1315 |
| 35 | Ga0070695_100290061 | 3300005545 | Bacteria | 1206 |
| 36 | Ga0070665_100021601 | 3300005548 | Bacteria | 6471 |
| 37 | Ga0070665_100023384 | 3300005548 | Bacteria | 6222 |
| 38 | Ga0070665_100053413 | 3300005548 | Bacteria | 4052 |
| 39 | Ga0070665_100078654 | 3300005548 | Bacteria | 3304 |
| 40 | Ga0070665_100099122 | 3300005548 | Bacteria | 2918 |
| 41 | Ga0068855_100176362 | 3300005563 | Bacteria | 2418 |
| 42 | Ga0068855_100187602 | 3300005563 | Bacteria | 2335 |
| 43 | Ga0070664_100084031 | 3300005564 | Bacteria | 2747 |
| 44 | Ga0068857_100276573 | 3300005577 | Bacteria | 1544 |
| 45 | Ga0068857_100405401 | 3300005577 | Bacteria | 1269 |
| 46 | Ga0068852_100426524 | 3300005616 | Bacteria | 1309 |
| 47 | Ga0068859_100181183 | 3300005617 | Bacteria | 2189 |
| 48 | Ga0068864_100058929 | 3300005618 | Bacteria | 3320 |
| 49 | Ga0068864_100482813 | 3300005618 | Bacteria | 1190 |
| 50 | Ga0068861_100543530 | 3300005719 | Bacteria | 1057 |
| 51 | Ga0068851_10082500 | 3300005834 | Bacteria | 1681 |
| 52 | Ga0068863_100168707 | 3300005841 | Bacteria | 2099 |
| 53 | Ga0068858_100119984 | 3300005842 | Bacteria | 2458 |
| 54 | Ga0068860_100153207 | 3300005843 | Bacteria | 2220 |
| 55 | Ga0068860_100404460 | 3300005843 | Bacteria | 1351 |
| 56 | Ga0068862_100215475 | 3300005844 | Bacteria | 1736 |
| 57 | Ga0068862_100244654 | 3300005844 | Bacteria | 1632 |
| 58 | Ga0068862_100345350 | 3300005844 | Bacteria | 1379 |
| 59 | Ga0081455_10002982 | 3300005937 | Bacteria | 19755 |
| 60 | Ga0081540_1003851 | 3300005983 | Bacteria | 11718 |
| 61 | Ga0070717_10007544 | 3300006028 | Bacteria | 8083 |
| 62 | Ga0070717_10061397 | 3300006028 | Bacteria | 3114 |
| 63 | Ga0070717_10403065 | 3300006028 | Bacteria | 1229 |
| 64 | Ga0075365_10229899 | 3300006038 | Bacteria | 1302 |
| 65 | Ga0075368_10011424 | 3300006042 | Bacteria | 3231 |
| 66 | Ga0075363_100002488 | 3300006048 | Bacteria | 7545 |
| 67 | Ga0075363_100026304 | 3300006048 | Bacteria | 2976 |
| 68 | Ga0075364_10024940 | 3300006051 | Bacteria | 3802 |
| 69 | Ga0075364_10181953 | 3300006051 | Bacteria | 1422 |
| 70 | Ga0070715_10001127 | 3300006163 | Bacteria | 7613 |
| 71 | Ga0075362_10052802 | 3300006177 | Bacteria | 1823 |
| 72 | Ga0075369_10032260 | 3300006186 | Bacteria | 2215 |
| 73 | Ga0075369_10033876 | 3300006186 | Bacteria | 2166 |
| 74 | Ga0075369_10034387 | 3300006186 | Bacteria | 2151 |
| 75 | Ga0075366_10033470 | 3300006195 | Bacteria | 3027 |
| 76 | Ga0075370_10031839 | 3300006353 | Bacteria | 2945 |
| 77 | Ga0068871_100069423 | 3300006358 | Bacteria | 2894 |
| 78 | Ga0075428_100101949 | 3300006844 | Bacteria | 3129 |
| 79 | Ga0075429_100227680 | 3300006880 | Bacteria | 1633 |
| 80 | Ga0068865_100311655 | 3300006881 | Bacteria | 1263 |
| 81 | Ga0097620_100181187 | 3300006931 | Bacteria | 2189 |
| 82 | Ga0099824_1011502 | 3300006942 | Bacteria | 9987 |
| 83 | Ga0099822_1021826 | 3300006943 | Bacteria | 6137 |
| 84 | Ga0105240_10024721 | 3300009093 | Bacteria | 7912 |
| 85 | Ga0105240_10084695 | 3300009093 | Bacteria | 3887 |
| 86 | Ga0105245_10137591 | 3300009098 | Bacteria | 2297 |
| 87 | Ga0105245_10754062 | 3300009098 | Bacteria | 1009 |
| 88 | Ga0105247_10034754 | 3300009101 | Bacteria | 3070 |
| 89 | Ga0105247_10100789 | 3300009101 | Bacteria | 1846 |
| 90 | Ga0105247_10136111 | 3300009101 | Bacteria | 1605 |
| 91 | Ga0105247_10234014 | 3300009101 | Bacteria | 1249 |
| 92 | Ga0114129_10414231 | 3300009147 | Bacteria | 1774 |
| 93 | Ga0105243_10267575 | 3300009148 | Bacteria | 1533 |
| 94 | Ga0105241_10100450 | 3300009174 | Bacteria | 2299 |
| 95 | Ga0105248_10130483 | 3300009177 | Bacteria | 2835 |
| 96 | Ga0105248_10194824 | 3300009177 | Bacteria | 2283 |
| 97 | Ga0105248_10260394 | 3300009177 | Bacteria | 1953 |
| 98 | Ga0105237_10009950 | 3300009545 | Bacteria | 10145 |
| 99 | Ga0105237_10021234 | 3300009545 | Bacteria | 6678 |
| 100 | Ga0105237_10047158 | 3300009545 | Bacteria | 4332 |
| 101 | Ga0105238_10027647 | 3300009551 | Bacteria | 5781 |
| 102 | Ga0105238_10151847 | 3300009551 | Bacteria | 2291 |
| 103 | Ga0105238_10256812 | 3300009551 | Bacteria | 1727 |
| 104 | Ga0105239_10127564 | 3300010375 | Bacteria | 2829 |
| 105 | Ga0105239_10267093 | 3300010375 | Bacteria | 1924 |
| 106 | Ga0105239_10431855 | 3300010375 | Bacteria | 1493 |
| 107 | Ga0105239_10807034 | 3300010375 | Bacteria | 1075 |
| 108 | Ga0105239_11041703 | 3300010375 | Bacteria | 941 |
| 109 | Ga0105246_10013775 | 3300011119 | Bacteria | 5074 |
| 110 | Ga0157370_10057618 | 3300013104 | Bacteria | 3693 |
| 111 | Ga0157370_10178217 | 3300013104 | Bacteria | 1975 |
| 112 | Ga0157369_10012423 | 3300013105 | Bacteria | 9667 |
| 113 | Ga0157369_10064867 | 3300013105 | Bacteria | 3932 |
| 114 | Ga0157369_10433652 | 3300013105 | Bacteria | 1362 |
| 115 | Ga0157369_10661448 | 3300013105 | Bacteria | 1077 |
| 116 | Ga0157374_10024785 | 3300013296 | Bacteria | 5379 |
| 117 | Ga0157374_10040321 | 3300013296 | Bacteria | 4299 |
| 118 | Ga0157374_10179291 | 3300013296 | Bacteria | 2069 |
| 119 | Ga0157378_10004961 | 3300013297 | Bacteria | 11667 |
| 120 | Ga0157378_10278553 | 3300013297 | Bacteria | 1611 |
| 121 | Ga0163162_10060239 | 3300013306 | Bacteria | 3831 |
| 122 | Ga0163162_10390454 | 3300013306 | Bacteria | 1524 |
| 123 | Ga0163162_10740909 | 3300013306 | Bacteria | 1102 |
| 124 | Ga0157375_10105710 | 3300013308 | Bacteria | 2906 |
| 125 | Ga0157375_10644025 | 3300013308 | Bacteria | 1216 |
| 126 | Ga0163163_10009852 | 3300014325 | Bacteria | 8564 |
| 127 | Ga0163163_10060452 | 3300014325 | Bacteria | 3752 |
| 128 | Ga0163163_10124811 | 3300014325 | Bacteria | 2611 |
| 129 | Ga0163163_10814217 | 3300014325 | Bacteria | 997 |
| 130 | Ga0157380_10245136 | 3300014326 | Bacteria | 1618 |
| 131 | Ga0157377_10063726 | 3300014745 | Bacteria | 2112 |
| 132 | Ga0157377_10351293 | 3300014745 | Bacteria | 989 |
| 133 | Ga0157379_10100952 | 3300014968 | Bacteria | 2590 |
| 134 | Ga0157376_10053421 | 3300014969 | Bacteria | 3364 |
| 135 | Ga0157376_10259121 | 3300014969 | Bacteria | 1628 |
| 136 | Ga0157376_10724361 | 3300014969 | Bacteria | 1002 |
| 137 | Ga0163161_10563434 | 3300017792 | Bacteria | 935 |
| 138 | Ga0209563_100325 | 3300025230 | Bacteria | 18742 |
| 139 | Ga0209677_102346 | 3300025253 | Bacteria | 7251 |
| 140 | Ga0209233_1010275 | 3300025261 | Bacteria | 2815 |
| 141 | Ga0209233_1017593 | 3300025261 | Bacteria | 1944 |
| 142 | Ga0209564_1005325 | 3300025295 | Bacteria | 7407 |
| 143 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 144 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 145 | Ga0209758_1001848 | 3300025297 | Bacteria | 23245 |
| 146 | Ga0209758_1008838 | 3300025297 | Bacteria | 6412 |
| 147 | Ga0209256_1010441 | 3300025299 | Bacteria | 3886 |
| 148 | Ga0207426_1006703 | 3300025302 | Bacteria | 4942 |
| 149 | Ga0209051_1060292 | 3300025303 | Bacteria | 1198 |
| 150 | Ga0209257_1001101 | 3300025304 | Bacteria | 35153 |
| 151 | Ga0207647_10008820 | 3300025904 | Bacteria | 7199 |
| 152 | Ga0207705_10199849 | 3300025909 | Bacteria | 1514 |
| 153 | Ga0207654_10020891 | 3300025911 | Bacteria | 3476 |
| 154 | Ga0207671_10212161 | 3300025914 | Bacteria | 1515 |
| 155 | Ga0207671_10245556 | 3300025914 | Bacteria | 1407 |
| 156 | Ga0207693_10007874 | 3300025915 | Bacteria | 8752 |
| 157 | Ga0207657_10421943 | 3300025919 | Bacteria | 1048 |
| 158 | Ga0207649_10163987 | 3300025920 | Bacteria | 1542 |
| 159 | Ga0207652_10304152 | 3300025921 | Bacteria | 1439 |
| 160 | Ga0207694_10040173 | 3300025924 | Bacteria | 3601 |
| 161 | Ga0207700_10172042 | 3300025928 | Bacteria | 1807 |
| 162 | Ga0207644_10386177 | 3300025931 | Bacteria | 1142 |
