F455401

General Info

Members Datasets Scaffolds Average Seq Length
499 444 183 427

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1260512|Ga0436363_1260512_3308_4648
Length 446
Sequence MAIDVKSPEFGLLAQTDLIDDRVRGVPPGTAAISPSEVPAQGWRPADGVMALPVLTLDEAAFANNRDLMLRYVKEHGVEIAPHAKTPMCPELAASLVKAGAWGTTVADIRQASVMLKAGLTRLLLANEVGGRGGALRLARLLASYPKAEFFIFADSPEAVAALAEAWRLEPAAPNIGILVEVGAGRAGARDAAAADRVIEAIRDPGPDARLALAGVATYEGTVAVADAVKTRAAIDDLMALTHEVYGKVRGLVGPEIPLILTAGGSSYFDWVVAALQPMIAADGNARLILRSGAIFFQDHGGYARAMAAIDERDGFAIGGRRVAAAEAFRPALRLWAEVLSRPEPGLAVCGMGMRDVSYDQDLPRPLRVHRDGRPLVEIAGPEAMQVLKLNDQHAFVAVDPQSPICVGDVIEFGISHPCTCMDKWRVLFGLDEKGRVVAAHPTFFG

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
16 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
17 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
20 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
21 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
22 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
23 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
24 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
25 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
28 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
29 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
30 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
31 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
34 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
35 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
36 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
37 2643221607 Rhizobium sp. Root73 Isolate Unclassified
38 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
39 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
40 2718217882 Rhizobium sp. N741 Isolate Nodule
41 2718217927 Rhizobium sp. N324 Isolate Nodule
42 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
43 2718218009 Rhizobium sp. N561 Isolate Nodule
44 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
45 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
46 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
47 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
48 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
49 2718218363 Rhizobium sp. N113 Isolate Nodule
50 2718218365 Rhizobium sp. N731 Isolate Nodule
51 2718218366 Rhizobium sp. N621 Isolate Nodule
52 2718218423 Rhizobium sp. N941 Isolate Nodule
53 2721755514 Rhizobium sp. N6212 Isolate Nodule
54 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
55 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
56 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
57 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
58 2721755809 Rhizobium sp. N541 Isolate Nodule
59 2721755810 Rhizobium sp. N871 Isolate Nodule
60 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
61 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
62 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
63 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
64 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
65 2728369365 Rhizobium sp. N1341 Isolate Nodule
66 2728369397 Rhizobium sp. N1314 Isolate Nodule
67 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
68 2738543024 Aminobacter sp. AP02 Isolate Unclassified
69 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
70 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
71 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
72 2791355256 Rhizobium sp. M10 Isolate Nodule
73 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
74 2791355260 Rhizobium sp. L9 Isolate Nodule
75 2791355261 Rhizobium sp. J15 Isolate Nodule
76 2791355262 Rhizobium sp. M1 Isolate Nodule
77 2791355263 Rhizobium chutanense C5 Isolate Nodule
78 2791355264 Rhizobium sp. S9 Isolate Nodule
79 2791355265 Rhizobium sp. H4 Isolate Nodule
80 2791355266 Rhizobium sp. L43 Isolate Nodule
81 2791355267 Rhizobium sp. L18 Isolate Nodule
82 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
83 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
84 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
85 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
86 2802429633 Rhizobium anhuiense J3 Isolate Nodule
87 2802429634 Rhizobium anhuiense S10 Isolate Nodule
88 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
89 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
90 2802429637 Rhizobium anhuiense C15 Isolate Nodule
91 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
92 2818991467 Bosea vestrisii 3192 Isolate Unclassified
93 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
94 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
95 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
96 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
97 2838061910 Rhizobium phaseoli L15 Isolate Nodule
98 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
99 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
100 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
101 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
102 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
103 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
104 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
105 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
106 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
107 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
108 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
109 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
110 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
111 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
112 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
113 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
114 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
115 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
116 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
117 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
118 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
119 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
120 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
121 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
122 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
123 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
124 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
125 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
126 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
127 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
128 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
129 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
130 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
131 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
132 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
133 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
134 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
135 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
136 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
137 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
138 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
