F455407

General Info

Members Datasets Scaffolds Average Seq Length
499 253 998 284

Family's Representative Sequence

Representative Sequence 3300041459|Ga0451800_0735920|Ga0451800_0735920_102_1133
Length 336
Sequence LAIGRAGYSSRPPAVVISSSLQQASNSDANRRLASTMAPDRSLQRSTSEVWMELGIVGLGRMGANMARRLQESGYPVATVFDVNNLAAQTIAQELSCVAAENLKTVTALSDVIITVVSDDLAMKRIYVGGLLNRAKGKLFINCATVTPAIHRWVEHKCDAKGAQVLEACMASSITQAREGSLYLMCGGKPEVFERARPILEKLSNSLRYIGPAGKAAEVKALVNMVMNANTAALAEGLLDLTMLREVFSQTGARSGVLQTDGEDMQNREHSCYFSAAHAAKDSGIALKLAKEQGLNLPLATATKKQYDRMIKEGLGELDKSGIAELTFKGRKGVPV

Samples

Sample ID Description Type Environment
1 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
210 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 4.41
Rhizosphere 91.98
Stem 0
Stem Tuber 0
Unclassified 8.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451800_0735920 3300041459 Unclassified 1201
2 JGI24743J22301_10001740 3300001991 Bacteria 3113
3 JGI24033J26618_1000028 3300002155 Bacteria 22509
4 JGI25406J46586_10000016 3300003203 Bacteria 91056
5 rootH2_10000524 3300003320 Bacteria 95867
6 rootH2_10012722 3300003320 Bacteria 3263
7 rootH2_10056432 3300003320 Bacteria 6057
8 rootL2_10040027 3300003322 Bacteria 4888
9 rootH1_10066215 3300003323 Bacteria 25527
10 Ga0065704_10071137 3300005289 Bacteria 12902
11 Ga0065704_10184207 3300005289 Bacteria 1219
12 Ga0065712_10092986 3300005290 Bacteria 2310
13 Ga0065707_10106244 3300005295 Bacteria 2569
14 Ga0070658_10002659 3300005327 Bacteria 14864
15 Ga0070676_10009065 3300005328 Bacteria 5383
16 Ga0070683_100027725 3300005329 Bacteria 5111
17 Ga0070683_100063584 3300005329 Bacteria 3433
18 Ga0070683_100164917 3300005329 Bacteria 2102
19 Ga0070683_100581757 3300005329 Bacteria 1071
20 Ga0070690_100000531 3300005330 Bacteria 19119
21 Ga0070690_100059232 3300005330 Bacteria 2461
22 Ga0070690_100164447 3300005330 Bacteria 1523
23 Ga0070670_100019426 3300005331 Bacteria 5830
24 Ga0070677_10039916 3300005333 Bacteria 1844
25 Ga0070666_10003440 3300005335 Bacteria 9591
26 Ga0070666_10022363 3300005335 Bacteria 4106
27 Ga0070666_10034292 3300005335 Bacteria 3364
28 Ga0070666_10174325 3300005335 Bacteria 1507
29 Ga0068868_100071455 3300005338 Bacteria 2768
30 Ga0068868_100096274 3300005338 Bacteria 2391
31 Ga0068868_100376763 3300005338 Bacteria 1220
32 Ga0070689_100018747 3300005340 Bacteria 5104
33 Ga0070689_100026439 3300005340 Unclassified 4370
34 Ga0070689_100120259 3300005340 Bacteria 2097
35 Ga0070689_100137866 3300005340 Bacteria 1960
36 Ga0070687_100000853 3300005343 Bacteria 10206
37 Ga0070661_100000158 3300005344 Bacteria 55403
38 Ga0070661_100046725 3300005344 Bacteria 3168
39 Ga0070661_100212253 3300005344 Bacteria 1482
40 Ga0070668_100040169 3300005347 Bacteria 3580
41 Ga0070668_100049040 3300005347 Bacteria 3249
42 Ga0070668_100050803 3300005347 Bacteria 3193
43 Ga0070669_100006145 3300005353 Bacteria 8671
44 Ga0070669_100040774 3300005353 Bacteria 3375
45 Ga0070669_100460923 3300005353 Bacteria 1049
46 Ga0070675_100014482 3300005354 Bacteria 6220
47 Ga0070675_100041141 3300005354 Bacteria 3775
48 Ga0070675_100262822 3300005354 Bacteria 1513
49 Ga0070671_100048570 3300005355 Bacteria 3529
50 Ga0070671_100072152 3300005355 Bacteria 2883
51 Ga0070671_100145288 3300005355 Bacteria 2002
52 Ga0070674_100004132 3300005356 Bacteria 8249
53 Ga0070674_100063673 3300005356 Bacteria 2582
54 Ga0070673_100003933 3300005364 Bacteria 9333
55 Ga0070673_100207023 3300005364 Bacteria 1692
56 Ga0070673_100554479 3300005364 Bacteria 1044
57 Ga0070688_100000527 3300005365 Bacteria 19316
58 Ga0070688_100030529 3300005365 Bacteria 3236
59 Ga0070667_100004695 3300005367 Bacteria 11463
60 Ga0070667_100121836 3300005367 Bacteria 2269
61 Ga0070714_100016332 3300005435 Bacteria 5991
62 Ga0070714_100024083 3300005435 Bacteria 5009
63 Ga0070714_100060195 3300005435 Bacteria 3259
64 Ga0070711_100089305 3300005439 Bacteria 2216
65 Ga0070711_100327109 3300005439 Bacteria 1226
66 Ga0070705_100182465 3300005440 Bacteria 1423
67 Ga0070708_100053146 3300005445 Bacteria 3593
68 Ga0070708_100155991 3300005445 Bacteria 2125
69 Ga0070663_100090083 3300005455 Bacteria 2271
70 Ga0070678_100001827 3300005456 Bacteria 11474
71 Ga0070678_100005793 3300005456 Bacteria 7189
72 Ga0070678_100219751 3300005456 Bacteria 1579
73 Ga0070681_10308226 3300005458 Bacteria 1493
74 Ga0070681_10436017 3300005458 Unclassified 1222
75 Ga0068867_100014888 3300005459 Bacteria 5512
76 Ga0068867_100223556 3300005459 Bacteria 1518
77 Ga0070706_100000159 3300005467 Bacteria 86016
78 Ga0070706_100200387 3300005467 Bacteria 1865
79 Ga0070707_100059724 3300005468 Bacteria 3656
80 Ga0070707_100208208 3300005468 Bacteria 1906
81 Ga0070698_100024341 3300005471 Bacteria 6318
82 Ga0070698_100372496 3300005471 Bacteria 1360