| 163 | Ga0207644_10409285 | 3300025931 | Bacteria | 1110 |
| 164 | Ga0207669_10157627 | 3300025937 | Bacteria | 1599 |
| 165 | Ga0207665_10001385 | 3300025939 | Bacteria | 16335 |
| 166 | Ga0207665_10402319 | 3300025939 | Bacteria | 1043 |
| 167 | Ga0207691_10661332 | 3300025940 | Bacteria | 882 |
| 168 | Ga0207689_10019353 | 3300025942 | Bacteria | 5738 |
| 169 | Ga0207689_10167098 | 3300025942 | Bacteria | 1813 |
| 170 | Ga0207661_10040025 | 3300025944 | Bacteria | 3683 |
| 171 | Ga0207661_10254792 | 3300025944 | Bacteria | 1561 |
| 172 | Ga0207661_10491514 | 3300025944 | Bacteria | 1121 |
| 173 | Ga0207679_10465174 | 3300025945 | Bacteria | 1123 |
| 174 | Ga0207667_10168621 | 3300025949 | Bacteria | 2250 |
| 175 | Ga0207667_10172122 | 3300025949 | Bacteria | 2225 |
| 176 | Ga0207667_10492745 | 3300025949 | Bacteria | 1243 |
| 177 | Ga0207668_10318838 | 3300025972 | Bacteria | 1289 |
| 178 | Ga0207640_10103726 | 3300025981 | Bacteria | 2000 |
| 179 | Ga0207658_10097909 | 3300025986 | Bacteria | 2291 |
| 180 | Ga0207658_10109147 | 3300025986 | Bacteria | 2184 |
| 181 | Ga0207658_10374355 | 3300025986 | Bacteria | 1246 |
| 182 | Ga0207677_10073769 | 3300026023 | Bacteria | 2418 |
| 183 | Ga0207703_10129128 | 3300026035 | Bacteria | 2180 |
| 184 | Ga0207703_10302095 | 3300026035 | Bacteria | 1460 |
| 185 | Ga0207639_10089016 | 3300026041 | Bacteria | 2465 |
| 186 | Ga0207639_10151261 | 3300026041 | Bacteria | 1944 |
| 187 | Ga0207639_10266205 | 3300026041 | Bacteria | 1501 |
| 188 | Ga0207678_10017857 | 3300026067 | Bacteria | 6231 |
| 189 | Ga0207678_10022393 | 3300026067 | Bacteria | 5534 |
| 190 | Ga0207678_10026311 | 3300026067 | Bacteria | 5076 |
| 191 | Ga0207678_10033211 | 3300026067 | Bacteria | 4496 |
| 192 | Ga0207708_10147525 | 3300026075 | Bacteria | 1849 |
| 193 | Ga0207676_10068020 | 3300026095 | Bacteria | 2847 |
| 194 | Ga0207674_10007720 | 3300026116 | Bacteria | 12520 |
| 195 | Ga0207674_10167564 | 3300026116 | Bacteria | 2150 |
| 196 | Ga0207675_100048212 | 3300026118 | Bacteria | 3977 |
| 197 | Ga0207675_100058719 | 3300026118 | Bacteria | 3590 |
| 198 | Ga0207683_10003797 | 3300026121 | Bacteria | 13083 |
| 199 | Ga0207698_10132646 | 3300026142 | Bacteria | 2132 |
| 200 | Ga0207698_10383176 | 3300026142 | Bacteria | 1338 |
| 201 | Ga0207698_10390739 | 3300026142 | Bacteria | 1326 |
| 202 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 203 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 204 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 205 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 206 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 207 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 208 | Ga0209179_1003275 | 3300027512 | Bacteria | 2312 |
| 209 | Ga0209813_10013523 | 3300027866 | Bacteria | 2181 |
| 210 | Ga0268266_10007625 | 3300028379 | Bacteria | 9734 |
| 211 | Ga0268266_10013446 | 3300028379 | Bacteria | 7047 |
| 212 | Ga0268266_10020198 | 3300028379 | Bacteria | 5678 |
| 213 | Ga0268266_10056470 | 3300028379 | Bacteria | 3377 |
| 214 | Ga0268266_10078485 | 3300028379 | Bacteria | 2873 |
| 215 | Ga0268266_10079803 | 3300028379 | Bacteria | 2850 |
| 216 | Ga0268266_10243092 | 3300028379 | Bacteria | 1662 |
| 217 | Ga0268264_10140299 | 3300028381 | Bacteria | 2154 |
| 218 | Ga0268264_10380531 | 3300028381 | Bacteria | 1351 |
| 219 | Ga0307517_10000279 | 3300028786 | Bacteria | 88025 |
| 220 | Ga0307515_10163370 | 3300028794 | Bacteria | 2258 |
| 221 | Ga0265316_10246791 | 3300031344 | Bacteria | 1312 |
| 222 | Ga0307509_10098111 | 3300031507 | Bacteria | 2976 |
| 223 | Ga0265314_10076536 | 3300031711 | Bacteria | 2222 |
| 224 | Ga0265342_10080689 | 3300031712 | Bacteria | 1879 |
| 225 | Ga0307405_10457121 | 3300031731 | Bacteria | 1014 |
| 226 | Ga0307409_100320888 | 3300031995 | Bacteria | 1449 |
| 227 | Ga0307416_100343260 | 3300032002 | Bacteria | 1507 |
| 228 | Ga0307415_100149979 | 3300032126 | Bacteria | 1793 |
| 229 | Ga0307510_10006305 | 3300033180 | Bacteria | 14151 |
| 230 | Ga0307510_10041581 | 3300033180 | Bacteria | 5022 |
| 231 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 232 | Ga0373923_0000267 | 3300035111 | Bacteria | 11360 |
| 233 | Ga0373957_0022105 | 3300035120 | Bacteria | 2263 |
| 234 | Ga0373943_0000795 | 3300035170 | Bacteria | 13844 |
| 235 | Ga0373946_0006225 | 3300035171 | Bacteria | 4322 |
| 236 | Ga0373955_0021671 | 3300035172 | Bacteria | 3248 |
| 237 | Ga0373924_0009206 | 3300035410 | Bacteria | 3615 |
| 238 | Ga0373924_0017906 | 3300035410 | Bacteria | 2724 |
| 239 | Ga0373931_0023469 | 3300035691 | Bacteria | 3114 |
| 240 | Ga0373935_0000536 | 3300035692 | Bacteria | 19758 |
| 241 | Ga0373927_0000898 | 3300035695 | Bacteria | 22620 |
| 242 | Ga0373927_0149061 | 3300035695 | Bacteria | 1532 |
| 243 | Ga0373933_0066575 | 3300035724 | Bacteria | 2183 |
| 244 | Ga0373947_0010479 | 3300035725 | Bacteria | 5318 |
| 245 | Ga0373947_0171304 | 3300035725 | Bacteria | 1409 |
| 246 | Ga0373937_0064227 | 3300036401 | Bacteria | 3377 |
| 247 | Ga0373937_0095987 | 3300036401 | Bacteria | 2749 |
| 248 | Ga0373937_0151428 | 3300036401 | Bacteria | 2173 |
| 249 | Ga0373937_0297000 | 3300036401 | Bacteria | 1526 |
| 250 | Ga0373925_0001796 | 3300037068 | Bacteria | 17888 |
| 251 | Ga0395899_0177879 | 3300037312 | Bacteria | 1495 |
| 252 | Ga0395900_0111107 | 3300037418 | Bacteria | 2815 |
| 253 | Ga0395898_0064739 | 3300037466 | Bacteria | 3545 |
| 254 | Ga0395905_0386390 | 3300037471 | Bacteria | 1294 |
| 255 | Ga0395901_0137905 | 3300038443 | Bacteria | 2564 |
| 256 | Ga0395901_0204268 | 3300038443 | Bacteria | 2070 |
| 257 | Ga0439465_0055995 | 3300041413 | Bacteria | 1299 |
| 258 | Ga0451849_0432353 | 3300041505 | Bacteria | 989 |
| 259 | Ga0451853_2433109 | 3300041512 | Bacteria | 1741 |
| 260 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 261 | Ga0466963_0031606 | 3300044694 | Bacteria | 3423 |
| 262 | Ga0466957_0027162 | 3300044842 | Bacteria | 3400 |
| 263 | Ga0466960_0060690 | 3300044901 | Bacteria | 1854 |
| 264 | Ga0466967_0006352 | 3300045976 | Bacteria | 8348 |
| 265 | Ga0495617_058666 | 3300046452 | Bacteria | 1275 |
| 266 | Ga0495603_0000046 | 3300046455 | Bacteria | 53187 |
| 267 | Ga0495603_0002778 | 3300046455 | Bacteria | 10319 |
| 268 | Ga0495603_0180555 | 3300046455 | Bacteria | 1221 |
| 269 | Ga0495603_0240584 | 3300046455 | Bacteria | 1042 |
| 270 | Ga0495629_0000071 | 3300046459 | Bacteria | 88879 |
| 271 | Ga0495629_0065563 | 3300046459 | Bacteria | 2535 |
| 272 | Ga0495641_0009896 | 3300046461 | Bacteria | 5611 |
| 273 | Ga0495651_0227558 | 3300046462 | Bacteria | 1286 |
| 274 | Ga0495650_0121172 | 3300046471 | Bacteria | 963 |
| 275 | Ga0495580_0000057 | 3300046472 | Bacteria | 64650 |
| 276 | Ga0495582_0000111 | 3300046473 | Bacteria | 42751 |
| 277 | Ga0495639_0000108 | 3300046475 | Bacteria | 41656 |
| 278 | Ga0495639_0083076 | 3300046475 | Bacteria | 1494 |
| 279 | Ga0495662_0000992 | 3300046476 | Bacteria | 13882 |
| 280 | Ga0495664_0002718 | 3300046477 | Bacteria | 9505 |
| 281 | Ga0495585_0070948 | 3300046492 | Bacteria | 1899 |
| 282 | Ga0495594_0000133 | 3300046499 | Bacteria | 34897 |
| 283 | Ga0495594_0237949 | 3300046499 | Bacteria | 1038 |
| 284 | Ga0495606_0006998 | 3300046507 | Bacteria | 10238 |
| 285 | Ga0495606_0136524 | 3300046507 | Bacteria | 1452 |
| 286 | Ga0495608_0023395 | 3300046511 | Bacteria | 4234 |
| 287 | Ga0495616_0081220 | 3300046513 | Bacteria | 1551 |
| 288 | Ga0495618_0064992 | 3300046514 | Bacteria | 2318 |
| 289 | Ga0495620_0077867 | 3300046515 | Bacteria | 1345 |
| 290 | Ga0495620_0091398 | 3300046515 | Bacteria | 1221 |
| 291 | Ga0495630_0000959 | 3300046517 | Bacteria | 20201 |