139 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
140 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
141 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
142 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
143 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
144 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
145 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
146 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
147 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
148 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
149 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
150 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
151 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
152 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
153 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
154 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
155 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
156 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
157 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
158 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
159 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
160 2858950400 Achromobacter sp. K91 Isolate Unclassified
161 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
162 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
163 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
164 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
165 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
166 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
167 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
168 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
169 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
170 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
171 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
172 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
173 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
174 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
175 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
176 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
177 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
178 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
179 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
180 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
181 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
182 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
183 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
184 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
185 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
186 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
187 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
188 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
189 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
190 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
191 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
192 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
193 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
194 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
195 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
196 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
197 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
198 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
199 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
200 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
201 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
202 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
203 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
204 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
205 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
206 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
207 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
208 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
209 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
210 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
211 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
212 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
213 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
214 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
215 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
216 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
217 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
218 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
219 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
220 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
221 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
222 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
223 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
224 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
225 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
226 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
227 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
228 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
229 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
230 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
231 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
232 2936381700 Rhizobium chutanense C16 Isolate Unclassified
233 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
234 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
235 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
236 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
237 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
238 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
239 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
240 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
241 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
242 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
243 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
244 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
245 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
246 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
247 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
248 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
249 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
250 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
251 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
252 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
253 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
254 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
255 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
256 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
257 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
258 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
259 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
260 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
261 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
262 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