83 Ga0070699_100029034 3300005518 Bacteria 4768
84 Ga0070679_100011712 3300005530 Bacteria 8360
85 Ga0070679_100364750 3300005530 Bacteria 1392
86 Ga0070684_100098801 3300005535 Bacteria 2604
87 Ga0070684_100446518 3300005535 Bacteria 1195
88 Ga0070697_100030223 3300005536 Unclassified 4351
89 Ga0070697_100068332 3300005536 Bacteria 2909
90 Ga0068853_100259053 3300005539 Bacteria 1598
91 Ga0070672_100000507 3300005543 Bacteria 22759
92 Ga0070672_100011246 3300005543 Bacteria 6241
93 Ga0070686_100001256 3300005544 Bacteria 14382
94 Ga0070665_100049466 3300005548 Bacteria 4217
95 Ga0070665_100249338 3300005548 Bacteria 1776
96 Ga0070665_100274027 3300005548 Bacteria 1689
97 Ga0068855_100001572 3300005563 Bacteria 28658
98 Ga0068855_100034638 3300005563 Bacteria 6018
99 Ga0068855_100040003 3300005563 Bacteria 5565
100 Ga0068855_100103422 3300005563 Bacteria 3277
101 Ga0068855_100390867 3300005563 Bacteria 1526
102 Ga0070664_100013491 3300005564 Bacteria 6657
103 Ga0068857_100012495 3300005577 Bacteria 7393
104 Ga0068854_100000039 3300005578 Bacteria 94407
105 Ga0068856_100000747 3300005614 Bacteria 35242
106 Ga0068856_100003007 3300005614 Bacteria 17258
107 Ga0068856_100053187 3300005614 Bacteria 3993
108 Ga0068856_100110002 3300005614 Bacteria 2752
109 Ga0068856_100346176 3300005614 Bacteria 1505
110 Ga0068859_100261507 3300005617 Bacteria 1822
111 Ga0068859_100559227 3300005617 Bacteria 1238
112 Ga0068864_100018447 3300005618 Bacteria 5830
113 Ga0068866_10060893 3300005718 Bacteria 1958
114 Ga0068863_100000717 3300005841 Bacteria 33332
115 Ga0068860_100000236 3300005843 Bacteria 84807
116 Ga0068860_100278780 3300005843 Bacteria 1633
117 Ga0081455_10063529 3300005937 Unclassified 3098
118 Ga0081540_1028002 3300005983 Bacteria 3176
119 Ga0081539_10000383 3300005985 Bacteria 95995
120 Ga0081539_10003184 3300005985 Bacteria 20777
121 Ga0070717_10357438 3300006028 Bacteria 1307
122 Ga0070712_100102477 3300006175 Bacteria 2120
123 Ga0070712_100251488 3300006175 Bacteria 1412
124 Ga0075366_10125660 3300006195 Bacteria 1547
125 Ga0097621_100020780 3300006237 Bacteria 5066
126 Ga0097621_100026858 3300006237 Bacteria 4522
127 Ga0097621_100155268 3300006237 Bacteria 1964
128 Ga0097621_100192150 3300006237 Bacteria 1768
129 Ga0068871_100005948 3300006358 Bacteria 8587
130 Ga0068871_100015881 3300006358 Bacteria 5653
131 Ga0075428_100002258 3300006844 Bacteria 20864
132 Ga0075430_100097706 3300006846 Unclassified 2454
133 Ga0075431_100060093 3300006847 Unclassified 3922
134 Ga0075431_100234728 3300006847 Bacteria 1868
135 Ga0068865_100026395 3300006881 Bacteria 3829
136 Ga0075436_100090914 3300006914 Bacteria 2122
137 Ga0097620_100261519 3300006931 Bacteria 1822
138 Ga0097620_100559144 3300006931 Bacteria 1238
139 Ga0075435_100141771 3300007076 Bacteria 2017
140 Ga0105240_10056075 3300009093 Bacteria 4932
141 Ga0105240_10084270 3300009093 Unclassified 3898
142 Ga0105240_10496437 3300009093 Bacteria 1358
143 Ga0111539_10034867 3300009094 Bacteria 6097
144 Ga0111539_10087488 3300009094 Bacteria 3660
145 Ga0111539_10181084 3300009094 Bacteria 2461
146 Ga0111539_10412063 3300009094 Bacteria 1574
147 Ga0105245_10412486 3300009098 Bacteria 1352
148 Ga0114129_10007148 3300009147 Bacteria 15886
149 Ga0114129_10055817 3300009147 Bacteria 5535
150 Ga0105242_10054059 3300009176 Bacteria 3281
151 Ga0105237_10008312 3300009545 Bacteria 11259
152 Ga0105237_10068069 3300009545 Bacteria 3555
153 Ga0105238_10035658 3300009551 Bacteria 5056
154 Ga0105238_10122876 3300009551 Bacteria 2576
155 Ga0105238_10137338 3300009551 Bacteria 2422
156 Ga0105239_10120682 3300010375 Bacteria 2911
157 Ga0105239_10132355 3300010375 Bacteria 2775
158 Ga0157374_10000043 3300013296 Bacteria 145109
159 Ga0157374_10012327 3300013296 Bacteria 7439
160 Ga0157374_10013389 3300013296 Bacteria 7161
161 Ga0157374_10013540 3300013296 Bacteria 7121
162 Ga0157374_10025878 3300013296 Bacteria 5275
163 Ga0157374_10044897 3300013296 Bacteria 4087
164 Ga0157374_10051028 3300013296 Unclassified 3848
165 Ga0157374_10068203 3300013296 Bacteria 3346
166 Ga0157374_10072340 3300013296 Unclassified 3253
167 Ga0157374_10256489 3300013296 Bacteria 1721
168 Ga0157378_10029064 3300013297 Bacteria 4879
169 Ga0157378_10035625 3300013297 Bacteria 4403
170 Ga0157378_10301231 3300013297 Bacteria 1551
171 Ga0157378_10393579 3300013297 Bacteria 1364
172 Ga0163162_10002963 3300013306 Bacteria 16201
173 Ga0163162_10021042 3300013306 Bacteria 6416
174 Ga0157372_10200691 3300013307 Bacteria 2310
175 Ga0157375_10000081 3300013308 Bacteria 96625
176 Ga0157375_10002525 3300013308 Bacteria 15888
177 Ga0157375_10008738 3300013308 Bacteria 8876
178 Ga0157375_10011067 3300013308 Bacteria 7956
179 Ga0157375_10021659 3300013308 Bacteria 5900