| 292 | Ga0495630_0077623 | 3300046517 | Bacteria | 2504 |
| 293 | Ga0495631_0036622 | 3300046518 | Bacteria | 2190 |
| 294 | Ga0495632_0056495 | 3300046519 | Bacteria | 1918 |
| 295 | Ga0495643_0042317 | 3300046522 | Bacteria | 2481 |
| 296 | Ga0495648_0014927 | 3300046524 | Bacteria | 5658 |
| 297 | Ga0495648_0041864 | 3300046524 | Bacteria | 2888 |
| 298 | Ga0495666_0078399 | 3300046526 | Bacteria | 1565 |
| 299 | Ga0495652_0042099 | 3300046529 | Bacteria | 3939 |
| 300 | Ga0495665_0000001 | 3300046531 | Bacteria | 156121 |
| 301 | Ga0495640_0012179 | 3300046533 | Bacteria | 6583 |
| 302 | Ga0495586_0168797 | 3300046535 | Bacteria | 1236 |
| 303 | Ga0495587_0202775 | 3300046536 | Bacteria | 1121 |
| 304 | Ga0495609_0072783 | 3300046538 | Bacteria | 1509 |
| 305 | Ga0495645_0058108 | 3300046543 | Bacteria | 2806 |
| 306 | Ga0495622_0001363 | 3300046557 | Bacteria | 12492 |
| 307 | Ga0495633_0148817 | 3300046558 | Bacteria | 1082 |
| 308 | Ga0495667_0032071 | 3300046559 | Bacteria | 3523 |
| 309 | Ga0495667_0206994 | 3300046559 | Bacteria | 1254 |
| 310 | Ga0495656_0002642 | 3300046615 | Bacteria | 5973 |
| 311 | Ga0495656_0126518 | 3300046615 | Bacteria | 1212 |
| 312 | Ga0495656_0141170 | 3300046615 | Bacteria | 1155 |
| 313 | Ga0495668_0055701 | 3300046616 | Bacteria | 2183 |
| 314 | Ga0495634_0000046 | 3300046642 | Bacteria | 97947 |
| 315 | Ga0495634_0123320 | 3300046642 | Bacteria | 1658 |
| 316 | Ga0495625_0116759 | 3300046660 | Bacteria | 1820 |
| 317 | Ga0495635_0000338 | 3300046663 | Bacteria | 29955 |
| 318 | Ga0495659_0009434 | 3300046664 | Bacteria | 3114 |
| 319 | Ga0495588_0001464 | 3300046674 | Bacteria | 10138 |
| 320 | Ga0495588_0112999 | 3300046674 | Bacteria | 1431 |
| 321 | Ga0495599_0086294 | 3300046678 | Bacteria | 1960 |
| 322 | Ga0495623_0091416 | 3300046679 | Bacteria | 1867 |
| 323 | Ga0495646_0008580 | 3300046680 | Bacteria | 6490 |
| 324 | Ga0495647_0000754 | 3300046681 | Bacteria | 9612 |
| 325 | Ga0495647_0037982 | 3300046681 | Bacteria | 1820 |
| 326 | Ga0495658_0000994 | 3300046683 | Bacteria | 14995 |
| 327 | Ga0495658_0096530 | 3300046683 | Bacteria | 1758 |
| 328 | Ga0495613_0000928 | 3300046689 | Bacteria | 22495 |
| 329 | Ga0495624_0003652 | 3300046690 | Bacteria | 11380 |
| 330 | Ga0495624_0245547 | 3300046690 | Bacteria | 1083 |
| 331 | Ga0495649_0015884 | 3300046694 | Bacteria | 4277 |
| 332 | Ga0495649_0093239 | 3300046694 | Bacteria | 1603 |
| 333 | Ga0495600_0189485 | 3300046809 | Bacteria | 1323 |
| 334 | Ga0495581_0000012 | 3300047315 | Bacteria | 62886 |
| 335 | Ga0495581_0104891 | 3300047315 | Bacteria | 1643 |
| 336 | Ga0495581_0168311 | 3300047315 | Bacteria | 1282 |
| 337 | Ga0495604_0071062 | 3300047317 | Bacteria | 2634 |
| 338 | Ga0495604_0238673 | 3300047317 | Bacteria | 1244 |
| 339 | Ga0495636_0043671 | 3300047318 | Bacteria | 1866 |
| 340 | Ga0495674_0000031 | 3300047319 | Bacteria | 115867 |
| 341 | Ga0495672_0078591 | 3300047320 | Bacteria | 1845 |
| 342 | Ga0495676_0201835 | 3300047321 | Bacteria | 1381 |
| 343 | Ga0495687_006694 | 3300047443 | Bacteria | 6990 |
| 344 | Ga0495673_0045802 | 3300047469 | Bacteria | 1942 |
| 345 | Ga0495686_0182057 | 3300047472 | Bacteria | 1217 |
| 346 | Ga0495686_0191125 | 3300047472 | Bacteria | 1180 |
| 347 | Ga0495593_0000008 | 3300047673 | Bacteria | 87310 |
| 348 | Ga0495602_0177171 | 3300048088 | Bacteria | 1648 |
| 349 | Ga0495602_0386165 | 3300048088 | Bacteria | 1002 |
| 350 | Ga0495614_0009666 | 3300048089 | Bacteria | 4262 |
| 351 | Ga0496100_0081519 | 3300048903 | Bacteria | 2186 |
| 352 | Ga0496100_0139144 | 3300048903 | Bacteria | 1718 |
| 353 | Ga0496101_0183070 | 3300048904 | Bacteria | 1614 |
| 354 | Ga0496102_0003595 | 3300048905 | Bacteria | 13132 |
| 355 | Ga0496102_0072804 | 3300048905 | Bacteria | 3158 |
| 356 | Ga0496102_0106267 | 3300048905 | Bacteria | 2612 |
| 357 | Ga0496103_0004751 | 3300048906 | Bacteria | 8214 |
| 358 | Ga0496104_0056792 | 3300048907 | Bacteria | 3703 |
| 359 | Ga0496104_0341279 | 3300048907 | Bacteria | 1411 |
| 360 | Ga0496105_0116561 | 3300048908 | Bacteria | 2203 |
| 361 | Ga0496105_0157034 | 3300048908 | Bacteria | 1868 |
| 362 | Ga0496106_0029456 | 3300048909 | Bacteria | 4091 |
| 363 | Ga0496106_0031714 | 3300048909 | Bacteria | 3938 |
| 364 | Ga0496106_0233068 | 3300048909 | Bacteria | 1470 |
| 365 | Ga0496106_0585026 | 3300048909 | Bacteria | 895 |
| 366 | Ga0496107_0000947 | 3300048910 | Bacteria | 17177 |
| 367 | Ga0496108_0013705 | 3300048911 | Bacteria | 6616 |
| 368 | Ga0496108_0028679 | 3300048911 | Bacteria | 4606 |
| 369 | Ga0496108_0053689 | 3300048911 | Bacteria | 3380 |
| 370 | Ga0496108_0094617 | 3300048911 | Bacteria | 2543 |
| 371 | Ga0496108_0229456 | 3300048911 | Bacteria | 1614 |
| 372 | Ga0496109_0008951 | 3300048912 | Bacteria | 8527 |
| 373 | Ga0496109_0110861 | 3300048912 | Bacteria | 2551 |
| 374 | Ga0496109_0196509 | 3300048912 | Bacteria | 1896 |
| 375 | Ga0496110_0047060 | 3300048913 | Bacteria | 3775 |
| 376 | Ga0496110_0164218 | 3300048913 | Bacteria | 2013 |
| 377 | Ga0496110_0329716 | 3300048913 | Bacteria | 1390 |
| 378 | Ga0496111_0015443 | 3300048914 | Bacteria | 5242 |
| 379 | Ga0496111_0028576 | 3300048914 | Bacteria | 3953 |
| 380 | Ga0496112_0012760 | 3300048915 | Bacteria | 7731 |
| 381 | Ga0496112_0027701 | 3300048915 | Bacteria | 5465 |
| 382 | Ga0496112_0132201 | 3300048915 | Bacteria | 2466 |
| 383 | Ga0496113_0001327 | 3300048916 | Bacteria | 13676 |
| 384 | Ga0496113_0039228 | 3300048916 | Bacteria | 3485 |
| 385 | Ga0496113_0111008 | 3300048916 | Bacteria | 2134 |
| 386 | Ga0496114_0024353 | 3300048917 | Bacteria | 4940 |
| 387 | Ga0496115_0000604 | 3300048918 | Bacteria | 27391 |
| 388 | Ga0496115_0033862 | 3300048918 | Bacteria | 4036 |
| 389 | Ga0496115_0365576 | 3300048918 | Bacteria | 1175 |
| 390 | Ga0496117_0068811 | 3300048920 | Bacteria | 2388 |
| 391 | Ga0496118_0092830 | 3300048921 | Bacteria | 2070 |
| 392 | Ga0496119_0057406 | 3300048922 | Bacteria | 2352 |
| 393 | Ga0496121_0062307 | 3300048924 | Bacteria | 3056 |
| 394 | Ga0496125_0067022 | 3300048928 | Bacteria | 2832 |
| 395 | Ga0496126_0008677 | 3300048929 | Bacteria | 10918 |
| 396 | Ga0496126_0173025 | 3300048929 | Bacteria | 1838 |
| 397 | Ga0496126_0296898 | 3300048929 | Bacteria | 1334 |
| 398 | nmdc:mga03683_55344_c1 | 3300050489 | Bacteria | 1666 |
| 399 | nmdc:mga03n38_106390_c1 | 3300050490 | Bacteria | 1360 |
| 400 | nmdc:mga03n38_1351_c1 | 3300050490 | Bacteria | 6942 |
| 401 | nmdc:mga03n38_44340_c1 | 3300050490 | Bacteria | 1953 |
| 402 | nmdc:mga00v17_4146_c1 | 3300050491 | Bacteria | 7505 |
| 403 | nmdc:mga0yw44_47972_c1 | 3300050492 | Bacteria | 2574 |
| 404 | nmdc:mga0yw44_5233_c1 | 3300050492 | Bacteria | 6085 |
| 405 | nmdc:mga0yw44_70100_c1 | 3300050492 | Bacteria | 1396 |
| 406 | nmdc:mga06z11_61386_c1 | 3300050494 | Bacteria | 1960 |
| 407 | nmdc:mga04h51_36493_c1 | 3300050495 | Bacteria | 1582 |
| 408 | nmdc:mga07m45_44129_c1 | 3300050496 | Bacteria | 2501 |
| 409 | nmdc:mga07m45_82651_c1 | 3300050496 | Bacteria | 1834 |
| 410 | nmdc:mga05p37_40049_c1 | 3300050507 | Bacteria | 5754 |
| 411 | nmdc:mga0sz30_184682_c1 | 3300050516 | Bacteria | 926 |
| 412 | nmdc:mga0sz30_31337_c1 | 3300050516 | Bacteria | 1830 |
| 413 | Ga0495601_0167446 | 3300053077 | Bacteria | 1436 |
| 414 | Ga0495612_0021447 | 3300053078 | Bacteria | 2592 |
| 415 | Ga0495612_0026650 | 3300053078 | Bacteria | 2323 |
| 416 | Ga0500635_0017787 | 3300053080 | Bacteria | 2135 |
| 417 | Ga0495595_0031623 | 3300053084 | Bacteria | 2380 |
| 418 | Ga0495619_0022726 | 3300053085 | Bacteria | 4016 |
| 419 | Ga0495619_0036652 | 3300053085 | Bacteria | 3194 |