263 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
264 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
265 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
266 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
267 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
268 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
269 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
270 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
271 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
272 2996893221 Rhizobium sp. R635 Isolate Nodule
273 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
274 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
275 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
276 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
277 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
278 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
279 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
280 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
281 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
282 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
283 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
284 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
285 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
286 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
287 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
288 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
289 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
290 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
291 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
292 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
293 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
294 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
295 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
296 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
297 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
298 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
299 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
300 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
301 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
302 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
303 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
304 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
307 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
308 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
309 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
310 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
311 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
312 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
313 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
314 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
315 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
316 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
317 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
318 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
319 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
321 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
324 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
327 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
329 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
331 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
339 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
340 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
344 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
345 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
346 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
347 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
348 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
349 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
353 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
354 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
355 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
356 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
357 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
358 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
359 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
360 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
361 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
364 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
365 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
366 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
380 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
381 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
395 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
402 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
403 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
404 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
407 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
408 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
409 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
410 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
411 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
412 8005275841 Rhizobium sp. N4311 Isolate Nodule
413 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
414 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
415 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
416 8005382845 Rhizobium sp. R634 Isolate Nodule
417 8005395548 Rhizobium sp. R339 Isolate Nodule
418 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
419 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
420 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
421 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
422 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
423 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
424 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
425 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
426 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
427 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
428 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
429 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
430 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
431 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
432 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
433 8018176218 Rhizobium sp. N122 Isolate Nodule
434 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
435 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
436 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
437 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
438 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
439 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
440 8024501048 Rhizobium sp. H4 Isolate Nodule
441 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
442 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
443 8056382006 Rhizobium croatiense 13T Isolate Nodule
444 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.75
Metatranscriptomes 0
Isolates 63.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.43