180 Ga0157375_10163959 3300013308 Bacteria 2366
181 Ga0157375_10192096 3300013308 Unclassified 2197
182 Ga0163163_10000059 3300014325 Bacteria 123393
183 Ga0163163_10106061 3300014325 Bacteria 2836
184 Ga0163163_10194353 3300014325 Bacteria 2077
185 Ga0182008_10022552 3300014497 Bacteria 3224
186 Ga0157376_10001205 3300014969 Bacteria 17045
187 Ga0157376_10045142 3300014969 Bacteria 3627
188 Ga0157376_10052050 3300014969 Bacteria 3403
189 Ga0157376_10098714 3300014969 Bacteria 2546
190 Ga0206356_10933481 3300020070 Bacteria 8970
191 Ga0206354_11166194 3300020081 Bacteria 1051
192 Ga0213873_10001996 3300021358 Bacteria 3483
193 Ga0213872_10004543 3300021361 Bacteria 7340
194 Ga0213876_10062382 3300021384 Unclassified 1967
195 Ga0213876_10063589 3300021384 Bacteria 1949
196 Ga0207697_10003337 3300025315 Bacteria 7982
197 Ga0207697_10033466 3300025315 Unclassified 2104
198 Ga0207688_10033826 3300025901 Bacteria 2828
199 Ga0207680_10014109 3300025903 Bacteria 4123
200 Ga0207680_10017224 3300025903 Bacteria 3813
201 Ga0207680_10323700 3300025903 Bacteria 1078
202 Ga0207699_10122088 3300025906 Bacteria 1687
203 Ga0207645_10003338 3300025907 Bacteria 12235
204 Ga0207645_10027556 3300025907 Unclassified 3667
205 Ga0207645_10101859 3300025907 Bacteria 1853
206 Ga0207705_10000742 3300025909 Bacteria 26882
207 Ga0207684_10000208 3300025910 Bacteria 91185
208 Ga0207707_10058503 3300025912 Bacteria 3355
209 Ga0207707_10376129 3300025912 Unclassified 1222
210 Ga0207671_10021182 3300025914 Bacteria 4938
211 Ga0207693_10020913 3300025915 Bacteria 5202
212 Ga0207662_10005357 3300025918 Bacteria 6831
213 Ga0207657_10013229 3300025919 Bacteria 8098
214 Ga0207649_10001221 3300025920 Bacteria 15462
215 Ga0207652_10336373 3300025921 Bacteria 1363
216 Ga0207646_10000115 3300025922 Bacteria 110424
217 Ga0207646_10000985 3300025922 Bacteria 36586
218 Ga0207646_10045182 3300025922 Bacteria 3954
219 Ga0207646_10148729 3300025922 Bacteria 2112
220 Ga0207646_10562271 3300025922 Bacteria 1025
221 Ga0207681_10012256 3300025923 Bacteria 5286
222 Ga0207681_10115977 3300025923 Unclassified 1956
223 Ga0207681_10245054 3300025923 Bacteria 1397
224 Ga0207681_10268445 3300025923 Bacteria 1338
225 Ga0207694_10015516 3300025924 Bacteria 5745
226 Ga0207650_10007381 3300025925 Bacteria 7481
227 Ga0207650_10086843 3300025925 Unclassified 2382
228 Ga0207659_10009479 3300025926 Bacteria 6087
229 Ga0207659_10023331 3300025926 Bacteria 4127
230 Ga0207659_10229098 3300025926 Bacteria 1498
231 Ga0207664_10034989 3300025929 Bacteria 3873
232 Ga0207664_10065604 3300025929 Bacteria 2907
233 Ga0207664_10070293 3300025929 Bacteria 2817
234 Ga0207644_10026230 3300025931 Bacteria 4013
235 Ga0207644_10030154 3300025931 Unclassified 3768
236 Ga0207644_10151155 3300025931 Bacteria 1796
237 Ga0207706_10159121 3300025933 Bacteria 1986
238 Ga0207670_10073929 3300025936 Bacteria 2364
239 Ga0207670_10104781 3300025936 Bacteria 2026
240 Ga0207670_10141148 3300025936 Bacteria 1777
241 Ga0207670_10167869 3300025936 Bacteria 1643
242 Ga0207669_10013699 3300025937 Bacteria 4039
243 Ga0207691_10001154 3300025940 Bacteria 26239
244 Ga0207691_10017530 3300025940 Bacteria 6787
245 Ga0207691_10038963 3300025940 Bacteria 4398
246 Ga0207691_10499580 3300025940 Unclassified 1033
247 Ga0207661_10018152 3300025944 Bacteria 5226
248 Ga0207661_10411057 3300025944 Unclassified 1228
249 Ga0207661_10518626 3300025944 Bacteria 1090
250 Ga0207679_10004144 3300025945 Bacteria 9009
251 Ga0207679_10065135 3300025945 Bacteria 2726
252 Ga0207667_10006025 3300025949 Bacteria 14751
253 Ga0207667_10007744 3300025949 Bacteria 12839
254 Ga0207651_10062672 3300025960 Bacteria 2592
255 Ga0207651_10172017 3300025960 Bacteria 1709
256 Ga0207668_10096139 3300025972 Bacteria 2188
257 Ga0207668_10152140 3300025972 Unclassified 1792
258 Ga0207668_10179630 3300025972 Bacteria 1668
259 Ga0207640_10000024 3300025981 Bacteria 154876
260 Ga0207658_10107372 3300025986 Bacteria 2200
261 Ga0207658_10117232 3300025986 Bacteria 2116
262 Ga0207677_10049875 3300026023 Bacteria 2827
263 Ga0207677_10140625 3300026023 Bacteria 1847
264 Ga0207639_10201901 3300026041 Bacteria 1706
265 Ga0207678_10040840 3300026067 Bacteria 4022
266 Ga0207678_10189416 3300026067 Bacteria 1758
267 Ga0207702_10000285 3300026078 Bacteria 58642
268 Ga0207702_10002531 3300026078 Bacteria 17199
269 Ga0207702_10053326 3300026078 Bacteria 3423
270 Ga0207702_10116127 3300026078 Bacteria 2388
271 Ga0207702_10280386 3300026078 Bacteria 1575
272 Ga0207702_10360839 3300026078 Bacteria 1393
273 Ga0207641_10005378 3300026088 Bacteria 10939
274 Ga0207648_10009854 3300026089 Bacteria 9111
275 Ga0207648_10232878 3300026089 Bacteria 1639
276 Ga0207676_10164537 3300026095 Bacteria 1926
277 Ga0207676_10167414 3300026095 Unclassified 1911