| 420 | Ga0495619_0232266 | 3300053085 | Bacteria | 1278 |
| 421 | Ga0500578_0235792 | 3300053086 | Bacteria | 1107 |
| 422 | Ga0500566_0000293 | 3300053094 | Bacteria | 26861 |
| 423 | Ga0500566_0000412 | 3300053094 | Bacteria | 23818 |
| 424 | Ga0500641_0009681 | 3300053096 | Bacteria | 3467 |
| 425 | Ga0500554_004219 | 3300053102 | Bacteria | 3025 |
| 426 | Ga0500554_032547 | 3300053102 | Bacteria | 1548 |
| 427 | Ga0500595_000395 | 3300053119 | Bacteria | 28044 |
| 428 | Ga0500595_016246 | 3300053119 | Bacteria | 2776 |
| 429 | Ga0500642_0000127 | 3300053130 | Bacteria | 34341 |
| 430 | Ga0500658_0212920 | 3300053134 | Bacteria | 885 |
| 431 | Ga0500603_006349 | 3300053150 | Bacteria | 2567 |
| 432 | Ga0500622_0063763 | 3300053156 | Bacteria | 1875 |
| 433 | Ga0500638_000370 | 3300053162 | Bacteria | 10477 |
| 434 | Ga0500637_0000026 | 3300053178 | Bacteria | 59050 |
| 435 | Ga0500637_0079586 | 3300053178 | Bacteria | 1892 |
| 436 | Ga0500637_0305746 | 3300053178 | Bacteria | 865 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048088 | Ga0495602_0386165 | Ga0495602_0386165_104_895 | 239 |
| 2 | iso_pu_bacteria | 2824644064 | 2824652637 | 244 |
| 3 | 3300031344 | Ga0265316_10246791 | Ga0265316_102467912 | 245 |
| 4 | 3300046507 | Ga0495606_0136524 | Ga0495606_0136524_698_1441 | 247 |
| 5 | iso_pu_bacteria | 2844315083 | 2844320216 | 247 |
| 6 | iso_pu_bacteria | 2881364244 | 2881370118 | 247 |
| 7 | iso_pu_bacteria | 2903727486 | 2903731194 | 247 |
| 8 | iso_pu_bacteria | 2906602504 | 2906610039 | 247 |
| 9 | 3300044694 | Ga0466963_0031606 | Ga0466963_0031606_638_1384 | 248 |
| 10 | 3300044842 | Ga0466957_0027162 | Ga0466957_0027162_452_1198 | 248 |
| 11 | 3300045976 | Ga0466967_0006352 | Ga0466967_0006352_4017_4763 | 248 |
| 12 | 3300037418 | Ga0395900_0111107 | Ga0395900_0111107_875_1627 | 249 |
| 13 | 3300038443 | Ga0395901_0204268 | Ga0395901_0204268_895_1647 | 249 |
| 14 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_67099_67848 | 249 |
| 15 | 3300047315 | Ga0495581_0168311 | Ga0495581_0168311_22_774 | 249 |
| 16 | 3300053080 | Ga0500635_0017787 | Ga0500635_0017787_814_1572 | 249 |
| 17 | 3300053102 | Ga0500554_004219 | Ga0500554_004219_1023_1781 | 249 |
| 18 | 3300053150 | Ga0500603_006349 | Ga0500603_006349_99_857 | 249 |
| 19 | 3300005577 | Ga0068857_100405401 | Ga0068857_1004054012 | 250 |
| 20 | 3300047320 | Ga0495672_0078591 | Ga0495672_0078591_149_901 | 250 |
| 21 | 3300050516 | nmdc:mga0sz30_184682_c1 | nmdc:mga0sz30_184682_c1_13_768 | 251 |
| 22 | iso_pu_bacteria | 2513237137 | 2513857031 | 253 |
| 23 | iso_pu_bacteria | 2517572143 | 2517891155 | 253 |
| 24 | iso_pu_bacteria | 2524023228 | 2524533661 | 253 |
| 25 | iso_pu_bacteria | 2728368998 | 2728755520 | 253 |
| 26 | iso_pu_bacteria | 2791355197 | 2793066498 | 253 |
| 27 | iso_pu_bacteria | 2903748898 | 2903752226 | 253 |
| 28 | iso_pu_bacteria | 2904699407 | 2904701034 | 253 |
| 29 | iso_pu_bacteria | 2906610324 | 2906616335 | 253 |
| 30 | iso_pu_bacteria | 2908739725 | 2908741473 | 253 |
| 31 | iso_pu_bacteria | 2908756301 | 2908758742 | 253 |
| 32 | iso_pu_bacteria | 2922425934 | 2922431667 | 253 |
| 33 | iso_pu_bacteria | 2935630451 | 2935635783 | 253 |
| 34 | iso_pu_bacteria | 2941507105 | 2941512380 | 253 |
| 35 | iso_pu_bacteria | 2941515067 | 2941520115 | 253 |
| 36 | iso_pu_bacteria | 2941523033 | 2941528264 | 253 |
| 37 | iso_pu_bacteria | 3005474847 | 3005481466 | 253 |
| 38 | iso_pu_bacteria | 8006933436 | 8006939251 | 253 |
| 39 | iso_pu_bacteria | 8006973647 | 8006978909 | 253 |
| 40 | iso_pu_bacteria | 8019555841 | 8019565112 | 253 |
| 41 | iso_pu_bacteria | 8019565922 | 8019575214 | 253 |
| 42 | 3300009148 | Ga0105243_10267575 | Ga0105243_102675752 | 255 |
| 43 | 3300013105 | Ga0157369_10064867 | Ga0157369_100648676 | 255 |
| 44 | 3300013297 | Ga0157378_10004961 | Ga0157378_100049613 | 255 |
| 45 | 3300014745 | Ga0157377_10351293 | Ga0157377_103512931 | 255 |
| 46 | 3300025986 | Ga0207658_10374355 | Ga0207658_103743552 | 255 |
| 47 | 3300028379 | Ga0268266_10078485 | Ga0268266_100784853 | 255 |
| 48 | 3300035724 | Ga0373933_0066575 | Ga0373933_0066575_1234_2025 | 255 |
| 49 | 3300037312 | Ga0395899_0177879 | Ga0395899_0177879_560_1330 | 255 |
| 50 | 3300037466 | Ga0395898_0064739 | Ga0395898_0064739_446_1216 | 255 |
| 51 | 3300046559 | Ga0495667_0206994 | Ga0495667_0206994_223_1014 | 255 |
| 52 | 3300046674 | Ga0495588_0112999 | Ga0495588_0112999_413_1180 | 255 |
| 53 | iso_pu_bacteria | 2511231028 | 2511398975 | 255 |
| 54 | iso_pu_bacteria | 2513237092 | 2513621665 | 255 |
| 55 | iso_pu_bacteria | 2513237095 | 2513651149 | 255 |
| 56 | iso_pu_bacteria | 2513237102 | 2513700652 | 255 |
| 57 | iso_pu_bacteria | 2513237139 | 2513878362 | 255 |
| 58 | iso_pu_bacteria | 2513237161 | 2514011711 | 255 |
| 59 | iso_pu_bacteria | 2617270735 | 2617352714 | 255 |
| 60 | iso_pu_bacteria | 2802429603 | 2805920585 | 255 |
| 61 | iso_pu_bacteria | 2816332527 | 2818236771 | 255 |
| 62 | iso_pu_bacteria | 2824617872 | 2824622031 | 255 |
| 63 | iso_pu_bacteria | 2824626560 | 2824629295 | 255 |
| 64 | iso_pu_bacteria | 2824671348 | 2824675203 | 255 |
| 65 | iso_pu_bacteria | 2824687955 | 2824690049 | 255 |
| 66 | iso_pu_bacteria | 2824696289 | 2824701154 | 255 |
| 67 | iso_pu_bacteria | 2824723954 | 2824731757 | 255 |
| 68 | iso_pu_bacteria | 2824773399 | 2824776681 | 255 |
| 69 | iso_pu_bacteria | 2838122688 | 2838127369 | 255 |
| 70 | iso_pu_bacteria | 2841941048 | 2841946388 | 255 |
| 71 | iso_pu_bacteria | 2841949485 | 2841957107 | 255 |
| 72 | iso_pu_bacteria | 2841966195 | 2841972898 | 255 |
| 73 | iso_pu_bacteria | 2841974524 | 2841978430 | 255 |
| 74 | iso_pu_bacteria | 2841983080 | 2841987468 | 255 |
| 75 | iso_pu_bacteria | 2847939898 | 2847947966 | 255 |
| 76 | iso_pu_bacteria | 2874612657 | 2874616760 | 255 |
| 77 | iso_pu_bacteria | 2874620515 | 2874628290 | 255 |
| 78 | iso_pu_bacteria | 2879083081 | 2879084951 | 255 |
| 79 | iso_pu_bacteria | 2881665667 | 2881670118 | 255 |
| 80 | iso_pu_bacteria | 2885366525 | 2885370183 | 255 |
| 81 | iso_pu_bacteria | 2888388044 | 2888392573 | 255 |
| 82 | iso_pu_bacteria | 2904666416 | 2904674091 | 255 |
| 83 | iso_pu_bacteria | 2906643746 | 2906651213 | 255 |
| 84 | iso_pu_bacteria | 2935883170 | 2935885691 | 255 |
| 85 | iso_pu_bacteria | 3005483717 | 3005488446 | 255 |
| 86 | iso_pu_bacteria | 3005506211 | 3005508227 | 255 |
| 87 | iso_pu_bacteria | 3005587118 | 3005588271 | 255 |
| 88 | iso_pu_bacteria | 3005594810 | 3005600529 | 255 |
| 89 | iso_pu_bacteria | 8016622563 | 8016625421 | 255 |
| 90 | 3300005548 | Ga0070665_100021601 | Ga0070665_1000216015 | 256 |
| 91 | 3300028379 | Ga0268266_10013446 | Ga0268266_100134465 | 256 |
| 92 | 3300028379 | Ga0268266_10079803 | Ga0268266_100798032 | 256 |
| 93 | 3300036401 | Ga0373937_0151428 | Ga0373937_0151428_86_859 | 256 |
| 94 | 3300038443 | Ga0395901_0137905 | Ga0395901_0137905_990_1760 | 256 |
| 95 | 3300053134 | Ga0500658_0212920 | Ga0500658_0212920_20_793 | 256 |
| 96 | 3300005334 | Ga0068869_100204188 | Ga0068869_1002041882 | 257 |
| 97 | 3300005336 | Ga0070680_100119741 | Ga0070680_1001197413 | 257 |
| 98 | 3300005337 | Ga0070682_100279061 | Ga0070682_1002790612 | 257 |
| 99 | 3300005338 | Ga0068868_100048941 | Ga0068868_1000489411 | 257 |
| 100 | 3300005344 | Ga0070661_100191217 | Ga0070661_1001912173 | 257 |
| 101 | 3300005353 | Ga0070669_100156285 | Ga0070669_1001562853 | 257 |
| 102 | 3300005355 | Ga0070671_100104083 | Ga0070671_1001040832 | 257 |
| 103 | 3300005356 | Ga0070674_100310311 | Ga0070674_1003103112 | 257 |
| 104 | 3300005364 | Ga0070673_100106590 | Ga0070673_1001065902 | 257 |