Nodule 57.52
Rhizoplane 1
Rhizosphere 14.63
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000266 3300003187 Bacteria 59738
2 JGI25151J46595_10001650 3300003187 Bacteria 14683
3 JGI25153J46596_10001872 3300003215 Bacteria 12465
4 JGI25153J46596_10004950 3300003215 Bacteria 7078
5 JGI25153J46596_10008849 3300003215 Bacteria 4755
6 rootH2_10164622 3300003320 Bacteria 2150
7 JGI25160J50197_1001080 3300003354 Bacteria 13978
8 JGI25160J50197_1002452 3300003354 Bacteria 8631
9 JGI25160J50197_1005726 3300003354 Bacteria 5130
10 JGI25161J50226_1002200 3300003374 Bacteria 5184
11 Ga0055526_1001249 3300003771 Bacteria 18238
12 Ga0055526_1001536 3300003771 Bacteria 16350
13 Ga0055528_1000526 3300003790 Bacteria 29618
14 Ga0055528_1001097 3300003790 Bacteria 17792
15 Ga0055528_1004893 3300003790 Bacteria 6332
16 Ga0055528_1012457 3300003790 Bacteria 3295
17 Ga0055540_1000066 3300003792 Bacteria 122947
18 Ga0055543_1001029 3300004625 Bacteria 12389
19 Ga0065165_1000231 3300005262 Bacteria 97237
20 Ga0065165_1021234 3300005262 Bacteria 2262
21 Ga0070668_100084958 3300005347 Bacteria 2487
22 Ga0070671_100032908 3300005355 Bacteria 4285
23 Ga0068867_100133619 3300005459 Bacteria 1931
24 Ga0068853_100328911 3300005539 Bacteria 1418
25 Ga0068855_100242204 3300005563 Bacteria 2015
26 Ga0068856_100139325 3300005614 Bacteria 2433
27 Ga0068863_100204153 3300005841 Bacteria 1902
28 Ga0068858_100336290 3300005842 Bacteria 1445
29 Ga0075365_10032026 3300006038 Bacteria 3377
30 Ga0075365_10032225 3300006038 Bacteria 3367
31 Ga0075365_10045071 3300006038 Bacteria 2891
32 Ga0075368_10003130 3300006042 Bacteria 5489
33 Ga0075368_10009137 3300006042 Bacteria 3561
34 Ga0075363_100066031 3300006048 Bacteria 1957
35 Ga0075362_10011202 3300006177 Bacteria 3528
36 Ga0075369_10013097 3300006186 Bacteria 3284
37 Ga0075369_10023652 3300006186 Bacteria 2541
38 Ga0075366_10014521 3300006195 Bacteria 4497
39 Ga0075366_10066514 3300006195 Bacteria 2144
40 Ga0075370_10014019 3300006353 Bacteria 4268
41 Ga0075370_10027170 3300006353 Bacteria 3174
42 Ga0075370_10052044 3300006353 Bacteria 2322
43 Ga0079104_1000913 3300006946 Bacteria 23812
44 Ga0105243_10093469 3300009148 Bacteria 2482
45 Ga0105241_10065798 3300009174 Bacteria 2802
46 Ga0105248_10026604 3300009177 Bacteria 6434
47 Ga0105237_10033033 3300009545 Bacteria 5241
48 Ga0105237_10251837 3300009545 Bacteria 1768
49 Ga0123341_1000005 3300009765 Bacteria 150422
50 Ga0123342_1013225 3300009766 Bacteria 8344
51 Ga0105033_100455 3300009986 Bacteria 3166
52 Ga0105239_10163755 3300010375 Bacteria 2486
53 Ga0157374_10219074 3300013296 Bacteria 1867
54 Ga0157378_10283196 3300013297 Bacteria 1598
55 Ga0163162_10364423 3300013306 Bacteria 1578
56 Ga0163163_10378414 3300014325 Bacteria 1473
57 Ga0157377_10090602 3300014745 Bacteria 1805
58 Ga0157379_10160829 3300014968 Bacteria 2027
59 Ga0228711_1000567 3300022739 Bacteria 46852
60 Ga0228710_1000099 3300022740 Bacteria 72291
61 Ga0209148_1000428 3300025254 Bacteria 46613
62 Ga0209129_1001118 3300025258 Bacteria 15591
63 Ga0209455_1003566 3300025272 Bacteria 5438
64 Ga0209673_1000020 3300025273 Bacteria 430653
65 Ga0209673_1000462 3300025273 Bacteria 68568
66 Ga0209673_1001799 3300025273 Bacteria 17679
67 Ga0209130_1000893 3300025284 Bacteria 24295
68 Ga0209675_1023276 3300025291 Bacteria 1607
69 Ga0209676_1034480 3300025292 Bacteria 1496
70 Ga0209025_1000081 3300025294 Bacteria 265899
71 Ga0209025_1000590 3300025294 Bacteria 65489
72 Ga0209564_1000114 3300025295 Bacteria 209934
73 Ga0209564_1002773 3300025295 Bacteria 13135
74 Ga0209564_1003479 3300025295 Bacteria 10734
75 Ga0209758_1000076 3300025297 Bacteria 270615
76 Ga0209758_1000321 3300025297 Bacteria 92591
77 Ga0209758_1001367 3300025297 Bacteria 29109
78 Ga0209758_1001883 3300025297 Bacteria 22938
79 Ga0209758_1004015 3300025297 Bacteria 12699
80 Ga0209256_1001187 3300025299 Bacteria 29225
81 Ga0209256_1001966 3300025299 Bacteria 18549
82 Ga0209256_1011434 3300025299 Bacteria 3550
83 Ga0207426_1000169 3300025302 Bacteria 164859
84 Ga0207426_1000278 3300025302 Bacteria 105775
85 Ga0207426_1000366 3300025302 Bacteria 80234
86 Ga0209051_1000038 3300025303 Bacteria 320926
87 Ga0209051_1007377 3300025303 Bacteria 6022
88 Ga0209051_1018245 3300025303 Bacteria 3109
89 Ga0209257_1010728 3300025304 Bacteria 4561
90 Ga0209257_1014206 3300025304 Bacteria 3444
91 Ga0207671_10145332 3300025914 Bacteria 1829
92 Ga0207650_10112836 3300025925 Bacteria 2106
93 Ga0207668_10067031 3300025972 Bacteria 2547
94 Ga0207668_10130984 3300025972 Bacteria 1915
95 Ga0207678_10209234 3300026067 Bacteria 1668
96 Ga0207648_10123027 3300026089 Bacteria 2281
97 Ga0209281_1000577 3300027111 Bacteria 43309
98 Ga0209282_1000067 3300027666 Bacteria 86942
99 Ga0268266_10342658 3300028379 Bacteria 1403
100 Ga0315914_1000379 3300031967 Bacteria 53126
101 Ga0307510_10042237 3300033180 Bacteria 4971
102 Ga0315913_1011520 3300033430 Bacteria 9982
103 Ga0315915_1000031 3300033464 Bacteria 90055
104 Ga0373943_0089836 3300035170 Bacteria 1589
105 Ga0373935_0057424 3300035692 Bacteria 2483
106 Ga0373927_0000127 3300035695 Bacteria 58182
107 Ga0373947_0212210 3300035725 Bacteria 1270
108 Ga0373925_0001869 3300037068 Bacteria 17499
109 Ga0395905_0002535 3300037471 Bacteria 20156
110 Ga0395905_0005260 3300037471 Bacteria 13239
111 Ga0395905_0053126 3300037471 Bacteria 3793
112 Ga0395905_0206364 3300037471 Bacteria 1841
113 Ga0395901_0353580 3300038443 Bacteria 1516
114 Ga0436363_1260512 3300039450 Bacteria 6424
115 Ga0439465_0012504 3300041413 Bacteria 2653
116 Ga0439465_0012665 3300041413 Bacteria 2638
117 Ga0451839_1566732 3300041496 Bacteria 1221
118 Ga0451849_0470032 3300041505 Bacteria 2899
119 Ga0439432_042308 3300042006 Bacteria 1440
120 Ga0466972_0001888 3300044658 Bacteria 10288
121 Ga0466972_0042463 3300044658 Bacteria 2210
122 Ga0466968_0008418 3300044735 Bacteria 3949
123 Ga0466970_0000044 3300044765 Bacteria 45630
124 Ga0466957_0026427 3300044842 Bacteria 3444
125 Ga0466960_0006934 3300044901 Bacteria 4570
126 Ga0466960_0014015 3300044901 Bacteria 3419
127 Ga0495638_0011563 3300046460 Bacteria 6081
128 Ga0495606_0013100 3300046507 Bacteria 6586
129 Ga0495606_0059066 3300046507 Bacteria 2461
130 Ga0495610_0019281 3300046512 Bacteria 3823
131 Ga0495610_0025359 3300046512 Bacteria 3183
132 Ga0495610_0067435 3300046512 Bacteria 1681
133 Ga0495643_0040739 3300046522 Bacteria 2535
134 Ga0495643_0068688 3300046522 Bacteria 1864
135 Ga0495668_0072751 3300046616 Bacteria 1888
136 Ga0495668_0090585 3300046616 Bacteria 1676
137 Ga0495611_0077759 3300046648 Bacteria 1522
138 Ga0495625_0011702 3300046660 Bacteria 7133
139 Ga0495670_0168203 3300046691 Bacteria 1154
140 Ga0495671_0031038 3300046692 Bacteria 2733
141 Ga0496101_0176682 3300048904 Bacteria 1643
142 Ga0496102_0230146 3300048905 Bacteria 1748
143 Ga0496109_0123335 3300048912 Bacteria 2415
144 Ga0496110_0190803 3300048913 Bacteria 1861
145 Ga0496113_0083963 3300048916 Bacteria 2444
146 Ga0496116_0073233 3300048919 Bacteria 2161
147 Ga0496117_0094199 3300048920 Bacteria 1918
148 Ga0496118_0000477 3300048921 Bacteria 66433
149 Ga0496118_0046294 3300048921 Bacteria 3386
150 Ga0496121_0031785 3300048924 Bacteria 4814