278 Ga0207674_10005516 3300026116 Bacteria 15022
279 Ga0207674_10560396 3300026116 Bacteria 1104
280 Ga0207683_10015328 3300026121 Bacteria 6528
281 Ga0207683_10015937 3300026121 Bacteria 6397
282 Ga0207683_10022088 3300026121 Bacteria 5461
283 Ga0207683_10047470 3300026121 Bacteria 3761
284 Ga0268266_10013392 3300028379 Bacteria 7063
285 Ga0268266_10015972 3300028379 Bacteria 6421
286 Ga0268266_10220806 3300028379 Bacteria 1742
287 Ga0268264_10000508 3300028381 Bacteria 50098
288 Ga0265337_1006066 3300028556 Unclassified 4709
289 Ga0265326_10001335 3300028558 Bacteria 8748
290 Ga0265338_10000223 3300028800 Bacteria 105618
291 Ga0265338_10000496 3300028800 Bacteria 70245
292 Ga0265338_10000699 3300028800 Bacteria 57627
293 Ga0265338_10002222 3300028800 Bacteria 29586
294 Ga0265338_10002248 3300028800 Bacteria 29389
295 Ga0265338_10028978 3300028800 Bacteria 5504
296 Ga0265338_10042626 3300028800 Bacteria 4223
297 Ga0265338_10052885 3300028800 Bacteria 3639
298 Ga0265338_10070106 3300028800 Bacteria 3007
299 Ga0265338_10157216 3300028800 Bacteria 1760
300 Ga0265324_10000417 3300029957 Bacteria 30508
301 Ga0265332_10014967 3300031238 Bacteria 3430
302 Ga0265320_10003194 3300031240 Bacteria 11114
303 Ga0265340_10077423 3300031247 Bacteria 1569
304 Ga0265339_10016917 3300031249 Bacteria 4332
305 Ga0265327_10001043 3300031251 Bacteria 38982
306 Ga0265314_10027217 3300031711 Bacteria 4284
307 Ga0265314_10106433 3300031711 Bacteria 1792
308 Ga0307411_10040926 3300032005 Bacteria 2944
309 Ga0373938_0037373 3300034957 Bacteria 1066
310 Ga0373926_0018014 3300035083 Bacteria 2427
311 Ga0373954_0036185 3300035118 Unclassified 2291
312 Ga0373954_0171777 3300035118 Bacteria 1062
313 Ga0373943_0079960 3300035170 Bacteria 1674
314 Ga0373943_0119649 3300035170 Bacteria 1398
315 Ga0373935_0010141 3300035692 Bacteria 5643
316 Ga0373927_0004132 3300035695 Bacteria 10219
317 Ga0373927_0009042 3300035695 Bacteria 6687
318 Ga0373927_0247323 3300035695 Bacteria 1172
319 Ga0373947_0024096 3300035725 Bacteria 3544
320 Ga0373937_0030113 3300036401 Bacteria 4917
321 Ga0373937_0314680 3300036401 Bacteria 1481
322 Ga0373937_0480134 3300036401 Bacteria 1181
323 Ga0373925_0000862 3300037068 Bacteria 27775
324 Ga0373925_0045922 3300037068 Bacteria 3246
325 Ga0373925_0485018 3300037068 Bacteria 1014
326 Ga0395899_0000067 3300037312 Bacteria 202348
327 Ga0395900_0008838 3300037418 Bacteria 10348
328 Ga0395900_0011539 3300037418 Bacteria 9042
329 Ga0395898_0000067 3300037466 Bacteria 255955
330 Ga0395898_0419466 3300037466 Bacteria 1275
331 Ga0395905_0212990 3300037471 Bacteria 1810
332 Ga0395901_0000532 3300038443 Bacteria 43915
333 Ga0395901_0228132 3300038443 Bacteria 1945
334 Ga0395901_0548547 3300038443 Bacteria 1172
335 Ga0436365_0785320 3300039437 Bacteria 2520
336 Ga0436365_1813535 3300039437 Bacteria 4017
337 Ga0436360_1197960 3300039438 Bacteria 3507
338 Ga0436361_0314176 3300039447 Bacteria 12482
339 Ga0436361_0425304 3300039447 Bacteria 1822
340 Ga0436361_0475029 3300039447 Bacteria 4661
341 Ga0436363_0634802 3300039450 Bacteria 44772
342 Ga0436363_1432688 3300039450 Bacteria 1997
343 Ga0436362_0237644 3300039453 Bacteria 4094
344 Ga0439450_023499 3300042008 Unclassified 1338
345 Ga0439463_025190 3300042016 Unclassified 1492
346 Ga0451577_0004759 3300042876 Bacteria 14202
347 Ga0453684_0004271 3300044712 Bacteria 30499
348 Ga0453684_0429769 3300044712 Bacteria 1473
349 Ga0466971_0000081 3300044719 Bacteria 34909
350 Ga0466957_0008871 3300044842 Bacteria 5728
351 Ga0466957_0038034 3300044842 Bacteria 2898
352 Ga0451576_0043040 3300045051 Bacteria 4766
353 Ga0451576_0052872 3300045051 Bacteria 4256
354 Ga0451576_0141455 3300045051 Bacteria 2509
355 Ga0451576_0200943 3300045051 Bacteria 2082
356 Ga0451576_0247625 3300045051 Bacteria 1862
357 Ga0451576_0295734 3300045051 Bacteria 1693
358 Ga0451576_0332276 3300045051 Bacteria 1591
359 Ga0451576_0797192 3300045051 Unclassified 992
360 Ga0466967_0047460 3300045976 Bacteria 3744
361 Ga0466967_0348621 3300045976 Bacteria 1433
362 Ga0495592_0053302 3300046454 Unclassified 3001
363 Ga0495651_0043280 3300046462 Unclassified 3494
364 Ga0495651_0206617 3300046462 Bacteria 1370
365 Ga0495653_0207560 3300046463 Unclassified 1325
366 Ga0495664_0157714 3300046477 Unclassified 1377
367 Ga0495618_0104699 3300046514 Bacteria 1812
368 Ga0495630_0000063 3300046517 Bacteria 85919
369 Ga0495630_0046614 3300046517 Bacteria 3240
370 Ga0495630_0066418 3300046517 Bacteria 2711
371 Ga0495630_0080002 3300046517 Unclassified 2465
372 Ga0495630_0181044 3300046517 Bacteria 1607
373 Ga0495630_0286625 3300046517 Bacteria 1258
374 Ga0495652_0090812 3300046529 Unclassified 2498
375 Ga0495652_0169144 3300046529 Unclassified 1689
376 Ga0495640_0123322 3300046533 Bacteria 1682