| 105 | 3300005455 | Ga0070663_100008949 | Ga0070663_1000089497 | 257 |
| 106 | 3300005455 | Ga0070663_100053262 | Ga0070663_1000532623 | 257 |
| 107 | 3300005456 | Ga0070678_100094705 | Ga0070678_1000947052 | 257 |
| 108 | 3300005456 | Ga0070678_100293777 | Ga0070678_1002937773 | 257 |
| 109 | 3300005458 | Ga0070681_10304038 | Ga0070681_103040381 | 257 |
| 110 | 3300005518 | Ga0070699_100326955 | Ga0070699_1003269551 | 257 |
| 111 | 3300005530 | Ga0070679_100561983 | Ga0070679_1005619831 | 257 |
| 112 | 3300005539 | Ga0068853_100207247 | Ga0068853_1002072472 | 257 |
| 113 | 3300005539 | Ga0068853_100300458 | Ga0068853_1003004583 | 257 |
| 114 | 3300005545 | Ga0070695_100290061 | Ga0070695_1002900612 | 257 |
| 115 | 3300005548 | Ga0070665_100023384 | Ga0070665_1000233844 | 257 |
| 116 | 3300005548 | Ga0070665_100078654 | Ga0070665_1000786543 | 257 |
| 117 | 3300005548 | Ga0070665_100099122 | Ga0070665_1000991223 | 257 |
| 118 | 3300005564 | Ga0070664_100084031 | Ga0070664_1000840313 | 257 |
| 119 | 3300005616 | Ga0068852_100426524 | Ga0068852_1004265241 | 257 |
| 120 | 3300005617 | Ga0068859_100181183 | Ga0068859_1001811834 | 257 |
| 121 | 3300005618 | Ga0068864_100058929 | Ga0068864_1000589292 | 257 |
| 122 | 3300005618 | Ga0068864_100482813 | Ga0068864_1004828132 | 257 |
| 123 | 3300005719 | Ga0068861_100543530 | Ga0068861_1005435301 | 257 |
| 124 | 3300005842 | Ga0068858_100119984 | Ga0068858_1001199842 | 257 |
| 125 | 3300005843 | Ga0068860_100153207 | Ga0068860_1001532074 | 257 |
| 126 | 3300005844 | Ga0068862_100215475 | Ga0068862_1002154753 | 257 |
| 127 | 3300005844 | Ga0068862_100244654 | Ga0068862_1002446542 | 257 |
| 128 | 3300005844 | Ga0068862_100345350 | Ga0068862_1003453501 | 257 |
| 129 | 3300005937 | Ga0081455_10002982 | Ga0081455_100029829 | 257 |
| 130 | 3300006028 | Ga0070717_10007544 | Ga0070717_100075442 | 257 |
| 131 | 3300006038 | Ga0075365_10229899 | Ga0075365_102298992 | 257 |
| 132 | 3300006048 | Ga0075363_100026304 | Ga0075363_1000263044 | 257 |
| 133 | 3300006051 | Ga0075364_10024940 | Ga0075364_100249405 | 257 |
| 134 | 3300006186 | Ga0075369_10032260 | Ga0075369_100322602 | 257 |
| 135 | 3300006358 | Ga0068871_100069423 | Ga0068871_1000694233 | 257 |
| 136 | 3300006844 | Ga0075428_100101949 | Ga0075428_1001019492 | 257 |
| 137 | 3300006880 | Ga0075429_100227680 | Ga0075429_1002276803 | 257 |
| 138 | 3300006881 | Ga0068865_100311655 | Ga0068865_1003116552 | 257 |
| 139 | 3300006931 | Ga0097620_100181187 | Ga0097620_1001811872 | 257 |
| 140 | 3300006943 | Ga0099822_1021826 | Ga0099822_10218264 | 257 |
| 141 | 3300009093 | Ga0105240_10024721 | Ga0105240_100247212 | 257 |
| 142 | 3300009098 | Ga0105245_10137591 | Ga0105245_101375914 | 257 |
| 143 | 3300009098 | Ga0105245_10754062 | Ga0105245_107540621 | 257 |
| 144 | 3300009101 | Ga0105247_10100789 | Ga0105247_101007892 | 257 |
| 145 | 3300009101 | Ga0105247_10136111 | Ga0105247_101361113 | 257 |
| 146 | 3300009101 | Ga0105247_10234014 | Ga0105247_102340142 | 257 |
| 147 | 3300009147 | Ga0114129_10414231 | Ga0114129_104142312 | 257 |
| 148 | 3300009177 | Ga0105248_10194824 | Ga0105248_101948243 | 257 |
| 149 | 3300009177 | Ga0105248_10260394 | Ga0105248_102603944 | 257 |
| 150 | 3300010375 | Ga0105239_11041703 | Ga0105239_110417032 | 257 |
| 151 | 3300013104 | Ga0157370_10178217 | Ga0157370_101782172 | 257 |
| 152 | 3300013296 | Ga0157374_10024785 | Ga0157374_100247856 | 257 |
| 153 | 3300013297 | Ga0157378_10278553 | Ga0157378_102785533 | 257 |
| 154 | 3300013306 | Ga0163162_10060239 | Ga0163162_100602391 | 257 |
| 155 | 3300013306 | Ga0163162_10740909 | Ga0163162_107409092 | 257 |
| 156 | 3300013308 | Ga0157375_10105710 | Ga0157375_101057104 | 257 |
| 157 | 3300013308 | Ga0157375_10644025 | Ga0157375_106440251 | 257 |
| 158 | 3300014325 | Ga0163163_10060452 | Ga0163163_100604522 | 257 |
| 159 | 3300014325 | Ga0163163_10814217 | Ga0163163_108142172 | 257 |
| 160 | 3300014326 | Ga0157380_10245136 | Ga0157380_102451362 | 257 |
| 161 | 3300014745 | Ga0157377_10063726 | Ga0157377_100637262 | 257 |
| 162 | 3300014969 | Ga0157376_10053421 | Ga0157376_100534214 | 257 |
| 163 | 3300014969 | Ga0157376_10259121 | Ga0157376_102591212 | 257 |
| 164 | 3300014969 | Ga0157376_10724361 | Ga0157376_107243612 | 257 |
| 165 | 3300017792 | Ga0163161_10563434 | Ga0163161_105634341 | 257 |
| 166 | 3300025261 | Ga0209233_1017593 | Ga0209233_10175931 | 257 |
| 167 | 3300025909 | Ga0207705_10199849 | Ga0207705_101998492 | 257 |
| 168 | 3300025919 | Ga0207657_10421943 | Ga0207657_104219431 | 257 |
| 169 | 3300025920 | Ga0207649_10163987 | Ga0207649_101639872 | 257 |
| 170 | 3300025921 | Ga0207652_10304152 | Ga0207652_103041522 | 257 |
| 171 | 3300025931 | Ga0207644_10409285 | Ga0207644_104092851 | 257 |
| 172 | 3300025937 | Ga0207669_10157627 | Ga0207669_101576272 | 257 |
| 173 | 3300025940 | Ga0207691_10661332 | Ga0207691_106613321 | 257 |
| 174 | 3300025942 | Ga0207689_10019353 | Ga0207689_100193535 | 257 |
| 175 | 3300025944 | Ga0207661_10040025 | Ga0207661_100400254 | 257 |
| 176 | 3300025944 | Ga0207661_10491514 | Ga0207661_104915142 | 257 |
| 177 | 3300025945 | Ga0207679_10465174 | Ga0207679_104651742 | 257 |
| 178 | 3300025972 | Ga0207668_10318838 | Ga0207668_103188381 | 257 |
| 179 | 3300025981 | Ga0207640_10103726 | Ga0207640_101037262 | 257 |
| 180 | 3300025986 | Ga0207658_10109147 | Ga0207658_101091472 | 257 |
| 181 | 3300026023 | Ga0207677_10073769 | Ga0207677_100737692 | 257 |
| 182 | 3300026035 | Ga0207703_10129128 | Ga0207703_101291282 | 257 |
| 183 | 3300026035 | Ga0207703_10302095 | Ga0207703_103020952 | 257 |
| 184 | 3300026041 | Ga0207639_10151261 | Ga0207639_101512613 | 257 |
| 185 | 3300026041 | Ga0207639_10266205 | Ga0207639_102662052 | 257 |
| 186 | 3300026067 | Ga0207678_10017857 | Ga0207678_100178574 | 257 |
| 187 | 3300026067 | Ga0207678_10026311 | Ga0207678_100263115 | 257 |
| 188 | 3300026067 | Ga0207678_10033211 | Ga0207678_100332113 | 257 |
| 189 | 3300026075 | Ga0207708_10147525 | Ga0207708_101475252 | 257 |
| 190 | 3300026095 | Ga0207676_10068020 | Ga0207676_100680204 | 257 |
| 191 | 3300026118 | Ga0207675_100048212 | Ga0207675_1000482125 | 257 |
| 192 | 3300026118 | Ga0207675_100058719 | Ga0207675_1000587195 | 257 |
| 193 | 3300026121 | Ga0207683_10003797 | Ga0207683_100037977 | 257 |
| 194 | 3300026142 | Ga0207698_10390739 | Ga0207698_103907392 | 257 |
| 195 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001137 | 257 |
| 196 | 3300027361 | Ga0209489_100012 | Ga0209489_10001237 | 257 |
| 197 | 3300027363 | Ga0209700_100019 | Ga0209700_10001937 | 257 |
| 198 | 3300028379 | Ga0268266_10007625 | Ga0268266_100076253 | 257 |
| 199 | 3300028379 | Ga0268266_10020198 | Ga0268266_100201984 | 257 |
| 200 | 3300028379 | Ga0268266_10056470 | Ga0268266_100564703 | 257 |
| 201 | 3300028381 | Ga0268264_10140299 | Ga0268264_101402992 | 257 |
| 202 | 3300028786 | Ga0307517_10000279 | Ga0307517_1000027920 | 257 |
| 203 | 3300028794 | Ga0307515_10163370 | Ga0307515_101633702 | 257 |
| 204 | 3300031507 | Ga0307509_10098111 | Ga0307509_100981115 | 257 |
| 205 | 3300031731 | Ga0307405_10457121 | Ga0307405_104571211 | 257 |
| 206 | 3300031995 | Ga0307409_100320888 | Ga0307409_1003208882 | 257 |
| 207 | 3300032002 | Ga0307416_100343260 | Ga0307416_1003432602 | 257 |
| 208 | 3300032126 | Ga0307415_100149979 | Ga0307415_1001499792 | 257 |
| 209 | 3300033180 | Ga0307510_10006305 | Ga0307510_1000630512 | 257 |
| 210 | 3300033180 | Ga0307510_10041581 | Ga0307510_100415815 | 257 |
| 211 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003443 | 257 |
| 212 | 3300035111 | Ga0373923_0000267 | Ga0373923_0000267_406_1182 | 257 |