151 Ga0496122_0055120 3300048925 Bacteria 2977
152 Ga0496123_0024259 3300048926 Bacteria 4615
153 Ga0496125_0000264 3300048928 Bacteria 108134
154 Ga0496126_0133544 3300048929 Bacteria 2143
155 Ga0501032_0063867 3300049569 Bacteria 2465
156 Ga0501033_0062481 3300049570 Bacteria 2742
157 Ga0501033_0169207 3300049570 Bacteria 1570
158 Ga0501033_0198953 3300049570 Bacteria 1432
159 Ga0501070_0018180 3300049586 Bacteria 5897
160 nmdc:mga0yw44_19184_c1 3300050492 Bacteria 3765
161 nmdc:mga0yw44_81166_c1 3300050492 Bacteria 2033
162 nmdc:mga0yw44_83303_c1 3300050492 Bacteria 2009
163 nmdc:mga07m45_30681_c1 3300050496 Bacteria 2978
164 nmdc:mga07m45_3365_c1 3300050496 Bacteria 7705
165 Ga0500578_0098869 3300053086 Bacteria 1847
166 Ga0500643_000032 3300053087 Bacteria 200350
167 Ga0500583_0010315 3300053092 Bacteria 3461
168 Ga0500569_005063 3300053109 Bacteria 2811
169 Ga0500595_022772 3300053119 Bacteria 2211
170 Ga0500607_013671 3300053121 Bacteria 4736
171 Ga0500614_004486 3300053123 Bacteria 2947
172 Ga0500642_0000080 3300053130 Bacteria 52024
173 Ga0500642_0002059 3300053130 Bacteria 5840
174 Ga0500652_037435 3300053131 Bacteria 1936
175 Ga0500658_0000253 3300053134 Bacteria 24884
176 Ga0500559_0094004 3300053136 Bacteria 1375
177 Ga0500616_0012792 3300053153 Bacteria 4899
178 Ga0500619_012211 3300053154 Bacteria 2237
179 Ga0500622_0020441 3300053156 Bacteria 3515
180 Ga0500627_0074983 3300053158 Bacteria 1503
181 Ga0500634_0117503 3300053161 Bacteria 1300
182 Ga0500636_0000066 3300053177 Bacteria 51367
183 Ga0500636_0006797 3300053177 Bacteria 6587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0055120 Ga0496122_0055120_1242_2507 350
2 3300048926 Ga0496123_0024259 Ga0496123_0024259_2596_3861 350
3 3300053161 Ga0500634_0117503 Ga0500634_0117503_59_1117 352
4 3300035170 Ga0373943_0089836 Ga0373943_0089836_486_1553 353
5 iso_pu_bacteria 8004395343 8004403241 355
6 3300053158 Ga0500627_0074983 Ga0500627_0074983_385_1488 356
7 3300041496 Ga0451839_1566732 Ga0451839_1566732_90_1211 362
8 3300046691 Ga0495670_0168203 Ga0495670_0168203_16_1140 363
9 3300013297 Ga0157378_10283196 Ga0157378_102831961 367
10 iso_pu_bacteria 8017057580 8017063609 369
11 iso_pu_bacteria 3004334049 3004338448 388
12 3300025284 Ga0209130_1000893 Ga0209130_100089319 389
13 3300025302 Ga0207426_1000366 Ga0207426_100036629 389
14 3300046460 Ga0495638_0011563 Ga0495638_0011563_3475_4710 389
15 3300035725 Ga0373947_0212210 Ga0373947_0212210_31_1212 391
16 iso_pu_bacteria 2848858292 2848863845 399
17 3300003354 JGI25160J50197_1005726 JGI25160J50197_10057267 400
18 3300044735 Ga0466968_0008418 Ga0466968_0008418_358_1692 400
19 3300038443 Ga0395901_0353580 Ga0395901_0353580_201_1451 401
20 3300053153 Ga0500616_0012792 Ga0500616_0012792_3601_4836 401
21 3300053156 Ga0500622_0020441 Ga0500622_0020441_1913_3148 401
22 3300053119 Ga0500595_022772 Ga0500595_022772_232_1527 403
23 3300006946 Ga0079104_1000913 Ga0079104_100091313 404
24 3300022739 Ga0228711_1000567 Ga0228711_100056719 404
25 3300022740 Ga0228710_1000099 Ga0228710_100009919 404
26 3300027111 Ga0209281_1000577 Ga0209281_100057732 404
27 3300027666 Ga0209282_1000067 Ga0209282_100006776 404
28 3300031967 Ga0315914_1000379 Ga0315914_100037919 404
29 3300033430 Ga0315913_1011520 Ga0315913_10115203 404
30 3300033464 Ga0315915_1000031 Ga0315915_100003176 404
31 3300005539 Ga0068853_100328911 Ga0068853_1003289111 407
32 iso_pu_bacteria 2513237160 2514008056 407
33 iso_pu_bacteria 2517487022 2517567970 407
34 iso_pu_bacteria 2802428859 2802724046 407
35 iso_pu_bacteria 2802428863 2802752044 407
36 iso_pu_bacteria 2921250672 2921254121 407
37 iso_pu_bacteria 2924144063 2924150040 407
38 iso_pu_bacteria 2924200457 2924205520 407
39 iso_pu_bacteria 2924228884 2924231832 407
40 iso_pu_bacteria 2937036028 2937037459 407
41 iso_pu_bacteria 2937078374 2937079627 407
42 iso_pu_bacteria 2957443900 2957448292 407
43 iso_pu_bacteria 2960584000 2960586345 407
44 iso_pu_bacteria 2960603979 2960606196 407
45 iso_pu_bacteria 2960631154 2960632217 407
46 iso_pu_bacteria 2960660292 2960664507 407
47 iso_pu_bacteria 2967728569 2967728811 407
48 iso_pu_bacteria 2967748971 2967749705 407
49 iso_pu_bacteria 2967769361 2967774374 407
50 iso_pu_bacteria 2970122695 2970125302 407
51 iso_pu_bacteria 2977530762 2977536778 407
52 iso_pu_bacteria 2977558990 2977561489 407
53 3300003354 JGI25160J50197_1001080 JGI25160J50197_100108011 408
54 3300006038 Ga0075365_10032026 Ga0075365_100320262 408
55 3300006186 Ga0075369_10023652 Ga0075369_100236522 408
56 3300006353 Ga0075370_10014019 Ga0075370_100140192 408
57 3300009174 Ga0105241_10065798 Ga0105241_100657983 408
58 3300009545 Ga0105237_10251837 Ga0105237_102518372 408
59 3300025302 Ga0207426_1000278 Ga0207426_100027857 408
60 3300025914 Ga0207671_10145332 Ga0207671_101453321 408
61 3300050496 nmdc:mga07m45_30681_c1 nmdc:mga07m45_30681_c1_414_1706 408
62 3300014968 Ga0157379_10160829 Ga0157379_101608292 411
63 3300046648 Ga0495611_0077759 Ga0495611_0077759_163_1398 411
64 3300053087 Ga0500643_000032 Ga0500643_000032_2935_4170 411
65 3300053092 Ga0500583_0010315 Ga0500583_0010315_1086_2321 411
66 3300053130 Ga0500642_0002059 Ga0500642_0002059_3144_4379 411
67 3300053131 Ga0500652_037435 Ga0500652_037435_313_1548 411
68 iso_pu_bacteria 8004445564 8004448292 411
69 3300046692 Ga0495671_0031038 Ga0495671_0031038_561_1850 418
70 iso_pu_bacteria 2513237146 2513924853 418
71 iso_pu_bacteria 2599185170 2599416415 418
72 iso_pu_bacteria 2838035591 2838036530 418
73 3300044658 Ga0466972_0042463 Ga0466972_0042463_179_1504 420
74 3300048921 Ga0496118_0046294 Ga0496118_0046294_1280_2575 420
75 3300037471 Ga0395905_0053126 Ga0395905_0053126_557_1882 421
76 3300046512 Ga0495610_0025359 Ga0495610_0025359_1456_2805 421
77 3300053109 Ga0500569_005063 Ga0500569_005063_524_1819 421
78 iso_pu_bacteria 2528768022 2528853876 422
79 3300003187 JGI25151J46595_10001650 JGI25151J46595_100016506 423
80 3300003215 JGI25153J46596_10004950 JGI25153J46596_100049505 423
81 3300003354 JGI25160J50197_1002452 JGI25160J50197_10024525 423
82 3300003374 JGI25161J50226_1002200 JGI25161J50226_10022003 423
83 3300004625 Ga0055543_1001029 Ga0055543_10010299 423
84 3300006177 Ga0075362_10011202 Ga0075362_100112023 423
85 3300006195 Ga0075366_10014521 Ga0075366_100145213 423
86 3300025258 Ga0209129_1001118 Ga0209129_100111810 423
87 3300025273 Ga0209673_1001799 Ga0209673_100179914 423
88 3300025291 Ga0209675_1023276 Ga0209675_10232761 423
89 3300025294 Ga0209025_1000081 Ga0209025_100008169 423
90 3300025297 Ga0209758_1000076 Ga0209758_100007651 423
91 3300025299 Ga0209256_1001966 Ga0209256_10019665 423
92 3300025302 Ga0207426_1000169 Ga0207426_100016986 423
93 3300037471 Ga0395905_0206364 Ga0395905_0206364_543_1820 423
94 3300050492 nmdc:mga0yw44_81166_c1 nmdc:mga0yw44_81166_c1_314_1624 423
95 3300003215 JGI25153J46596_10008849 JGI25153J46596_100088494 424
96 3300003790 Ga0055528_1004893 Ga0055528_10048936 424
97 3300025297 Ga0209758_1001883 Ga0209758_100188310 424
98 3300025299 Ga0209256_1011434 Ga0209256_10114343 424
99 3300025303 Ga0209051_1018245 Ga0209051_10182452 424
100 3300044765 Ga0466970_0000044 Ga0466970_0000044_31100_32410 424
101 3300044842 Ga0466957_0026427 Ga0466957_0026427_2034_3344 424