377 Ga0495586_0000009 3300046535 Bacteria 144639
378 Ga0495586_0002437 3300046535 Bacteria 10094
379 Ga0495598_0009453 3300046537 Bacteria 2305
380 Ga0495645_0186528 3300046543 Bacteria 1417
381 Ga0495634_0061168 3300046642 Bacteria 2504
382 Ga0495635_0032216 3300046663 Bacteria 3637
383 Ga0495635_0149327 3300046663 Unclassified 1591
384 Ga0495588_0113729 3300046674 Bacteria 1426
385 Ga0495657_0033097 3300046675 Unclassified 3602
386 Ga0495599_0043680 3300046678 Bacteria 2813
387 Ga0495647_0005370 3300046681 Bacteria 4197
388 Ga0495647_0044292 3300046681 Bacteria 1706
389 Ga0495658_0080050 3300046683 Bacteria 1915
390 Ga0495658_0254728 3300046683 Bacteria 1104
391 Ga0495669_0024680 3300046684 Bacteria 2618
392 Ga0495669_0034262 3300046684 Bacteria 2238
393 Ga0495613_0151445 3300046689 Unclassified 1654
394 Ga0495613_0263146 3300046689 Bacteria 1201
395 Ga0495674_0000043 3300047319 Bacteria 92585
396 Ga0495674_0411716 3300047319 Unclassified 1090
397 Ga0495676_0016708 3300047321 Bacteria 6499
398 Ga0495676_0136525 3300047321 Bacteria 1763
399 Ga0495680_0033917 3300047322 Bacteria 4129
400 Ga0495680_0336418 3300047322 Bacteria 1054
401 Ga0495675_0018678 3300047444 Bacteria 4403
402 Ga0495675_0044495 3300047444 Unclassified 2828
403 Ga0495675_0075796 3300047444 Bacteria 2120
404 Ga0495675_0313956 3300047444 Bacteria 928
405 Ga0495684_0322155 3300047471 Bacteria 1105
406 Ga0496100_0178724 3300048903 Bacteria 1534
407 Ga0496104_0391009 3300048907 Bacteria 1303
408 Ga0496104_0668616 3300048907 Bacteria 947
409 Ga0496107_0093137 3300048910 Bacteria 2203
410 Ga0496108_0047861 3300048911 Bacteria 3575
411 Ga0496108_0228409 3300048911 Bacteria 1618
412 Ga0496109_0016068 3300048912 Bacteria 6541
413 Ga0496109_0095928 3300048912 Bacteria 2747
414 Ga0496109_0140314 3300048912 Bacteria 2260
415 Ga0496109_0191104 3300048912 Bacteria 1924
416 Ga0496109_0249567 3300048912 Bacteria 1671
417 Ga0496112_0041101 3300048915 Bacteria 4524
418 Ga0496112_0096529 3300048915 Bacteria 2926
419 Ga0496112_0168756 3300048915 Bacteria 2154
420 Ga0496112_0343485 3300048915 Bacteria 1436
421 Ga0496112_0398868 3300048915 Bacteria 1315
422 Ga0496112_0446636 3300048915 Bacteria 1231
423 Ga0496112_0461813 3300048915 Bacteria 1207
424 Ga0496112_0491281 3300048915 Bacteria 1163
425 Ga0496113_0088160 3300048916 Bacteria 2387
426 Ga0496114_0130296 3300048917 Bacteria 2171
427 Ga0501298_016971 3300049521 Bacteria 1324
428 Ga0501299_003159 3300049522 Unclassified 2362
429 Ga0501031_0000196 3300049568 Bacteria 34298
430 Ga0501031_0053055 3300049568 Bacteria 2641
431 Ga0501031_0280820 3300049568 Bacteria 1080
432 Ga0501032_0000359 3300049569 Bacteria 37996
433 Ga0501032_0020803 3300049569 Bacteria 4568
434 Ga0501033_0000072 3300049570 Bacteria 95370
435 Ga0501033_0000909 3300049570 Bacteria 27041
436 Ga0501033_0159187 3300049570 Bacteria 1626
437 Ga0501036_0038072 3300049572 Bacteria 4069
438 Ga0501036_0312258 3300049572 Bacteria 1314
439 Ga0501036_0416318 3300049572 Bacteria 1120
440 Ga0501037_0000073 3300049573 Bacteria 93756
441 Ga0501038_0001837 3300049574 Bacteria 19631
442 Ga0501038_0042447 3300049574 Bacteria 3961
443 Ga0501038_0112265 3300049574 Bacteria 2256
444 Ga0501039_0001009 3300049575 Bacteria 20516
445 Ga0501039_0005996 3300049575 Bacteria 9213
446 Ga0501039_0075468 3300049575 Bacteria 2621
447 Ga0501040_0283013 3300049576 Bacteria 1184
448 Ga0501040_0350698 3300049576 Bacteria 1057
449 Ga0501041_0003553 3300049577 Bacteria 8968
450 Ga0501042_0035435 3300049578 Bacteria 3540
451 Ga0501042_0128528 3300049578 Bacteria 1825
452 Ga0501043_0000640 3300049579 Bacteria 30930
453 Ga0501043_0000854 3300049579 Bacteria 27003
454 Ga0501043_0159477 3300049579 Bacteria 1763
455 Ga0501046_0010124 3300049580 Bacteria 8115
456 Ga0501047_0008693 3300049581 Bacteria 9589
457 Ga0501047_0215115 3300049581 Bacteria 1779
458 Ga0501048_0001164 3300049582 Bacteria 19830
459 Ga0501068_0075037 3300049584 Bacteria 2068
460 Ga0501069_0069401 3300049585 Bacteria 1973
461 Ga0501070_0001365 3300049586 Bacteria 21863
462 Ga0501070_0214854 3300049586 Bacteria 1578
463 Ga0501071_0162022 3300049587 Bacteria 1672
464 Ga0501072_0039663 3300049588 Bacteria 3697
465 Ga0501073_0479746 3300049589 Bacteria 860
466 Ga0501075_0011489 3300049591 Bacteria 6268
467 Ga0501075_0182882 3300049591 Bacteria 1599
468 Ga0501076_0486240 3300049592 Bacteria 1017
469 Ga0501236_027300 3300049670 Bacteria 884
470 Ga0501080_0012228 3300049742 Bacteria 7866
471 Ga0501083_0000889 3300049744 Bacteria 19792
472 Ga0501083_0077697 3300049744 Bacteria 2202
473 Ga0501035_0000002 3300049822 Bacteria 585447
474 Ga0501035_0035790 3300049822 Bacteria 4504
475 Ga0501035_0240091 3300049822 Bacteria 1541
476 Ga0501035_0319675 3300049822 Bacteria 1304
477 Ga0501044_0001262 3300049823 Bacteria 29942
478 Ga0501044_0011458 3300049823 Bacteria 9606
479 Ga0501044_0184314 3300049823 Bacteria 2053
480 nmdc:mga05p37_13377_c1 3300050507 Bacteria 9833
481 nmdc:mga05p37_642555_c1 3300050507 Bacteria 1190
482 nmdc:mga0qj67_371845_c1 3300050509 Bacteria 1154
483 nmdc:mga0qj67_498332_c1 3300050509 Bacteria 979
484 nmdc:mga06r32_241040_c1 3300050510 Unclassified 1796
485 nmdc:mga08y16_251709_c1 3300050511 Bacteria 1825
486 nmdc:mga08y16_99182_c1 3300050511 Bacteria 3033
487 nmdc:mga08x19_102207_c1 3300050514 Bacteria 1903
488 Ga0495601_0020187 3300053077 Unclassified 4068
489 Ga0495619_0074926 3300053085 Bacteria 2270
490 Ga0495619_0201216 3300053085 Bacteria 1379
491 Ga0500555_000015 3300053103 Bacteria 230204
492 Ga0500556_0019404 3300053104 Bacteria 2160
493 Ga0500559_0003741 3300053136 Bacteria 7396
494 Ga0500616_0122595 3300053153 Bacteria 1239
495 Ga0500636_0031006 3300053177 Bacteria 3165
496 Ga0500645_019459 3300053730 Bacteria 2112
497 Ga0501084_0042581 3300054114 Bacteria 3798
498 Ga0466962_0000047 3300061719 Bacteria 50198
499 Ga0530510_0069395 3300061734 Bacteria 2557
500 Ga0451800_0735920
501 JGI24743J22301_10001740
502 JGI24033J26618_1000028
503 JGI25406J46586_10000016
504 rootH2_10000524
505 rootH2_10012722
506 rootH2_10056432
507 rootL2_10040027
508 rootH1_10066215
509 Ga0065704_10071137
510 Ga0065704_10184207
511 Ga0065712_10092986
512 Ga0065707_10106244
513 Ga0070658_10002659
514 Ga0070676_10009065
515 Ga0070683_100027725
516 Ga0070683_100063584
517 Ga0070683_100164917
518 Ga0070683_100581757
519 Ga0070690_100000531
520 Ga0070690_100059232
521 Ga0070690_100164447
522 Ga0070670_100019426
523 Ga0070677_10039916
524 Ga0070666_10003440
525 Ga0070666_10022363
526 Ga0070666_10034292
527 Ga0070666_10174325
528 Ga0068868_100071455
529 Ga0068868_100096274
530 Ga0068868_100376763
531 Ga0070689_100018747
532 Ga0070689_100026439
533 Ga0070689_100120259
534 Ga0070689_100137866
535 Ga0070687_100000853
536 Ga0070661_100000158
537 Ga0070661_100046725
538 Ga0070661_100212253
539 Ga0070668_100040169
540 Ga0070668_100049040
541 Ga0070668_100050803
542 Ga0070669_100006145
543 Ga0070669_100040774
544 Ga0070669_100460923
545 Ga0070675_100014482
546 Ga0070675_100041141
547 Ga0070675_100262822
548 Ga0070671_100048570
549 Ga0070671_100072152
550 Ga0070671_100145288
551 Ga0070674_100004132
552 Ga0070674_100063673
553 Ga0070673_100003933
554 Ga0070673_100207023
555 Ga0070673_100554479
556 Ga0070688_100000527
557 Ga0070688_100030529
558 Ga0070667_100004695
559 Ga0070667_100121836
560 Ga0070714_100016332
561 Ga0070714_100024083
562 Ga0070714_100060195
563 Ga0070711_100089305
564 Ga0070711_100327109
565 Ga0070705_100182465
566 Ga0070708_100053146
567 Ga0070708_100155991
568 Ga0070663_100090083
569 Ga0070678_100001827
570 Ga0070678_100005793
571 Ga0070678_100219751
572 Ga0070681_10308226
573 Ga0070681_10436017
574 Ga0068867_100014888
575 Ga0068867_100223556
576 Ga0070706_100000159
577 Ga0070706_100200387
578 Ga0070707_100059724
579 Ga0070707_100208208
580 Ga0070698_100024341
581 Ga0070698_100372496
582 Ga0070699_100029034
583 Ga0070679_100011712
584 Ga0070679_100364750
585 Ga0070684_100098801
586 Ga0070684_100446518
587 Ga0070697_100030223
588 Ga0070697_100068332
589 Ga0068853_100259053
590 Ga0070672_100000507
591 Ga0070672_100011246
592 Ga0070686_100001256
593 Ga0070665_100049466
594 Ga0070665_100249338
595 Ga0070665_100274027
596 Ga0068855_100001572
597 Ga0068855_100034638
598 Ga0068855_100040003
599 Ga0068855_100103422
600 Ga0068855_100390867
601 Ga0070664_100013491
602 Ga0068857_100012495
603 Ga0068854_100000039
604 Ga0068856_100000747
605 Ga0068856_100003007
606 Ga0068856_100053187
607 Ga0068856_100110002
608 Ga0068856_100346176
609 Ga0068859_100261507
610 Ga0068859_100559227
611 Ga0068864_100018447
612 Ga0068866_10060893
613 Ga0068863_100000717
614 Ga0068860_100000236
615 Ga0068860_100278780
616 Ga0081455_10063529
617 Ga0081540_1028002
618 Ga0081539_10000383
619 Ga0081539_10003184
620 Ga0070717_10357438
621 Ga0070712_100102477
622 Ga0070712_100251488
623 Ga0075366_10125660
624 Ga0097621_100020780
625 Ga0097621_100026858
626 Ga0097621_100155268
627 Ga0097621_100192150
628 Ga0068871_100005948
629 Ga0068871_100015881
630 Ga0075428_100002258
631 Ga0075430_100097706
632 Ga0075431_100060093
633 Ga0075431_100234728
634 Ga0068865_100026395
635 Ga0075436_100090914
636 Ga0097620_100261519
637 Ga0097620_100559144
638 Ga0075435_100141771
639 Ga0105240_10056075
640 Ga0105240_10084270
641 Ga0105240_10496437
642 Ga0111539_10034867
643 Ga0111539_10087488
644 Ga0111539_10181084
645 Ga0111539_10412063
646 Ga0105245_10412486
647 Ga0114129_10007148
648 Ga0114129_10055817
649 Ga0105242_10054059
650 Ga0105237_10008312
651 Ga0105237_10068069
652 Ga0105238_10035658
653 Ga0105238_10122876
654 Ga0105238_10137338
655 Ga0105239_10120682
656 Ga0105239_10132355
657 Ga0157374_10000043
658 Ga0157374_10012327
659 Ga0157374_10013389
660 Ga0157374_10013540
661 Ga0157374_10025878
662 Ga0157374_10044897
663 Ga0157374_10051028
664 Ga0157374_10068203
665 Ga0157374_10072340
666 Ga0157374_10256489
667 Ga0157378_10029064
668 Ga0157378_10035625
669 Ga0157378_10301231
670 Ga0157378_10393579
671 Ga0163162_10002963
672 Ga0163162_10021042
673 Ga0157372_10200691
674 Ga0157375_10000081
675 Ga0157375_10002525
676 Ga0157375_10008738
677 Ga0157375_10011067
678 Ga0157375_10021659
679 Ga0157375_10163959
680 Ga0157375_10192096
681 Ga0163163_10000059
682 Ga0163163_10106061
683 Ga0163163_10194353
684 Ga0182008_10022552
685 Ga0157376_10001205
686 Ga0157376_10045142
687 Ga0157376_10052050
688 Ga0157376_10098714
689 Ga0206356_10933481
690 Ga0206354_11166194
691 Ga0213873_10001996
692 Ga0213872_10004543
693 Ga0213876_10062382
694 Ga0213876_10063589
695 Ga0207697_10003337
696 Ga0207697_10033466
697 Ga0207688_10033826
698 Ga0207680_10014109
699 Ga0207680_10017224
700 Ga0207680_10323700
701 Ga0207699_10122088
702 Ga0207645_10003338
703 Ga0207645_10027556
704 Ga0207645_10101859
705 Ga0207705_10000742
706 Ga0207684_10000208
707 Ga0207707_10058503
708 Ga0207707_10376129
709 Ga0207671_10021182
710 Ga0207693_10020913
711 Ga0207662_10005357
712 Ga0207657_10013229
713 Ga0207649_10001221
714 Ga0207652_10336373
715 Ga0207646_10000115
716 Ga0207646_10000985
717 Ga0207646_10045182
718 Ga0207646_10148729
719 Ga0207646_10562271
720 Ga0207681_10012256
721 Ga0207681_10115977
722 Ga0207681_10245054
723 Ga0207681_10268445
724 Ga0207694_10015516
725 Ga0207650_10007381
726 Ga0207650_10086843
727 Ga0207659_10009479
728 Ga0207659_10023331
729 Ga0207659_10229098
730 Ga0207664_10034989
731 Ga0207664_10065604
732 Ga0207664_10070293
733 Ga0207644_10026230
734 Ga0207644_10030154
735 Ga0207644_10151155
736 Ga0207706_10159121
737 Ga0207670_10073929
738 Ga0207670_10104781
739 Ga0207670_10141148
740 Ga0207670_10167869
741 Ga0207669_10013699
742 Ga0207691_10001154
743 Ga0207691_10017530
744 Ga0207691_10038963
745 Ga0207691_10499580
746 Ga0207661_10018152
747 Ga0207661_10411057
748 Ga0207661_10518626
749 Ga0207679_10004144
750 Ga0207679_10065135
751 Ga0207667_10006025
752 Ga0207667_10007744
753 Ga0207651_10062672
754 Ga0207651_10172017
755 Ga0207668_10096139
756 Ga0207668_10152140
757 Ga0207668_10179630
758 Ga0207640_10000024
759 Ga0207658_10107372
760 Ga0207658_10117232
761 Ga0207677_10049875
762 Ga0207677_10140625
763 Ga0207639_10201901
764 Ga0207678_10040840
765 Ga0207678_10189416
766 Ga0207702_10000285
767 Ga0207702_10002531
768 Ga0207702_10053326
769 Ga0207702_10116127
770 Ga0207702_10280386
771 Ga0207702_10360839
772 Ga0207641_10005378
773 Ga0207648_10009854
774 Ga0207648_10232878
775 Ga0207676_10164537
776 Ga0207676_10167414
777 Ga0207674_10005516
778 Ga0207674_10560396
779 Ga0207683_10015328
780 Ga0207683_10015937
781 Ga0207683_10022088
782 Ga0207683_10047470
783 Ga0268266_10013392
784 Ga0268266_10015972
785 Ga0268266_10220806
786 Ga0268264_10000508
787 Ga0265337_1006066
788 Ga0265326_10001335
789 Ga0265338_10000223
790 Ga0265338_10000496
791 Ga0265338_10000699
792 Ga0265338_10002222
793 Ga0265338_10002248
794 Ga0265338_10028978
795 Ga0265338_10042626
796 Ga0265338_10052885
797 Ga0265338_10070106
798 Ga0265338_10157216
799 Ga0265324_10000417
800 Ga0265332_10014967
801 Ga0265320_10003194
802 Ga0265340_10077423
803 Ga0265339_10016917
804 Ga0265327_10001043
805 Ga0265314_10027217
806 Ga0265314_10106433
807 Ga0307411_10040926
808 Ga0373938_0037373
809 Ga0373926_0018014
810 Ga0373954_0036185
811 Ga0373954_0171777
812 Ga0373943_0079960
813 Ga0373943_0119649
814 Ga0373935_0010141
815 Ga0373927_0004132
816 Ga0373927_0009042
817 Ga0373927_0247323
818 Ga0373947_0024096
819 Ga0373937_0030113
820 Ga0373937_0314680
821 Ga0373937_0480134
822 Ga0373925_0000862
823 Ga0373925_0045922
824 Ga0373925_0485018
825 Ga0395899_0000067
826 Ga0395900_0008838
827 Ga0395900_0011539
828 Ga0395898_0000067
829 Ga0395898_0419466
830 Ga0395905_0212990
831 Ga0395901_0000532
832 Ga0395901_0228132
833 Ga0395901_0548547
834 Ga0436365_0785320
835 Ga0436365_1813535
836 Ga0436360_1197960
837 Ga0436361_0314176
838 Ga0436361_0425304
839 Ga0436361_0475029
840 Ga0436363_0634802
841 Ga0436363_1432688
842 Ga0436362_0237644
843 Ga0439450_023499
844 Ga0439463_025190
845 Ga0451577_0004759
846 Ga0453684_0004271
847 Ga0453684_0429769
848 Ga0466971_0000081
849 Ga0466957_0008871
850 Ga0466957_0038034
851 Ga0451576_0043040
852 Ga0451576_0052872
853 Ga0451576_0141455
854 Ga0451576_0200943
855 Ga0451576_0247625
856 Ga0451576_0295734
857 Ga0451576_0332276
858 Ga0451576_0797192
859 Ga0466967_0047460
860 Ga0466967_0348621
861 Ga0495592_0053302
862 Ga0495651_0043280
863 Ga0495651_0206617
864 Ga0495653_0207560
865 Ga0495664_0157714
866 Ga0495618_0104699
867 Ga0495630_0000063
868 Ga0495630_0046614
869 Ga0495630_0066418
870 Ga0495630_0080002
871 Ga0495630_0181044
872 Ga0495630_0286625
873 Ga0495652_0090812
874 Ga0495652_0169144
875 Ga0495640_0123322
876 Ga0495586_0000009
877 Ga0495586_0002437
878 Ga0495598_0009453
879 Ga0495645_0186528
880 Ga0495634_0061168
881 Ga0495635_0032216
882 Ga0495635_0149327
883 Ga0495588_0113729
884 Ga0495657_0033097
885 Ga0495599_0043680
886 Ga0495647_0005370
887 Ga0495647_0044292
888 Ga0495658_0080050
889 Ga0495658_0254728
890 Ga0495669_0024680
891 Ga0495669_0034262
892 Ga0495613_0151445
893 Ga0495613_0263146
894 Ga0495674_0000043
895 Ga0495674_0411716
896 Ga0495676_0016708
897 Ga0495676_0136525
898 Ga0495680_0033917
899 Ga0495680_0336418
900 Ga0495675_0018678
901 Ga0495675_0044495
902 Ga0495675_0075796
903 Ga0495675_0313956
904 Ga0495684_0322155
905 Ga0496100_0178724
906 Ga0496104_0391009
907 Ga0496104_0668616
908 Ga0496107_0093137
909 Ga0496108_0047861
910 Ga0496108_0228409
911 Ga0496109_0016068
912 Ga0496109_0095928
913 Ga0496109_0140314
914 Ga0496109_0191104
915 Ga0496109_0249567
916 Ga0496112_0041101
917 Ga0496112_0096529
918 Ga0496112_0168756
919 Ga0496112_0343485
920 Ga0496112_0398868
921 Ga0496112_0446636
922 Ga0496112_0461813
923 Ga0496112_0491281
924 Ga0496113_0088160
925 Ga0496114_0130296
926 Ga0501298_016971
927 Ga0501299_003159
928 Ga0501031_0000196
929 Ga0501031_0053055
930 Ga0501031_0280820
931 Ga0501032_0000359
932 Ga0501032_0020803
933 Ga0501033_0000072
934 Ga0501033_0000909
935 Ga0501033_0159187
936 Ga0501036_0038072
937 Ga0501036_0312258
938 Ga0501036_0416318
939 Ga0501037_0000073
940 Ga0501038_0001837
941 Ga0501038_0042447
942 Ga0501038_0112265
943 Ga0501039_0001009
944 Ga0501039_0005996
945 Ga0501039_0075468
946 Ga0501040_0283013
947 Ga0501040_0350698
948 Ga0501041_0003553
949 Ga0501042_0035435
950 Ga0501042_0128528
951 Ga0501043_0000640
952 Ga0501043_0000854
953 Ga0501043_0159477
954 Ga0501046_0010124
955 Ga0501047_0008693
956 Ga0501047_0215115
957 Ga0501048_0001164
958 Ga0501068_0075037
959 Ga0501069_0069401
960 Ga0501070_0001365
961 Ga0501070_0214854
962 Ga0501071_0162022
963 Ga0501072_0039663
964 Ga0501073_0479746
965 Ga0501075_0011489
966 Ga0501075_0182882
967 Ga0501076_0486240
968 Ga0501236_027300
969 Ga0501080_0012228
970 Ga0501083_0000889
971 Ga0501083_0077697
972 Ga0501035_0000002
973 Ga0501035_0035790
974 Ga0501035_0240091
975 Ga0501035_0319675
976 Ga0501044_0001262
977 Ga0501044_0011458
978 Ga0501044_0184314
979 nmdc:mga05p37_13377_c1
980 nmdc:mga05p37_642555_c1
981 nmdc:mga0qj67_371845_c1
982 nmdc:mga0qj67_498332_c1
983 nmdc:mga06r32_241040_c1
984 nmdc:mga08y16_251709_c1
985 nmdc:mga08y16_99182_c1
986 nmdc:mga08x19_102207_c1
987 Ga0495601_0020187
988 Ga0495619_0074926
989 Ga0495619_0201216
990 Ga0500555_000015
991 Ga0500556_0019404
992 Ga0500559_0003741
993 Ga0500616_0122595
994 Ga0500636_0031006
995 Ga0500645_019459
996 Ga0501084_0042581
997 Ga0466962_0000047
998 Ga0530510_0069395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

214

327

0.96

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

53

211

0.94

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

19

146

0.8

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

53

145

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9309 2 273
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.927 2 274
5xvh-assembly1.cif.gz_A-2 crystal structure of the nadp+ and tartrate-bound complex of l-serine 3-dehydrogenase from the hyperthermophilic archaeon pyrobaculum calidifontis 0.9201 2 269
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.9186 2 271
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.9179 2 272
ID Description Score Start End Superfamily
3ckyD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.964 48 159 3.40.50.720
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 2 160 3.40.50.720
af_Q9XTI0_3_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9476 2 159 3.40.50.720
3ws7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 2 160 3.40.50.720
af_Q9C991_11_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 2 159 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V5W536-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9929 2 168 GO:0016616
GO:0050661
AF-A0A4Q2YG68-F1-model_v4 NAD(P)-dependent oxidoreductase 0.968 2 258 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A382CPB1-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9644 2 174 GO:0050661
AF-A0A183U7X3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.9594 84 165 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A539E7Y2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9555 8 178 GO:0050661

Map