| 213 | 3300035120 | Ga0373957_0022105 | Ga0373957_0022105_89_880 | 257 |
| 214 | 3300035410 | Ga0373924_0017906 | Ga0373924_0017906_319_1110 | 257 |
| 215 | 3300035691 | Ga0373931_0023469 | Ga0373931_0023469_1383_2156 | 257 |
| 216 | 3300035695 | Ga0373927_0149061 | Ga0373927_0149061_237_1010 | 257 |
| 217 | 3300035725 | Ga0373947_0171304 | Ga0373947_0171304_265_1041 | 257 |
| 218 | 3300036401 | Ga0373937_0297000 | Ga0373937_0297000_469_1260 | 257 |
| 219 | 3300041413 | Ga0439465_0055995 | Ga0439465_0055995_138_911 | 257 |
| 220 | 3300041505 | Ga0451849_0432353 | Ga0451849_0432353_176_949 | 257 |
| 221 | 3300041512 | Ga0451853_2433109 | Ga0451853_2433109_428_1204 | 257 |
| 222 | 3300046452 | Ga0495617_058666 | Ga0495617_058666_256_1029 | 257 |
| 223 | 3300046455 | Ga0495603_0002778 | Ga0495603_0002778_5773_6546 | 257 |
| 224 | 3300046455 | Ga0495603_0180555 | Ga0495603_0180555_64_837 | 257 |
| 225 | 3300046459 | Ga0495629_0065563 | Ga0495629_0065563_237_1010 | 257 |
| 226 | 3300046462 | Ga0495651_0227558 | Ga0495651_0227558_176_967 | 257 |
| 227 | 3300046471 | Ga0495650_0121172 | Ga0495650_0121172_156_929 | 257 |
| 228 | 3300046492 | Ga0495585_0070948 | Ga0495585_0070948_664_1437 | 257 |
| 229 | 3300046499 | Ga0495594_0237949 | Ga0495594_0237949_121_894 | 257 |
| 230 | 3300046511 | Ga0495608_0023395 | Ga0495608_0023395_2970_3761 | 257 |
| 231 | 3300046514 | Ga0495618_0064992 | Ga0495618_0064992_191_982 | 257 |
| 232 | 3300046517 | Ga0495630_0077623 | Ga0495630_0077623_180_953 | 257 |
| 233 | 3300046518 | Ga0495631_0036622 | Ga0495631_0036622_596_1369 | 257 |
| 234 | 3300046519 | Ga0495632_0056495 | Ga0495632_0056495_549_1322 | 257 |
| 235 | 3300046536 | Ga0495587_0202775 | Ga0495587_0202775_294_1085 | 257 |
| 236 | 3300046543 | Ga0495645_0058108 | Ga0495645_0058108_1456_2247 | 257 |
| 237 | 3300046558 | Ga0495633_0148817 | Ga0495633_0148817_64_837 | 257 |
| 238 | 3300046615 | Ga0495656_0002642 | Ga0495656_0002642_610_1383 | 257 |
| 239 | 3300046615 | Ga0495656_0126518 | Ga0495656_0126518_61_834 | 257 |
| 240 | 3300046615 | Ga0495656_0141170 | Ga0495656_0141170_301_1074 | 257 |
| 241 | 3300046616 | Ga0495668_0055701 | Ga0495668_0055701_852_1625 | 257 |
| 242 | 3300046642 | Ga0495634_0123320 | Ga0495634_0123320_113_904 | 257 |
| 243 | 3300046664 | Ga0495659_0009434 | Ga0495659_0009434_201_974 | 257 |
| 244 | 3300046678 | Ga0495599_0086294 | Ga0495599_0086294_672_1463 | 257 |
| 245 | 3300046679 | Ga0495623_0091416 | Ga0495623_0091416_319_1110 | 257 |
| 246 | 3300046683 | Ga0495658_0096530 | Ga0495658_0096530_722_1495 | 257 |
| 247 | 3300046690 | Ga0495624_0245547 | Ga0495624_0245547_14_787 | 257 |
| 248 | 3300046809 | Ga0495600_0189485 | Ga0495600_0189485_74_847 | 257 |
| 249 | 3300047315 | Ga0495581_0104891 | Ga0495581_0104891_430_1203 | 257 |
| 250 | 3300047317 | Ga0495604_0238673 | Ga0495604_0238673_161_934 | 257 |
| 251 | 3300047318 | Ga0495636_0043671 | Ga0495636_0043671_447_1220 | 257 |
| 252 | 3300047321 | Ga0495676_0201835 | Ga0495676_0201835_534_1307 | 257 |
| 253 | 3300047472 | Ga0495686_0182057 | Ga0495686_0182057_247_1020 | 257 |
| 254 | 3300048088 | Ga0495602_0177171 | Ga0495602_0177171_448_1239 | 257 |
| 255 | 3300048903 | Ga0496100_0139144 | Ga0496100_0139144_459_1235 | 257 |
| 256 | 3300048905 | Ga0496102_0003595 | Ga0496102_0003595_4394_5170 | 257 |
| 257 | 3300048907 | Ga0496104_0341279 | Ga0496104_0341279_471_1244 | 257 |
| 258 | 3300048908 | Ga0496105_0116561 | Ga0496105_0116561_919_1695 | 257 |
| 259 | 3300048909 | Ga0496106_0029456 | Ga0496106_0029456_2545_3321 | 257 |
| 260 | 3300048909 | Ga0496106_0585026 | Ga0496106_0585026_11_784 | 257 |
| 261 | 3300048910 | Ga0496107_0000947 | Ga0496107_0000947_4887_5663 | 257 |
| 262 | 3300048911 | Ga0496108_0013705 | Ga0496108_0013705_1910_2686 | 257 |
| 263 | 3300048911 | Ga0496108_0053689 | Ga0496108_0053689_514_1287 | 257 |
| 264 | 3300048911 | Ga0496108_0094617 | Ga0496108_0094617_185_958 | 257 |
| 265 | 3300048911 | Ga0496108_0229456 | Ga0496108_0229456_783_1556 | 257 |
| 266 | 3300048912 | Ga0496109_0008951 | Ga0496109_0008951_6754_7530 | 257 |
| 267 | 3300048912 | Ga0496109_0196509 | Ga0496109_0196509_567_1340 | 257 |
| 268 | 3300048913 | Ga0496110_0047060 | Ga0496110_0047060_886_1662 | 257 |
| 269 | 3300048913 | Ga0496110_0329716 | Ga0496110_0329716_414_1187 | 257 |
| 270 | 3300048914 | Ga0496111_0015443 | Ga0496111_0015443_4017_4793 | 257 |
| 271 | 3300048915 | Ga0496112_0012760 | Ga0496112_0012760_4970_5746 | 257 |
| 272 | 3300048916 | Ga0496113_0001327 | Ga0496113_0001327_7607_8383 | 257 |
| 273 | 3300048917 | Ga0496114_0024353 | Ga0496114_0024353_4026_4802 | 257 |
| 274 | 3300048918 | Ga0496115_0000604 | Ga0496115_0000604_4927_5703 | 257 |
| 275 | 3300048918 | Ga0496115_0365576 | Ga0496115_0365576_64_837 | 257 |
| 276 | 3300048924 | Ga0496121_0062307 | Ga0496121_0062307_759_1532 | 257 |
| 277 | 3300048928 | Ga0496125_0067022 | Ga0496125_0067022_1674_2447 | 257 |
| 278 | 3300048929 | Ga0496126_0008677 | Ga0496126_0008677_5023_5796 | 257 |
| 279 | 3300048929 | Ga0496126_0173025 | Ga0496126_0173025_78_851 | 257 |
| 280 | 3300048929 | Ga0496126_0296898 | Ga0496126_0296898_103_876 | 257 |
| 281 | 3300050490 | nmdc:mga03n38_106390_c1 | nmdc:mga03n38_106390_c1_45_818 | 257 |
| 282 | 3300050490 | nmdc:mga03n38_1351_c1 | nmdc:mga03n38_1351_c1_4258_5031 | 257 |
| 283 | 3300050491 | nmdc:mga00v17_4146_c1 | nmdc:mga00v17_4146_c1_1985_2758 | 257 |
| 284 | 3300050492 | nmdc:mga0yw44_5233_c1 | nmdc:mga0yw44_5233_c1_3972_4745 | 257 |
| 285 | 3300050492 | nmdc:mga0yw44_70100_c1 | nmdc:mga0yw44_70100_c1_198_971 | 257 |
| 286 | 3300050494 | nmdc:mga06z11_61386_c1 | nmdc:mga06z11_61386_c1_351_1124 | 257 |
| 287 | 3300050496 | nmdc:mga07m45_82651_c1 | nmdc:mga07m45_82651_c1_379_1152 | 257 |
| 288 | 3300050507 | nmdc:mga05p37_40049_c1 | nmdc:mga05p37_40049_c1_2533_3306 | 257 |
| 289 | 3300050516 | nmdc:mga0sz30_31337_c1 | nmdc:mga0sz30_31337_c1_385_1158 | 257 |
| 290 | 3300053077 | Ga0495601_0167446 | Ga0495601_0167446_216_989 | 257 |
| 291 | 3300053078 | Ga0495612_0021447 | Ga0495612_0021447_1264_2055 | 257 |
| 292 | 3300053084 | Ga0495595_0031623 | Ga0495595_0031623_357_1130 | 257 |
| 293 | 3300053085 | Ga0495619_0036652 | Ga0495619_0036652_2225_2998 | 257 |
| 294 | 3300053085 | Ga0495619_0232266 | Ga0495619_0232266_63_836 | 257 |
| 295 | 3300053094 | Ga0500566_0000293 | Ga0500566_0000293_13207_13980 | 257 |
| 296 | 3300053096 | Ga0500641_0009681 | Ga0500641_0009681_762_1535 | 257 |
| 297 | 3300053102 | Ga0500554_032547 | Ga0500554_032547_717_1490 | 257 |
| 298 | 3300053119 | Ga0500595_000395 | Ga0500595_000395_24659_25432 | 257 |
| 299 | 3300053156 | Ga0500622_0063763 | Ga0500622_0063763_1078_1851 | 257 |
| 300 | 3300053162 | Ga0500638_000370 | Ga0500638_000370_6623_7396 | 257 |
| 301 | 3300053178 | Ga0500637_0000026 | Ga0500637_0000026_35461_36234 | 257 |
| 302 | 3300053178 | Ga0500637_0079586 | Ga0500637_0079586_997_1770 | 257 |
| 303 | 3300005331 | Ga0070670_100046539 | Ga0070670_1000465394 | 258 |
| 304 | 3300005539 | Ga0068853_100068998 | Ga0068853_1000689984 | 258 |
| 305 | 3300005548 | Ga0070665_100053413 | Ga0070665_1000534132 | 258 |
| 306 | 3300005563 | Ga0068855_100187602 | Ga0068855_1001876023 | 258 |
| 307 | 3300005983 | Ga0081540_1003851 | Ga0081540_10038513 | 258 |
| 308 | 3300006028 | Ga0070717_10403065 | Ga0070717_104030652 | 258 |
| 309 | 3300009545 | Ga0105237_10021234 | Ga0105237_100212347 | 258 |
| 310 | 3300009551 | Ga0105238_10027647 | Ga0105238_100276473 | 258 |
| 311 | 3300010375 | Ga0105239_10267093 | Ga0105239_102670933 | 258 |
| 312 | 3300013105 | Ga0157369_10661448 | Ga0157369_106614481 | 258 |
| 313 | 3300013296 | Ga0157374_10179291 | Ga0157374_101792912 | 258 |