102 3300046507 Ga0495606_0013100 Ga0495606_0013100_2142_3452 424
103 3300046512 Ga0495610_0019281 Ga0495610_0019281_673_1983 424
104 3300046522 Ga0495643_0068688 Ga0495643_0068688_228_1538 424
105 3300046616 Ga0495668_0072751 Ga0495668_0072751_56_1366 424
106 3300046660 Ga0495625_0011702 Ga0495625_0011702_993_2303 424
107 3300048905 Ga0496102_0230146 Ga0496102_0230146_378_1685 424
108 3300053086 Ga0500578_0098869 Ga0500578_0098869_90_1400 424
109 3300053134 Ga0500658_0000253 Ga0500658_0000253_18242_19552 424
110 iso_pu_bacteria 2818991467 2819720277 424
111 3300006038 Ga0075365_10045071 Ga0075365_100450713 425
112 3300006353 Ga0075370_10052044 Ga0075370_100520443 425
113 3300041505 Ga0451849_0470032 Ga0451849_0470032_1444_2754 425
114 3300044658 Ga0466972_0001888 Ga0466972_0001888_2656_3933 425
115 3300050496 nmdc:mga07m45_3365_c1 nmdc:mga07m45_3365_c1_801_2111 425
116 3300003320 rootH2_10164622 rootH2_101646222 426
117 3300003771 Ga0055526_1001536 Ga0055526_10015365 426
118 3300003790 Ga0055528_1000526 Ga0055528_100052624 426
119 3300025273 Ga0209673_1000020 Ga0209673_1000020226 426
120 3300025295 Ga0209564_1000114 Ga0209564_10001148 426
121 3300025299 Ga0209256_1001187 Ga0209256_10011878 426
122 3300048921 Ga0496118_0000477 Ga0496118_0000477_61177_62487 426
123 iso_pu_bacteria 2671180139 2671695676 426
124 iso_pu_bacteria 2882456835 2882463536 426
125 iso_pu_bacteria 2508501042 2508691806 427
126 iso_pu_bacteria 2511231028 2511399889 427
127 iso_pu_bacteria 2513237095 2513645608 427
128 iso_pu_bacteria 2513237104 2513722599 427
129 iso_pu_bacteria 2517093001 2517102831 427
130 iso_pu_bacteria 2816332527 2818238654 427
131 iso_pu_bacteria 2841957949 2841964200 427
132 iso_pu_bacteria 2874628541 2874632091 427
133 iso_pu_bacteria 2879099564 2879104894 427
134 iso_pu_bacteria 2885366525 2885373555 427
135 iso_pu_bacteria 2888378607 2888384298 427
136 iso_pu_bacteria 2904711408 2904714910 427
137 iso_pu_bacteria 2922368715 2922374655 427
138 iso_pu_bacteria 2922393267 2922400572 427
139 iso_pu_bacteria 2929615660 2929621749 427
140 iso_pu_bacteria 2929624759 2929629944 427
141 iso_pu_bacteria 2932784394 2932788601 427
142 iso_pu_bacteria 2932809354 2932817185 427
143 iso_pu_bacteria 2932818245 2932825226 427
144 iso_pu_bacteria 2932828146 2932830250 427
145 iso_pu_bacteria 2933577622 2933583975 427
146 iso_pu_bacteria 2935616580 2935622524 427
147 iso_pu_bacteria 2935638405 2935642129 427
148 iso_pu_bacteria 2935665750 2935672487 427
149 iso_pu_bacteria 2935675223 2935676049 427
150 iso_pu_bacteria 2935684952 2935686040 427
151 iso_pu_bacteria 2935694250 2935697715 427
152 iso_pu_bacteria 2935703347 2935705880 427
153 iso_pu_bacteria 2935713505 2935714592 427
154 iso_pu_bacteria 2935722832 2935725211 427
155 iso_pu_bacteria 2935732158 2935732429 427
156 iso_pu_bacteria 2935741537 2935741808 427
157 iso_pu_bacteria 2935750917 2935752005 427
158 iso_pu_bacteria 2935760218 2935765262 427
159 iso_pu_bacteria 2935801545 2935802877 427
160 iso_pu_bacteria 2935810662 2935813291 427
161 iso_pu_bacteria 2935827899 2935830296 427
162 iso_pu_bacteria 2935837841 2935838193 427
163 iso_pu_bacteria 2935855204 2935860773 427
164 iso_pu_bacteria 2935864058 2935872254 427
165 iso_pu_bacteria 2935873716 2935878691 427
166 iso_pu_bacteria 2935984226 2935987507 427
167 iso_pu_bacteria 2935992306 2935994913 427
168 iso_pu_bacteria 2936002035 2936003556 427
169 iso_pu_bacteria 2936037263 2936042240 427
170 iso_pu_bacteria 2940556831 2940557192 427
171 iso_pu_bacteria 2941538514 2941539140 427
172 iso_pu_bacteria 8016511872 8016522058 427
173 iso_pu_bacteria 8019576017 8019582933 427
174 iso_pu_bacteria 8019586578 8019590730 427
175 iso_pu_bacteria 8019597564 8019600619 427
176 iso_pu_bacteria 8019608314 8019617926 427
177 iso_pu_bacteria 8055742211 8055746085 427
178 3300009986 Ga0105033_100455 Ga0105033_1004552 428
179 iso_pu_bacteria 2643221607 2644047880 428
180 iso_pu_bacteria 2643221686 2644485035 428
181 iso_pu_bacteria 2915650412 2915654314 428
182 iso_pu_bacteria 3005587118 3005587818 428
183 iso_pu_bacteria 8016583857 8016593100 428
184 iso_pu_bacteria 2522572158 2523107127 429
185 iso_pu_bacteria 2615840624 2616294306 429
186 iso_pu_bacteria 2738543024 2739305562 429
187 iso_pu_bacteria 2791355261 2793326877 429
188 iso_pu_bacteria 2858950400 2858956764 429
189 iso_pu_bacteria 8005382845 8005389294 429
190 iso_pu_bacteria 8005395548 8005396843 429
191 iso_pu_bacteria 8018127388 8018134621 429
192 iso_pu_bacteria 8054558443 8054560596 429
193 3300003215 JGI25153J46596_10001872 JGI25153J46596_1000187212 430
194 3300005262 Ga0065165_1021234 Ga0065165_10212342 430
195 3300025295 Ga0209564_1003479 Ga0209564_10034795 430
196 3300025297 Ga0209758_1000321 Ga0209758_100032156 430
197 iso_pu_bacteria 2509276033 2509441856 430
198 iso_pu_bacteria 2510065019 2510137461 430
199 iso_pu_bacteria 2510461076 2510893349 430
200 iso_pu_bacteria 2513237084 2513572101 430
201 iso_pu_bacteria 2513237085 2513575989 430
202 iso_pu_bacteria 2513237093 2513633577 430
203 iso_pu_bacteria 2513237103 2513712171 430
204 iso_pu_bacteria 2513237162 2514019200 430
205 iso_pu_bacteria 2515075009 2515109532 430
206 iso_pu_bacteria 2515154134 2515742597 430
207 iso_pu_bacteria 2516653077 2517042599 430
208 iso_pu_bacteria 2516653085 2517081448 430
209 iso_pu_bacteria 2517093000 2517100169 430
210 iso_pu_bacteria 2517287029 2517411220 430
211 iso_pu_bacteria 2519899620 2520380205 430
212 iso_pu_bacteria 2524023209 2524459373 430
213 iso_pu_bacteria 2529292951 2530648584 430
214 iso_pu_bacteria 2585427526 2585526536 430
215 iso_pu_bacteria 2585427528 2585538829 430
216 iso_pu_bacteria 2585427593 2585836780 430
217 iso_pu_bacteria 2718217882 2719184207 430
218 iso_pu_bacteria 2718217927 2719389958 430
219 iso_pu_bacteria 2718217997 2719669548 430
220 iso_pu_bacteria 2718218009 2719729780 430
221 iso_pu_bacteria 2718218199 2720494564 430
222 iso_pu_bacteria 2718218232 2720610901 430
223 iso_pu_bacteria 2718218233 2720616781 430
224 iso_pu_bacteria 2718218235 2720628137 430
225 iso_pu_bacteria 2718218269 2720771717 430
226 iso_pu_bacteria 2718218363 2721144030 430
227 iso_pu_bacteria 2718218365 2721156718 430
228 iso_pu_bacteria 2718218366 2721161405 430
229 iso_pu_bacteria 2718218423 2721403597 430
230 iso_pu_bacteria 2721755514 2722837358 430
231 iso_pu_bacteria 2721755556 2723030980 430
232 iso_pu_bacteria 2721755684 2723563478 430
233 iso_pu_bacteria 2721755685 2723571471 430
234 iso_pu_bacteria 2721755809 2724035173 430
235 iso_pu_bacteria 2721755810 2724040934 430
236 iso_pu_bacteria 2721755819 2724087266 430
237 iso_pu_bacteria 2721755822 2724100977 430
238 iso_pu_bacteria 2721755823 2724108218 430
239 iso_pu_bacteria 2724679232 2725946385 430
240 iso_pu_bacteria 2728369352 2730105446 430
241 iso_pu_bacteria 2728369365 2730162347 430
242 iso_pu_bacteria 2728369397 2730295479 430
243 iso_pu_bacteria 2738541333 2739034251 430
244 iso_pu_bacteria 2765235942 2766068283 430
245 iso_pu_bacteria 2791355091 2792623935 430
246 iso_pu_bacteria 2791355256 2793295866 430
247 iso_pu_bacteria 2791355259 2793312805 430
248 iso_pu_bacteria 2791355260 2793321880 430
249 iso_pu_bacteria 2791355262 2793334640 430
250 iso_pu_bacteria 2791355263 2793340676 430
251 iso_pu_bacteria 2791355264 2793348599 430
252 iso_pu_bacteria 2791355265 2793354225 430
253 iso_pu_bacteria 2791355266 2793361770 430
254 iso_pu_bacteria 2791355267 2793367285 430
255 iso_pu_bacteria 2802429605 2805929771 430
256 iso_pu_bacteria 2802429606 2805933121 430
257 iso_pu_bacteria 2802429633 2806043051 430
258 iso_pu_bacteria 2802429634 2806051004 430
259 iso_pu_bacteria 2802429635 2806057827 430
260 iso_pu_bacteria 2802429636 2806065456 430
261 iso_pu_bacteria 2802429637 2806075303 430
262 iso_pu_bacteria 2838016132 2838019613 430
263 iso_pu_bacteria 2838022645 2838027177 430
264 iso_pu_bacteria 2838061910 2838066401 430
265 iso_pu_bacteria 2838068647 2838072484 430
266 iso_pu_bacteria 2838661181 2838662497 430
267 iso_pu_bacteria 2838668709 2838669063 430
268 iso_pu_bacteria 2838680041 2838686076 430
269 iso_pu_bacteria 2838686498 2838688466 430
270 iso_pu_bacteria 2838694306 2838700553 430
271 iso_pu_bacteria 2838701080 2838701277 430
272 iso_pu_bacteria 2838707686 2838713832 430
273 iso_pu_bacteria 2838729681 2838734399 430
274 iso_pu_bacteria 2838742623 2838746858 430
275 iso_pu_bacteria 2841851746 2841852207 430
276 iso_pu_bacteria 2842077413 2842083014 430
277 iso_pu_bacteria 2842110456 2842111677 430
278 iso_pu_bacteria 2842118031 2842124177 430
279 iso_pu_bacteria 2842146304 2842146658 430
280 iso_pu_bacteria 2842156927 2842158718 430
281 iso_pu_bacteria 2842163707 2842166147 430
282 iso_pu_bacteria 2842180545 2842182332 430
283 iso_pu_bacteria 2842192696 2842193949 430
284 iso_pu_bacteria 2842198810 2842200651 430
285 iso_pu_bacteria 2842205361 2842208533 430
286 iso_pu_bacteria 2842217011 2842222523 430
287 iso_pu_bacteria 2842229732 2842234655 430
288 iso_pu_bacteria 2842237096 2842243245 430
289 iso_pu_bacteria 2842243621 2842248388 430
290 iso_pu_bacteria 2842250916 2842251112 430
291 iso_pu_bacteria 2842257432 2842262439 430
292 iso_pu_bacteria 2842271015 2842272584 430
293 iso_pu_bacteria 2842278818 2842282121 430
294 iso_pu_bacteria 2842285085 2842289159 430
295 iso_pu_bacteria 2842291075 2842297273 430
296 iso_pu_bacteria 2842298080 2842301165 430
297 iso_pu_bacteria 2842304105 2842307975 430
298 iso_pu_bacteria 2842311132 2842313205 430
299 iso_pu_bacteria 2842317721 2842319363 430
300 iso_pu_bacteria 2842341865 2842345620 430
301 iso_pu_bacteria 2842357229 2842360552 430
302 iso_pu_bacteria 2842363717 2842363917 430
303 iso_pu_bacteria 2842370503 2842376305 430
304 iso_pu_bacteria 2842377471 2842383667 430
305 iso_pu_bacteria 2842384541 2842390806 430
306 iso_pu_bacteria 2842402390 2842407365 430
307 iso_pu_bacteria 2842409023 2842413386 430
308 iso_pu_bacteria 2842415677 2842420029 430
309 iso_pu_bacteria 2842422224 2842426068 430
310 iso_pu_bacteria 2842428310 2842430214 430
311 iso_pu_bacteria 2842441272 2842442834 430
312 iso_pu_bacteria 2842447887 2842452489 430
313 iso_pu_bacteria 2842462802 2842464710 430
314 iso_pu_bacteria 2842469257 2842471211 430
315 iso_pu_bacteria 2842489311 2842490711 430
316 iso_pu_bacteria 2842495871 2842498876 430
317 iso_pu_bacteria 2842509118 2842512603 430
318 iso_pu_bacteria 2844454524 2844461482 430
319 iso_pu_bacteria 2857516855 2857520694 430
320 iso_pu_bacteria 2933016740 2933021035 430
321 iso_pu_bacteria 2933570622 2933574425 430
322 iso_pu_bacteria 2933586486 2933590883 430
323 iso_pu_bacteria 2935894831 2935900869 430
324 iso_pu_bacteria 2935901341 2935907633 430
325 iso_pu_bacteria 2936367885 2936370834 430
326 iso_pu_bacteria 2936381700 2936382531 430
327 iso_pu_bacteria 2996893221 2996894816 430
328 iso_pu_bacteria 639633055 639651011 430
329 iso_pu_bacteria 8005275841 8005276082 430
330 iso_pu_bacteria 8005282627 8005287308 430
331 iso_pu_bacteria 8005289223 8005289947 430
332 iso_pu_bacteria 8005307578 8005311512 430
333 iso_pu_bacteria 8005430974 8005435704 430
334 iso_pu_bacteria 8005460587 8005466205 430
335 iso_pu_bacteria 8005497431 8005503448 430
336 iso_pu_bacteria 8005556819 8005563280 430
337 iso_pu_bacteria 8005563573 8005564843 430
338 iso_pu_bacteria 8005570704 8005575903 430
339 iso_pu_bacteria 8005619151 8005625750 430
340 iso_pu_bacteria 8005626139 8005632007 430
341 iso_pu_bacteria 8005668836 8005675326 430
342 iso_pu_bacteria 8005695170 8005695339 430
343 iso_pu_bacteria 8018163183 8018169765 430
344 iso_pu_bacteria 8018176218 8018180667 430
345 iso_pu_bacteria 8023680758 8023686038 430
346 iso_pu_bacteria 8024479707 8024485367 430
347 iso_pu_bacteria 8024501048 8024507014 430
348 iso_pu_bacteria 8056382006 8056385416 430
349 iso_pu_bacteria 8057874678 8057876300 430
350 3300005262 Ga0065165_1000231 Ga0065165_100023164 431
351 3300005355 Ga0070671_100032908 Ga0070671_1000329082 431
352 3300005563 Ga0068855_100242204 Ga0068855_1002422041 431
353 3300005614 Ga0068856_100139325 Ga0068856_1001393251 431
354 3300005841 Ga0068863_100204153 Ga0068863_1002041532 431
355 3300005842 Ga0068858_100336290 Ga0068858_1003362901 431
356 3300006042 Ga0075368_10003130 Ga0075368_100031302 431
357 3300006195 Ga0075366_10066514 Ga0075366_100665141 431
358 3300006353 Ga0075370_10027170 Ga0075370_100271702 431
359 3300009177 Ga0105248_10026604 Ga0105248_100266045 431
360 3300009545 Ga0105237_10033033 Ga0105237_100330332 431
361 3300010375 Ga0105239_10163755 Ga0105239_101637552 431
362 3300013296 Ga0157374_10219074 Ga0157374_102190742 431
363 3300013306 Ga0163162_10364423 Ga0163162_103644231 431
364 3300014325 Ga0163163_10378414 Ga0163163_103784141 431
365 3300014745 Ga0157377_10090602 Ga0157377_100906022 431
366 3300025254 Ga0209148_1000428 Ga0209148_100042827 431
367 3300025272 Ga0209455_1003566 Ga0209455_10035662 431
368 3300025297 Ga0209758_1004015 Ga0209758_10040152 431
369 3300025304 Ga0209257_1010728 Ga0209257_10107282 431
370 3300025925 Ga0207650_10112836 Ga0207650_101128362 431
371 3300025972 Ga0207668_10130984 Ga0207668_101309841 431
372 3300026067 Ga0207678_10209234 Ga0207678_102092341 431
373 3300033180 Ga0307510_10042237 Ga0307510_100422373 431
374 3300037471 Ga0395905_0002535 Ga0395905_0002535_1456_2760 431
375 3300044901 Ga0466960_0006934 Ga0466960_0006934_30_1325 431
376 3300046507 Ga0495606_0059066 Ga0495606_0059066_50_1345 431
377 3300046522 Ga0495643_0040739 Ga0495643_0040739_1119_2414 431
378 3300046616 Ga0495668_0090585 Ga0495668_0090585_117_1412 431
379 3300048904 Ga0496101_0176682 Ga0496101_0176682_13_1308 431
380 3300048912 Ga0496109_0123335 Ga0496109_0123335_172_1467 431
381 3300048913 Ga0496110_0190803 Ga0496110_0190803_14_1309 431
382 3300048916 Ga0496113_0083963 Ga0496113_0083963_1095_2390 431
383 3300048919 Ga0496116_0073233 Ga0496116_0073233_104_1399 431
384 3300048920 Ga0496117_0094199 Ga0496117_0094199_50_1345 431
385 3300048924 Ga0496121_0031785 Ga0496121_0031785_2456_3751 431
386 3300048928 Ga0496125_0000264 Ga0496125_0000264_88255_89559 431
387 3300049570 Ga0501033_0198953 Ga0501033_0198953_110_1408 431
388 3300049586 Ga0501070_0018180 Ga0501070_0018180_2301_3599 431
389 3300050492 nmdc:mga0yw44_83303_c1 nmdc:mga0yw44_83303_c1_248_1543 431
390 3300053121 Ga0500607_013671 Ga0500607_013671_3008_4303 431
391 3300053123 Ga0500614_004486 Ga0500614_004486_995_2290 431
392 3300053130 Ga0500642_0000080 Ga0500642_0000080_26909_28204 431
393 3300053136 Ga0500559_0094004 Ga0500559_0094004_65_1360 431
394 3300053154 Ga0500619_012211 Ga0500619_012211_418_1713 431
395 3300053177 Ga0500636_0000066 Ga0500636_0000066_21134_22429 431
396 iso_pu_bacteria 2791355253 2793281194 431
397 iso_pu_bacteria 2989349275 2989355014 431
398 3300053177 Ga0500636_0006797 Ga0500636_0006797_4497_5810 432
399 3300003771 Ga0055526_1001249 Ga0055526_100124914 433
400 3300003790 Ga0055528_1001097 Ga0055528_10010974 433
401 3300003790 Ga0055528_1012457 Ga0055528_10124572 433
402 3300003792 Ga0055540_1000066 Ga0055540_100006679 433
403 3300006042 Ga0075368_10009137 Ga0075368_100091373 433
404 3300006186 Ga0075369_10013097 Ga0075369_100130973 433
405 3300009765 Ga0123341_1000005 Ga0123341_100000564 433
406 3300009766 Ga0123342_1013225 Ga0123342_10132256 433
407 3300025273 Ga0209673_1000462 Ga0209673_100046214 433
408 3300025292 Ga0209676_1034480 Ga0209676_10344802 433
409 3300025295 Ga0209564_1002773 Ga0209564_10027739 433
410 3300025303 Ga0209051_1000038 Ga0209051_100003876 433
411 3300025303 Ga0209051_1007377 Ga0209051_10073773 433
412 3300025304 Ga0209257_1014206 Ga0209257_10142063 433
413 3300037471 Ga0395905_0005260 Ga0395905_0005260_10272_11582 433
414 3300041413 Ga0439465_0012504 Ga0439465_0012504_762_2072 433
415 3300042006 Ga0439432_042308 Ga0439432_042308_12_1322 433
416 3300049570 Ga0501033_0169207 Ga0501033_0169207_105_1415 433
417 iso_pu_bacteria 2508501127 2509141306 433
418 iso_pu_bacteria 2597489875 2597815532 433
419 iso_pu_bacteria 2821443989 2821444175 433
420 iso_pu_bacteria 2856342000 2856345692 433
421 iso_pu_bacteria 2888343758 2888349369 433
422 iso_pu_bacteria 2970524798 2970531063 433
423 iso_pu_bacteria 2970540015 2970541713 433
424 3300005347 Ga0070668_100084958 Ga0070668_1000849583 434
425 3300005459 Ga0068867_100133619 Ga0068867_1001336191 434
426 3300006038 Ga0075365_10032225 Ga0075365_100322253 434
427 3300009148 Ga0105243_10093469 Ga0105243_100934691 434
428 3300025972 Ga0207668_10067031 Ga0207668_100670311 434
429 3300026089 Ga0207648_10123027 Ga0207648_101230272 434
430 3300028379 Ga0268266_10342658 Ga0268266_103426581 434
431 3300035692 Ga0373935_0057424 Ga0373935_0057424_821_2140 434
432 3300035695 Ga0373927_0000127 Ga0373927_0000127_22093_23412 434
433 3300037068 Ga0373925_0001869 Ga0373925_0001869_12246_13565 434
434 3300041413 Ga0439465_0012665 Ga0439465_0012665_917_2239 434
435 3300049569 Ga0501032_0063867 Ga0501032_0063867_1091_2404 434
436 3300049570 Ga0501033_0062481 Ga0501033_0062481_1287_2600 434
437 3300050492 nmdc:mga0yw44_19184_c1 nmdc:mga0yw44_19184_c1_806_2128 434
438 iso_pu_bacteria 2856349417 2856353863 434
439 iso_pu_bacteria 2871488783 2871494670 434
440 iso_pu_bacteria 2878753008 2878758748 434
441 iso_pu_bacteria 2881155292 2881161674 434
442 iso_pu_bacteria 2881845957 2881846251 434
443 iso_pu_bacteria 2881853255 2881858794 434
444 iso_pu_bacteria 2881861095 2881866654 434
445 iso_pu_bacteria 2885318864 2885325070 434
446 iso_pu_bacteria 2885342637 2885344679 434
447 iso_pu_bacteria 2885350715 2885353302 434
448 iso_pu_bacteria 2903492973 2903504013 434
449 iso_pu_bacteria 2922158528 2922159796 434
450 iso_pu_bacteria 2924726620 2924728579 434
451 iso_pu_bacteria 2924784321 2924788950 434
452 iso_pu_bacteria 2961127735 2961132867 434
453 iso_pu_bacteria 2961170736 2961176174 434
454 iso_pu_bacteria 2967996073 2968002061 434
455 iso_pu_bacteria 2968003550 2968008915 434
456 iso_pu_bacteria 2970503327 2970508840 434
457 iso_pu_bacteria 2977821940 2977827288 434
458 iso_pu_bacteria 2977828996 2977834286 434
459 iso_pu_bacteria 2979808191 2979811512 434
460 iso_pu_bacteria 2996341866 2996344820 434
461 iso_pu_bacteria 8004374579 8004380269 434
462 3300006048 Ga0075363_100066031 Ga0075363_1000660312 435
463 3300044901 Ga0466960_0014015 Ga0466960_0014015_693_2018 435
464 3300048929 Ga0496126_0133544 Ga0496126_0133544_200_1519 435
465 iso_pu_bacteria 2513237164 2514035765 435
466 iso_pu_bacteria 2513237305 2514421307 435
467 iso_pu_bacteria 2721755686 2723575247 435
468 iso_pu_bacteria 2847670302 2847676086 435
469 iso_pu_bacteria 2847686936 2847692732 435
470 iso_pu_bacteria 2856314179 2856315872 435
471 iso_pu_bacteria 2871495908 2871499752 435
472 iso_pu_bacteria 2874102143 2874106712 435
473 iso_pu_bacteria 2878035449 2878040140 435
474 iso_pu_bacteria 2878760144 2878763926 435
475 iso_pu_bacteria 2878767105 2878770944 435
476 iso_pu_bacteria 2903540706 2903544562 435
477 iso_pu_bacteria 2906328253 2906329025 435
478 iso_pu_bacteria 2906414383 2906416009 435
479 iso_pu_bacteria 2937994558 2937998410 435
480 iso_pu_bacteria 2958115193 2958118926 435
481 iso_pu_bacteria 2958165035 2958168886 435
482 iso_pu_bacteria 2961163497 2961167350 435
483 iso_pu_bacteria 2965018300 2965022171 435
484 iso_pu_bacteria 2968097103 2968101024 435
485 iso_pu_bacteria 2968128360 2968132798 435
486 iso_pu_bacteria 2968171901 2968175755 435
487 iso_pu_bacteria 2970554993 2970558770 435
488 iso_pu_bacteria 2977858184 2977862751 435
489 iso_pu_bacteria 2979779861 2979784593 435
490 iso_pu_bacteria 2987659509 2987663356 435
491 iso_pu_bacteria 3000135777 3000136649 435
492 iso_pu_bacteria 3004188549 3004192413 435
493 iso_pu_bacteria 8004640170 8004640195 435
494 iso_pu_bacteria 8004703790 8004709828 435
495 3300039450 Ga0436363_1260512 Ga0436363_1260512_3308_4648 436
496 3300003187 JGI25151J46595_10000266 JGI25151J46595_1000026644 437
497 3300025294 Ga0209025_1000590 Ga0209025_100059048 437
498 3300025297 Ga0209758_1001367 Ga0209758_100136716 437
499 3300046512 Ga0495610_0067435 Ga0495610_0067435_27_1340 437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

57

266

0.81

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

332

431

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.868 19 433
6qkb-assembly1.cif.gz_B crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans 0.8543 16 431
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.8543 40 431
3gwq-assembly1.cif.gz_B crystal structure of a putative d-serine deaminase (bxe_a4060) from burkholderia xenovorans lb400 at 2.00 a resolution 0.8499 10 431
3gwq-assembly1.cif.gz_A crystal structure of a putative d-serine deaminase (bxe_a4060) from burkholderia xenovorans lb400 at 2.00 a resolution 0.8482 12 433
ID Description Score Start End Superfamily
4v15B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.8694 317 430 2.40.37.20
3gwqB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8669 51 284 3.20.20.10
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8591 51 281 3.20.20.10
3gwqB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8462 51 284 3.20.20.10
3gwqB01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.841 319 433 2.40.37.20
ID Description Score Start End GO Terms
AF-A0A434TEP5-F1-model_v4 Amino acid deaminase 0.983 11 291
AF-A0A6S7DPF3-F1-model_v4 D-threonine aldolase (EC 4.1.2.42) 0.9758 11 434 GO:0043876
AF-A0A3S1S8U3-F1-model_v4 Amino acid deaminase 0.9739 11 352 GO:0016829
AF-A0A434SPU8-F1-model_v4 Amino acid deaminase 0.9695 11 234
AF-A0A1M7NU87-F1-model_v4 D-serine dehydratase 0.9687 16 434 GO:0016829

Feature Viewer

pLDDT pTM Quality
88.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map