| 314 | 3300013306 | Ga0163162_10390454 | Ga0163162_103904542 | 258 |
| 315 | 3300025914 | Ga0207671_10245556 | Ga0207671_102455563 | 258 |
| 316 | 3300025924 | Ga0207694_10040173 | Ga0207694_100401735 | 258 |
| 317 | 3300025949 | Ga0207667_10168621 | Ga0207667_101686212 | 258 |
| 318 | 3300026041 | Ga0207639_10089016 | Ga0207639_100890164 | 258 |
| 319 | 3300026116 | Ga0207674_10167564 | Ga0207674_101675642 | 258 |
| 320 | 3300026142 | Ga0207698_10383176 | Ga0207698_103831761 | 258 |
| 321 | 3300028379 | Ga0268266_10243092 | Ga0268266_102430922 | 258 |
| 322 | 3300046455 | Ga0495603_0240584 | Ga0495603_0240584_102_878 | 258 |
| 323 | 3300046475 | Ga0495639_0083076 | Ga0495639_0083076_91_867 | 258 |
| 324 | 3300046681 | Ga0495647_0037982 | Ga0495647_0037982_97_873 | 258 |
| 325 | 3300048916 | Ga0496113_0039228 | Ga0496113_0039228_956_1732 | 258 |
| 326 | 3300003215 | JGI25153J46596_10013376 | JGI25153J46596_100133763 | 259 |
| 327 | 3300003354 | JGI25160J50197_1007102 | JGI25160J50197_10071023 | 259 |
| 328 | 3300003775 | Ga0055524_1027963 | Ga0055524_10279633 | 259 |
| 329 | 3300005262 | Ga0065165_1010604 | Ga0065165_10106044 | 259 |
| 330 | 3300005329 | Ga0070683_100076181 | Ga0070683_1000761815 | 259 |
| 331 | 3300005336 | Ga0070680_100023775 | Ga0070680_1000237753 | 259 |
| 332 | 3300005339 | Ga0070660_100037797 | Ga0070660_1000377972 | 259 |
| 333 | 3300005340 | Ga0070689_100143561 | Ga0070689_1001435613 | 259 |
| 334 | 3300005347 | Ga0070668_100101314 | Ga0070668_1001013142 | 259 |
| 335 | 3300005355 | Ga0070671_100044655 | Ga0070671_1000446552 | 259 |
| 336 | 3300005435 | Ga0070714_100173277 | Ga0070714_1001732773 | 259 |
| 337 | 3300005455 | Ga0070663_100065159 | Ga0070663_1000651592 | 259 |
| 338 | 3300005539 | Ga0068853_100252508 | Ga0068853_1002525083 | 259 |
| 339 | 3300005539 | Ga0068853_100381944 | Ga0068853_1003819442 | 259 |
| 340 | 3300005563 | Ga0068855_100176362 | Ga0068855_1001763623 | 259 |
| 341 | 3300005577 | Ga0068857_100276573 | Ga0068857_1002765732 | 259 |
| 342 | 3300005834 | Ga0068851_10082500 | Ga0068851_100825001 | 259 |
| 343 | 3300005841 | Ga0068863_100168707 | Ga0068863_1001687071 | 259 |
| 344 | 3300005843 | Ga0068860_100404460 | Ga0068860_1004044602 | 259 |
| 345 | 3300006028 | Ga0070717_10061397 | Ga0070717_100613973 | 259 |
| 346 | 3300006042 | Ga0075368_10011424 | Ga0075368_100114242 | 259 |
| 347 | 3300006048 | Ga0075363_100002488 | Ga0075363_1000024884 | 259 |
| 348 | 3300006051 | Ga0075364_10181953 | Ga0075364_101819533 | 259 |
| 349 | 3300006163 | Ga0070715_10001127 | Ga0070715_100011276 | 259 |
| 350 | 3300006177 | Ga0075362_10052802 | Ga0075362_100528022 | 259 |
| 351 | 3300006186 | Ga0075369_10033876 | Ga0075369_100338762 | 259 |
| 352 | 3300006186 | Ga0075369_10034387 | Ga0075369_100343872 | 259 |
| 353 | 3300006195 | Ga0075366_10033470 | Ga0075366_100334704 | 259 |
| 354 | 3300006353 | Ga0075370_10031839 | Ga0075370_100318393 | 259 |
| 355 | 3300006942 | Ga0099824_1011502 | Ga0099824_10115029 | 259 |
| 356 | 3300009093 | Ga0105240_10084695 | Ga0105240_100846955 | 259 |
| 357 | 3300009101 | Ga0105247_10034754 | Ga0105247_100347542 | 259 |
| 358 | 3300009174 | Ga0105241_10100450 | Ga0105241_101004503 | 259 |
| 359 | 3300009177 | Ga0105248_10130483 | Ga0105248_101304832 | 259 |
| 360 | 3300009545 | Ga0105237_10009950 | Ga0105237_1000995010 | 259 |
| 361 | 3300009545 | Ga0105237_10047158 | Ga0105237_100471584 | 259 |
| 362 | 3300009551 | Ga0105238_10151847 | Ga0105238_101518474 | 259 |
| 363 | 3300009551 | Ga0105238_10256812 | Ga0105238_102568122 | 259 |
| 364 | 3300010375 | Ga0105239_10127564 | Ga0105239_101275643 | 259 |
| 365 | 3300010375 | Ga0105239_10431855 | Ga0105239_104318552 | 259 |
| 366 | 3300010375 | Ga0105239_10807034 | Ga0105239_108070342 | 259 |
| 367 | 3300011119 | Ga0105246_10013775 | Ga0105246_100137756 | 259 |
| 368 | 3300013104 | Ga0157370_10057618 | Ga0157370_100576185 | 259 |
| 369 | 3300013105 | Ga0157369_10012423 | Ga0157369_100124233 | 259 |
| 370 | 3300013105 | Ga0157369_10433652 | Ga0157369_104336522 | 259 |
| 371 | 3300013296 | Ga0157374_10040321 | Ga0157374_100403215 | 259 |
| 372 | 3300014325 | Ga0163163_10009852 | Ga0163163_100098522 | 259 |
| 373 | 3300014325 | Ga0163163_10124811 | Ga0163163_101248112 | 259 |
| 374 | 3300014968 | Ga0157379_10100952 | Ga0157379_101009524 | 259 |
| 375 | 3300025230 | Ga0209563_100325 | Ga0209563_1003256 | 259 |
| 376 | 3300025253 | Ga0209677_102346 | Ga0209677_1023464 | 259 |
| 377 | 3300025261 | Ga0209233_1010275 | Ga0209233_10102753 | 259 |
| 378 | 3300025295 | Ga0209564_1005325 | Ga0209564_10053256 | 259 |
| 379 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011539 | 259 |
| 380 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012038 | 259 |
| 381 | 3300025297 | Ga0209758_1001848 | Ga0209758_100184816 | 259 |
| 382 | 3300025297 | Ga0209758_1008838 | Ga0209758_10088385 | 259 |
| 383 | 3300025299 | Ga0209256_1010441 | Ga0209256_10104415 | 259 |
| 384 | 3300025302 | Ga0207426_1006703 | Ga0207426_10067035 | 259 |
| 385 | 3300025303 | Ga0209051_1060292 | Ga0209051_10602922 | 259 |
| 386 | 3300025304 | Ga0209257_1001101 | Ga0209257_10011017 | 259 |
| 387 | 3300025904 | Ga0207647_10008820 | Ga0207647_100088206 | 259 |
| 388 | 3300025911 | Ga0207654_10020891 | Ga0207654_100208913 | 259 |
| 389 | 3300025914 | Ga0207671_10212161 | Ga0207671_102121612 | 259 |
| 390 | 3300025915 | Ga0207693_10007874 | Ga0207693_100078743 | 259 |
| 391 | 3300025928 | Ga0207700_10172042 | Ga0207700_101720423 | 259 |
| 392 | 3300025931 | Ga0207644_10386177 | Ga0207644_103861772 | 259 |
| 393 | 3300025939 | Ga0207665_10001385 | Ga0207665_100013854 | 259 |
| 394 | 3300025939 | Ga0207665_10402319 | Ga0207665_104023192 | 259 |
| 395 | 3300025942 | Ga0207689_10167098 | Ga0207689_101670982 | 259 |
| 396 | 3300025944 | Ga0207661_10254792 | Ga0207661_102547923 | 259 |
| 397 | 3300025949 | Ga0207667_10172122 | Ga0207667_101721223 | 259 |
| 398 | 3300025949 | Ga0207667_10492745 | Ga0207667_104927452 | 259 |
| 399 | 3300025986 | Ga0207658_10097909 | Ga0207658_100979092 | 259 |
| 400 | 3300026067 | Ga0207678_10022393 | Ga0207678_100223936 | 259 |
| 401 | 3300026116 | Ga0207674_10007720 | Ga0207674_100077204 | 259 |
| 402 | 3300026142 | Ga0207698_10132646 | Ga0207698_101326462 | 259 |
| 403 | 3300027296 | Ga0209389_1000043 | Ga0209389_100004320 | 259 |
| 404 | 3300027357 | Ga0209589_1000047 | Ga0209589_100004791 | 259 |
| 405 | 3300027361 | Ga0209489_100075 | Ga0209489_100075123 | 259 |
| 406 | 3300027512 | Ga0209179_1003275 | Ga0209179_10032751 | 259 |
| 407 | 3300027866 | Ga0209813_10013523 | Ga0209813_100135233 | 259 |
| 408 | 3300028381 | Ga0268264_10380531 | Ga0268264_103805312 | 259 |
| 409 | 3300031711 | Ga0265314_10076536 | Ga0265314_100765363 | 259 |
| 410 | 3300031712 | Ga0265342_10080689 | Ga0265342_100806892 | 259 |
| 411 | 3300035170 | Ga0373943_0000795 | Ga0373943_0000795_10080_10868 | 259 |
| 412 | 3300035171 | Ga0373946_0006225 | Ga0373946_0006225_1794_2582 | 259 |
| 413 | 3300035172 | Ga0373955_0021671 | Ga0373955_0021671_62_850 | 259 |
| 414 | 3300035410 | Ga0373924_0009206 | Ga0373924_0009206_1784_2572 | 259 |
| 415 | 3300035692 | Ga0373935_0000536 | Ga0373935_0000536_9020_9808 | 259 |
| 416 | 3300035695 | Ga0373927_0000898 | Ga0373927_0000898_6132_6920 | 259 |
| 417 | 3300035725 | Ga0373947_0010479 | Ga0373947_0010479_1612_2400 | 259 |
| 418 | 3300036401 | Ga0373937_0064227 | Ga0373937_0064227_2294_3082 | 259 |
| 419 | 3300036401 | Ga0373937_0095987 | Ga0373937_0095987_1941_2732 | 259 |
| 420 | 3300037068 | Ga0373925_0001796 | Ga0373925_0001796_285_1073 | 259 |
| 421 | 3300037471 | Ga0395905_0386390 | Ga0395905_0386390_265_1044 | 259 |
| 422 | 3300044901 | Ga0466960_0060690 | Ga0466960_0060690_41_820 | 259 |
| 423 | 3300046455 | Ga0495603_0000046 | Ga0495603_0000046_46660_47448 | 259 |
| 424 | 3300046459 | Ga0495629_0000071 | Ga0495629_0000071_23241_24029 | 259 |
| 425 | 3300046461 | Ga0495641_0009896 | Ga0495641_0009896_3101_3889 | 259 |
| 426 | 3300046472 | Ga0495580_0000057 | Ga0495580_0000057_38873_39661 | 259 |
| 427 | 3300046473 | Ga0495582_0000111 | Ga0495582_0000111_17132_17920 | 259 |
| 428 | 3300046475 | Ga0495639_0000108 | Ga0495639_0000108_14754_15542 | 259 |
| 429 | 3300046476 | Ga0495662_0000992 | Ga0495662_0000992_301_1089 | 259 |
| 430 | 3300046477 | Ga0495664_0002718 | Ga0495664_0002718_5154_5942 | 259 |
| 431 | 3300046499 | Ga0495594_0000133 | Ga0495594_0000133_9773_10561 | 259 |
| 432 | 3300046507 | Ga0495606_0006998 | Ga0495606_0006998_2666_3445 | 259 |
| 433 | 3300046513 | Ga0495616_0081220 | Ga0495616_0081220_409_1188 | 259 |
| 434 | 3300046515 | Ga0495620_0077867 | Ga0495620_0077867_431_1210 | 259 |
| 435 | 3300046515 | Ga0495620_0091398 | Ga0495620_0091398_206_985 | 259 |
| 436 | 3300046517 | Ga0495630_0000959 | Ga0495630_0000959_9582_10370 | 259 |
| 437 | 3300046522 | Ga0495643_0042317 | Ga0495643_0042317_1550_2329 | 259 |
| 438 | 3300046524 | Ga0495648_0014927 | Ga0495648_0014927_1205_1996 | 259 |
| 439 | 3300046524 | Ga0495648_0041864 | Ga0495648_0041864_1818_2597 | 259 |
| 440 | 3300046526 | Ga0495666_0078399 | Ga0495666_0078399_426_1214 | 259 |
| 441 | 3300046529 | Ga0495652_0042099 | Ga0495652_0042099_403_1191 | 259 |
| 442 | 3300046531 | Ga0495665_0000001 | Ga0495665_0000001_56251_57039 | 259 |
| 443 | 3300046533 | Ga0495640_0012179 | Ga0495640_0012179_3538_4326 | 259 |
| 444 | 3300046535 | Ga0495586_0168797 | Ga0495586_0168797_114_902 | 259 |
| 445 | 3300046538 | Ga0495609_0072783 | Ga0495609_0072783_241_1020 | 259 |
| 446 | 3300046557 | Ga0495622_0001363 | Ga0495622_0001363_8194_8982 | 259 |
| 447 | 3300046559 | Ga0495667_0032071 | Ga0495667_0032071_93_881 | 259 |
| 448 | 3300046642 | Ga0495634_0000046 | Ga0495634_0000046_24783_25571 | 259 |
| 449 | 3300046660 | Ga0495625_0116759 | Ga0495625_0116759_899_1678 | 259 |
| 450 | 3300046663 | Ga0495635_0000338 | Ga0495635_0000338_26247_27035 | 259 |
| 451 | 3300046674 | Ga0495588_0001464 | Ga0495588_0001464_4126_4914 | 259 |
| 452 | 3300046680 | Ga0495646_0008580 | Ga0495646_0008580_2118_2906 | 259 |
| 453 | 3300046681 | Ga0495647_0000754 | Ga0495647_0000754_6140_6928 | 259 |
| 454 | 3300046683 | Ga0495658_0000994 | Ga0495658_0000994_2417_3205 | 259 |
| 455 | 3300046689 | Ga0495613_0000928 | Ga0495613_0000928_617_1405 | 259 |
| 456 | 3300046690 | Ga0495624_0003652 | Ga0495624_0003652_8883_9671 | 259 |
| 457 | 3300046694 | Ga0495649_0015884 | Ga0495649_0015884_729_1508 | 259 |
| 458 | 3300046694 | Ga0495649_0093239 | Ga0495649_0093239_336_1115 | 259 |
| 459 | 3300047315 | Ga0495581_0000012 | Ga0495581_0000012_16328_17116 | 259 |
| 460 | 3300047317 | Ga0495604_0071062 | Ga0495604_0071062_326_1114 | 259 |
| 461 | 3300047319 | Ga0495674_0000031 | Ga0495674_0000031_23858_24646 | 259 |
| 462 | 3300047443 | Ga0495687_006694 | Ga0495687_006694_5884_6663 | 259 |
| 463 | 3300047469 | Ga0495673_0045802 | Ga0495673_0045802_148_939 | 259 |
| 464 | 3300047472 | Ga0495686_0191125 | Ga0495686_0191125_178_957 | 259 |
| 465 | 3300047673 | Ga0495593_0000008 | Ga0495593_0000008_31258_32046 | 259 |
| 466 | 3300048089 | Ga0495614_0009666 | Ga0495614_0009666_798_1586 | 259 |
| 467 | 3300048903 | Ga0496100_0081519 | Ga0496100_0081519_828_1607 | 259 |
| 468 | 3300048904 | Ga0496101_0183070 | Ga0496101_0183070_239_1018 | 259 |
| 469 | 3300048905 | Ga0496102_0072804 | Ga0496102_0072804_572_1351 | 259 |
| 470 | 3300048905 | Ga0496102_0106267 | Ga0496102_0106267_233_1108 | 259 |
| 471 | 3300048906 | Ga0496103_0004751 | Ga0496103_0004751_695_1474 | 259 |
| 472 | 3300048907 | Ga0496104_0056792 | Ga0496104_0056792_1487_2362 | 259 |
| 473 | 3300048908 | Ga0496105_0157034 | Ga0496105_0157034_161_982 | 259 |
| 474 | 3300048909 | Ga0496106_0031714 | Ga0496106_0031714_1382_2203 | 259 |
| 475 | 3300048909 | Ga0496106_0233068 | Ga0496106_0233068_98_877 | 259 |
| 476 | 3300048911 | Ga0496108_0028679 | Ga0496108_0028679_1687_2466 | 259 |
| 477 | 3300048912 | Ga0496109_0110861 | Ga0496109_0110861_1302_2081 | 259 |
| 478 | 3300048913 | Ga0496110_0164218 | Ga0496110_0164218_345_1124 | 259 |
| 479 | 3300048914 | Ga0496111_0028576 | Ga0496111_0028576_2030_2809 | 259 |
| 480 | 3300048915 | Ga0496112_0027701 | Ga0496112_0027701_4092_4913 | 259 |
| 481 | 3300048915 | Ga0496112_0132201 | Ga0496112_0132201_132_911 | 259 |
| 482 | 3300048916 | Ga0496113_0111008 | Ga0496113_0111008_997_1872 | 259 |
| 483 | 3300048918 | Ga0496115_0033862 | Ga0496115_0033862_1880_2755 | 259 |
| 484 | 3300048920 | Ga0496117_0068811 | Ga0496117_0068811_1300_2079 | 259 |
| 485 | 3300048921 | Ga0496118_0092830 | Ga0496118_0092830_98_877 | 259 |
| 486 | 3300048922 | Ga0496119_0057406 | Ga0496119_0057406_1397_2176 | 259 |
| 487 | 3300050489 | nmdc:mga03683_55344_c1 | nmdc:mga03683_55344_c1_296_1075 | 259 |
| 488 | 3300050490 | nmdc:mga03n38_44340_c1 | nmdc:mga03n38_44340_c1_768_1547 | 259 |
| 489 | 3300050492 | nmdc:mga0yw44_47972_c1 | nmdc:mga0yw44_47972_c1_1199_1978 | 259 |
| 490 | 3300050495 | nmdc:mga04h51_36493_c1 | nmdc:mga04h51_36493_c1_131_910 | 259 |
| 491 | 3300050496 | nmdc:mga07m45_44129_c1 | nmdc:mga07m45_44129_c1_1676_2455 | 259 |
| 492 | 3300053078 | Ga0495612_0026650 | Ga0495612_0026650_166_945 | 259 |
| 493 | 3300053085 | Ga0495619_0022726 | Ga0495619_0022726_2282_3061 | 259 |
| 494 | 3300053086 | Ga0500578_0235792 | Ga0500578_0235792_40_819 | 259 |
| 495 | 3300053094 | Ga0500566_0000412 | Ga0500566_0000412_13884_14663 | 259 |
| 496 | 3300053119 | Ga0500595_016246 | Ga0500595_016246_587_1366 | 259 |
| 497 | 3300053130 | Ga0500642_0000127 | Ga0500642_0000127_21425_22204 | 259 |
| 498 | 3300053178 | Ga0500637_0305746 | Ga0500637_0305746_28_819 | 259 |
| 499 | iso_pu_bacteria | 2824714736 | 2824723191 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h31-assembly3.cif.gz_E | oxidised soxax complex from rhodovulum sulfidophilum | 0.8693 | 30 | 259 |
| 2c1d-assembly4.cif.gz_G | crystal structure of soxxa from p. pantotrophus | 0.8554 | 31 | 258 |
| 3ocd-assembly2.cif.gz_C | diheme soxax - c236m mutant | 0.7936 | 50 | 255 |
| 1h31-assembly3.cif.gz_E | oxidised soxax complex from rhodovulum sulfidophilum | 0.7704 | 30 | 259 |
| 3oa8-assembly1.cif.gz_E | diheme soxax | 0.7679 | 50 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h31A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.958 | 53 | 140 | 1.10.760.10 |
| 1h31A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9476 | 53 | 140 | 1.10.760.10 |
| 2c1dG02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9226 | 53 | 142 | 1.10.760.10 |
| 2c1dG02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9129 | 53 | 142 | 1.10.760.10 |
| 3oa8A02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8152 | 54 | 142 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A389MKJ9-F1-model_v4 | Cytochrome c domain-containing protein | 0.9639 | 29 | 152 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A537QI86-F1-model_v4 | Sulfur oxidation c-type cytochrome SoxA | 0.9516 | 18 | 126 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A848T643-F1-model_v4 | Sulfur oxidation c-type cytochrome SoxA | 0.9497 | 31 | 175 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2R4D2R5-F1-model_v4 | deleted | 0.9426 | 83 | 147 |
|
| AF-A0A690A064-F1-model_v4 | deleted | 0.9408 | 83 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar