F455442

General Info

Members Datasets Scaffolds Average Seq Length
499 235 998 128

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0070151|Ga0501047_0070151_2303_2752
Length 149
Sequence MNAGDQLPELRITPDRYLTVRYAGASGDFNPIHVDDEFARSVGLPGRILHGLWSMAQVARAVTEASGDPAALRSLSVQFRGMGVPEAELSVTGTVKSVDPGSGVAVVEAEARQGDTRIIRPAAGRRRLTRPSPRRRVAACCTCSPCPQR

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
160 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 11.42
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0070151 3300049581 Bacteria 3374
2 Ga0070658_10298695 3300005327 Bacteria 1373
3 Ga0070683_100111278 3300005329 Bacteria 2583
4 Ga0070683_100123430 3300005329 Bacteria 2447
5 Ga0070683_100147433 3300005329 Bacteria 2230
6 Ga0070683_100272331 3300005329 Bacteria 1610
7 Ga0070683_100740406 3300005329 Bacteria 942
8 Ga0070680_101504531 3300005336 Bacteria 583
9 Ga0070682_100372861 3300005337 Bacteria 1071
10 Ga0070682_101482531 3300005337 Bacteria 583
11 Ga0068868_100067985 3300005338 Bacteria 2836
12 Ga0068868_100269035 3300005338 Bacteria 1439
13 Ga0070660_100967267 3300005339 Bacteria 719
14 Ga0070689_100349925 3300005340 Bacteria 1239
15 Ga0070691_10175397 3300005341 Bacteria 1113
16 Ga0070687_100081631 3300005343 Bacteria 1766
17 Ga0070661_100273087 3300005344 Bacteria 1310
18 Ga0070661_101226935 3300005344 Bacteria 628
19 Ga0070692_10539929 3300005345 Bacteria 762
20 Ga0070668_100693360 3300005347 Bacteria 898
21 Ga0070674_100783580 3300005356 Bacteria 822
22 Ga0070674_101151093 3300005356 Unclassified 687
23 Ga0070688_101094394 3300005365 Unclassified 637
24 Ga0070659_100000043 3300005366 Bacteria 102267
25 Ga0070714_100000745 3300005435 Bacteria 23021
26 Ga0070714_100009040 3300005435 Bacteria 7806
27 Ga0070714_100095526 3300005435 Bacteria 2610
28 Ga0070714_100484495 3300005435 Bacteria 1178
29 Ga0070714_100705061 3300005435 Bacteria 974
30 Ga0070714_100855565 3300005435 Bacteria 882
31 Ga0070713_100015622 3300005436 Bacteria 5685
32 Ga0070713_100280785 3300005436 Bacteria 1528
33 Ga0070713_101152542 3300005436 Bacteria 750
34 Ga0070710_10000003 3300005437 Bacteria 277772
35 Ga0070710_10277698 3300005437 Bacteria 1086
36 Ga0070711_100015599 3300005439 Unclassified 4810
37 Ga0070705_100000625 3300005440 Bacteria 20423
38 Ga0070700_100265095 3300005441 Bacteria 1239
39 Ga0070700_100673100 3300005441 Bacteria 819
40 Ga0070663_100275549 3300005455 Bacteria 1339
41 Ga0070663_101721096 3300005455 Bacteria 561
42 Ga0070678_101561673 3300005456 Bacteria 619
43 Ga0070662_100213092 3300005457 Bacteria 1538
44 Ga0068867_100266330 3300005459 Bacteria 1399
45 Ga0068867_100440461 3300005459 Bacteria 1108
46 Ga0070685_10480081 3300005466 Bacteria 876
47 Ga0070707_100253989 3300005468 Bacteria 1711
48 Ga0070684_100144934 3300005535 Bacteria 2149
49 Ga0070684_101152739 3300005535 Bacteria 729
50 Ga0068853_100402213 3300005539 Bacteria 1282
51 Ga0068853_101150644 3300005539 Bacteria 749
52 Ga0070696_100557723 3300005546 Bacteria 919
53 Ga0070693_100059351 3300005547 Bacteria 2217
54 Ga0070664_100083668 3300005564 Bacteria 2753
55 Ga0070664_100135073 3300005564 Bacteria 2169
56 Ga0070664_100525236 3300005564 Bacteria 1093
57 Ga0070664_100800942 3300005564 Bacteria 881
58 Ga0068854_100148945 3300005578 Bacteria 1803
59 Ga0070702_100080056 3300005615 Bacteria 1954
60 Ga0070702_100315043 3300005615 Bacteria 1088
61 Ga0068852_100158016 3300005616 Bacteria 2114
62 Ga0068864_100185626 3300005618 Bacteria 1903
63 Ga0068866_10170338 3300005718 Bacteria 1278
64 Ga0068861_100840726 3300005719 Bacteria 865
65 Ga0068861_101017277 3300005719 Bacteria 792
66 Ga0068870_10157666 3300005840 Bacteria 1343
67 Ga0068870_10881411 3300005840 Bacteria 631
68 Ga0068863_100983993 3300005841 Bacteria 846
69 Ga0068863_102046305 3300005841 Bacteria 583
70 Ga0068858_100822193 3300005842 Bacteria 907
71 Ga0068858_101317668 3300005842 Bacteria 711
72 Ga0081455_10091095 3300005937 Bacteria 2470
73 Ga0081540_1118066 3300005983 Bacteria 1107
74 Ga0081539_10274320 3300005985 Bacteria 737
75 Ga0070717_10022385 3300006028 Bacteria 4993
76 Ga0070717_10059896 3300006028 Bacteria 3151
77 Ga0070717_10804737 3300006028 Bacteria 855
78 Ga0070712_100191260 3300006175 Bacteria 1602
79 Ga0070712_101200915 3300006175 Bacteria 660
80 Ga0068871_102282229 3300006358 Bacteria 516
81 Ga0075428_101194334 3300006844 Bacteria 802
82 Ga0075433_10091267 3300006852 Bacteria 2692
83 Ga0068865_100055698 3300006881 Bacteria 2752
84 Ga0068865_100101640 3300006881 Bacteria 2106
85 Ga0068865_100994933 3300006881 Bacteria 734
86 Ga0097620_101093541 3300006931 Bacteria 877
87 Ga0105240_10134768 3300009093 Bacteria 2958
88 Ga0105240_11431006 3300009093 Bacteria 726
89 Ga0111539_11458047 3300009094 Bacteria 794
90 Ga0111539_11758754 3300009094 Bacteria 719
91 Ga0105245_10338397 3300009098 Bacteria 1487
92 Ga0105245_10917095 3300009098 Bacteria 918
93 Ga0105245_11090811 3300009098 Bacteria 844
94 Ga0105245_12044935 3300009098 Bacteria 626
95 Ga0114129_12386066 3300009147 Bacteria 634
96 Ga0105243_10143782 3300009148 Bacteria 2038
97 Ga0105243_10188122 3300009148 Bacteria 1801
98 Ga0105243_10410209 3300009148 Bacteria 1261
99 Ga0105243_10580055 3300009148 Bacteria 1076
100 Ga0105243_12416889 3300009148 Bacteria 564
101 Ga0105241_10852770 3300009174 Bacteria 843
102 Ga0105241_11030347 3300009174 Bacteria 771
103 Ga0105242_11435859 3300009176 Unclassified 719
104 Ga0105242_11595673 3300009176 Bacteria 686
105 Ga0105242_11892706 3300009176 Unclassified 637
106 Ga0105248_12379425 3300009177 Bacteria 603
107 Ga0105237_10000495 3300009545 Bacteria 55778
108 Ga0105238_10575693 3300009551 Bacteria 1132
109 Ga0105238_10729885 3300009551 Bacteria 1004
110 Ga0105249_11235175 3300009553 Bacteria 818
111 Ga0105239_10084576 3300010375 Bacteria 3495
112 Ga0105239_10261611 3300010375 Bacteria 1944
113 Ga0105239_10436818 3300010375 Bacteria 1484
114 Ga0105239_11179197 3300010375 Bacteria 882
115 Ga0105239_13465024 3300010375 Bacteria 513
116 Ga0105246_10059520 3300011119 Bacteria 2650
117 Ga0105246_10097914 3300011119 Bacteria 2130
118 Ga0105246_10223759 3300011119 Bacteria 1477
119 Ga0105246_10964796 3300011119 Bacteria 769
120 Ga0105246_11101827 3300011119 Bacteria 725
121 Ga0157373_11003126 3300013100 Bacteria 623
122 Ga0157371_10677097 3300013102 Bacteria 771
123 Ga0157371_10797636 3300013102 Bacteria 711
124 Ga0157374_11294181 3300013296 Bacteria 751
125 Ga0157378_11600043 3300013297 Bacteria 697
126 Ga0163162_10710771 3300013306 Bacteria 1126
127 Ga0157372_10258134 3300013307 Bacteria 2023
128 Ga0157372_10533365 3300013307 Bacteria 1368
129 Ga0157375_10282983 3300013308 Bacteria 1821
130 Ga0157375_12501180 3300013308 Unclassified 616
131 Ga0163163_10213057 3300014325 Bacteria 1981
132 Ga0163163_11282920 3300014325 Unclassified 795
133 Ga0163163_11789725 3300014325 Bacteria 675
134 Ga0163163_13074799 3300014325 Bacteria 520
135 Ga0157380_10893938 3300014326 Bacteria 914
136 Ga0157380_11274923 3300014326 Unclassified 781
137 Ga0157380_11428924 3300014326 Bacteria 743
138 Ga0157380_11825092 3300014326 Bacteria 667
139 Ga0157377_10015658 3300014745 Bacteria 3886
140 Ga0157377_10115422 3300014745 Bacteria 1620
141 Ga0157377_10812071 3300014745 Bacteria 691
142 Ga0157377_10923304 3300014745 Bacteria 654
143 Ga0157379_10149260 3300014968 Bacteria 2108
144 Ga0157379_10301028 3300014968 Bacteria 1461
145 Ga0157379_12096784 3300014968 Bacteria 560
146 Ga0157376_10247044 3300014969 Bacteria 1665
147 Ga0206356_10592591 3300020070 Bacteria 1192
148 Ga0206353_10298795 3300020082 Bacteria 732
149 Ga0206353_11399968 3300020082 Bacteria 519
150 Ga0213874_10314901 3300021377 Bacteria 592
151 Ga0213875_10000351 3300021388 Bacteria 43186
152 Ga0207692_10000016 3300025898 Bacteria 86771
153 Ga0207692_10483765 3300025898 Bacteria 783
154 Ga0207642_10083461 3300025899 Bacteria 1558
155 Ga0207642_10227181 3300025899 Bacteria 1046
156 Ga0207688_10031334 3300025901 Bacteria 2935
157 Ga0207688_10059605 3300025901 Bacteria 2150
158 Ga0207705_10634525 3300025909 Bacteria 831
159 Ga0207654_10370863 3300025911 Bacteria 989
160 Ga0207654_10638432 3300025911 Bacteria 762
161 Ga0207695_10171946 3300025913 Bacteria 2092
162 Ga0207695_10943864 3300025913 Bacteria 742
163 Ga0207671_10004500 3300025914 Bacteria 13265
164 Ga0207693_10185390 3300025915 Bacteria 1638
165 Ga0207693_10193049 3300025915 Bacteria 1602
166 Ga0207693_10856704 3300025915 Bacteria 699
167 Ga0207663_10053581 3300025916 Bacteria 2521
168 Ga0207663_10191297 3300025916 Bacteria 1469
169 Ga0207663_10834551 3300025916 Bacteria 735
170 Ga0207663_11411659 3300025916 Bacteria 561
171 Ga0207662_10051641 3300025918 Bacteria 2446
172 Ga0207657_10821781 3300025919 Bacteria 718
173 Ga0207652_10985098 3300025921 Bacteria 741
174 Ga0207646_10257522 3300025922 Bacteria 1577
175 Ga0207650_10530731 3300025925 Bacteria 985
176 Ga0207650_10836360 3300025925 Bacteria 781
177 Ga0207687_10063232 3300025927 Bacteria 2620
178 Ga0207687_10311513 3300025927 Bacteria 1271
179 Ga0207687_11476629 3300025927 Bacteria 584
180 Ga0207687_11833685 3300025927 Bacteria 519
181 Ga0207700_10243106 3300025928 Bacteria 1535
182 Ga0207700_10704042 3300025928 Bacteria 902
183 Ga0207664_10000004 3300025929 Bacteria 493014
184 Ga0207664_10003392 3300025929 Bacteria 10603
185 Ga0207664_10186494 3300025929 Bacteria 1784
186 Ga0207664_10308289 3300025929 Bacteria 1394
187 Ga0207664_10410134 3300025929 Bacteria 1206
188 Ga0207664_10761381 3300025929 Bacteria 871
189 Ga0207664_11471826 3300025929 Bacteria 602
190 Ga0207690_10000095 3300025932 Bacteria 73025
191 Ga0207690_10513241 3300025932 Bacteria 971
192 Ga0207690_10890412 3300025932 Bacteria 738
193 Ga0207686_10510017 3300025934 Bacteria 934
194 Ga0207709_10160385 3300025935 Bacteria 1568
195 Ga0207670_10331869 3300025936 Bacteria 1199
196 Ga0207669_10319531 3300025937 Bacteria 1188
197 Ga0207704_10748996 3300025938 Bacteria 812
198 Ga0207691_10330466 3300025940 Bacteria 1306
199 Ga0207689_10191674 3300025942 Bacteria 1687
200 Ga0207689_10690571 3300025942 Bacteria 860
201 Ga0207661_10173313 3300025944 Bacteria 1879
202 Ga0207661_10361887 3300025944 Bacteria 1310
203 Ga0207661_10630091 3300025944 Bacteria 985
204 Ga0207679_10056239 3300025945 Bacteria 2904
205 Ga0207679_10172565 3300025945 Bacteria 1782
206 Ga0207679_10279558 3300025945 Bacteria 1431
207 Ga0207679_10745866 3300025945 Bacteria 890
208 Ga0207679_10929875 3300025945 Bacteria 796
209 Ga0207679_11065689 3300025945 Bacteria 741
210 Ga0207712_10339714 3300025961 Bacteria 1245
211 Ga0207712_10856915 3300025961 Bacteria 801
212 Ga0207712_10979562 3300025961 Bacteria 750
213 Ga0207712_11791558 3300025961 Bacteria 550
214 Ga0207668_11314360 3300025972 Bacteria 651
215 Ga0207640_10145994 3300025981 Bacteria 1731
216 Ga0207677_10252380 3300026023 Bacteria 1433
217 Ga0207677_10904750 3300026023 Bacteria 796
218 Ga0207678_10405451 3300026067 Bacteria 1181
219 Ga0207678_10544546 3300026067 Bacteria 1015
220 Ga0207678_10626158 3300026067 Bacteria 944
221 Ga0207678_11862490 3300026067 Bacteria 525
222 Ga0207708_10105337 3300026075 Bacteria 2186
223 Ga0207708_10357158 3300026075 Bacteria 1200
224 Ga0207702_10375849 3300026078 Bacteria 1365
225 Ga0207648_10174672 3300026089 Bacteria 1900
226 Ga0207676_10080854 3300026095 Bacteria 2639
227 Ga0207674_10261710 3300026116 Bacteria 1677
228 Ga0207675_100046287 3300026118 Bacteria 4063
229 Ga0207675_100764600 3300026118 Bacteria 978
230 Ga0207698_10273434 3300026142 Bacteria 1559
231 Ga0207698_10581659 3300026142 Bacteria 1102
232 Ga0207698_10703065 3300026142 Bacteria 1006
233 Ga0268266_10664038 3300028379 Bacteria 1004
234 Ga0268265_10714038 3300028380 Bacteria 970
235 Ga0268264_12084245 3300028381 Bacteria 576
236 Ga0265337_1003227 3300028556 Bacteria 7133
237 Ga0265326_10000006 3300028558 Bacteria 233392
238 Ga0265326_10000595 3300028558 Bacteria 13520
239 Ga0265319_1000280 3300028563 Bacteria 38064
240 Ga0265319_1000861 3300028563 Bacteria 19297
241 Ga0265334_10000016 3300028573 Bacteria 147961
242 Ga0265334_10104145 3300028573 Bacteria 1024
243 Ga0265334_10289420 3300028573 Bacteria 561
244 Ga0265318_10001633 3300028577 Bacteria 12949
245 Ga0265318_10028777 3300028577 Bacteria 2170
246 Ga0265318_10152598 3300028577 Bacteria 847
247 Ga0265322_10056684 3300028654 Bacteria 1111
248 Ga0265336_10000002 3300028666 Bacteria 830172
249 Ga0265338_10000001 3300028800 Bacteria 1177449
250 Ga0265338_10000961 3300028800 Bacteria 48623
251 Ga0265338_10041316 3300028800 Bacteria 4314
252 Ga0265338_10268014 3300028800 Bacteria 1252
253 Ga0265324_10005485 3300029957 Bacteria 5475
254 Ga0265324_10011445 3300029957 Bacteria 3379
255 Ga0265329_10238674 3300031242 Bacteria 604
256 Ga0265340_10000001 3300031247 Bacteria 1647668
257 Ga0265327_10006873 3300031251 Bacteria 8953
258 Ga0265327_10064640 3300031251 Bacteria 1853
259 Ga0265327_10267476 3300031251 Bacteria 758
260 Ga0265327_10313836 3300031251 Unclassified 688
261 Ga0307408_100275710 3300031548 Bacteria 1398
262 Ga0307408_101183247 3300031548 Bacteria 712
263 Ga0265342_10028369 3300031712 Bacteria 3488
264 Ga0307405_10298651 3300031731 Bacteria 1221
265 Ga0307405_10750135 3300031731 Bacteria 813
266 Ga0307413_10082801 3300031824 Bacteria 2062
267 Ga0307410_10011564 3300031852 Bacteria 5054
268 Ga0307410_10696953 3300031852 Bacteria 856
269 Ga0307410_10856625 3300031852 Bacteria 776
270 Ga0307410_11738381 3300031852 Bacteria 553
271 Ga0307406_11756972 3300031901 Bacteria 551
272 Ga0307407_10100014 3300031903 Bacteria 1798
273 Ga0307407_10136994 3300031903 Bacteria 1574
274 Ga0307407_10481828 3300031903 Bacteria 906
275 Ga0307412_10014682 3300031911 Bacteria 4628
276 Ga0307412_10939587 3300031911 Bacteria 760
277 Ga0307412_11229741 3300031911 Bacteria 672
278 Ga0307409_100011701 3300031995 Bacteria 5548
279 Ga0307409_100045835 3300031995 Bacteria 3305
280 Ga0307409_100333271 3300031995 Bacteria 1425
281 Ga0307409_100559978 3300031995 Bacteria 1124
282 Ga0307409_100649025 3300031995 Bacteria 1049
283 Ga0307409_101135589 3300031995 Bacteria 803
284 Ga0307416_100075257 3300032002 Bacteria 2825
285 Ga0307416_100555605 3300032002 Bacteria 1222
286 Ga0307416_100693288 3300032002 Bacteria 1107
287 Ga0307416_100820044 3300032002 Bacteria 1027
288 Ga0307414_10226330 3300032004 Bacteria 1539
289 Ga0307414_11079785 3300032004 Bacteria 741
290 Ga0307411_10098453 3300032005 Bacteria 2061
291 Ga0307411_10670883 3300032005 Bacteria 900
292 Ga0307411_10724538 3300032005 Bacteria 869
293 Ga0307415_100075017 3300032126 Bacteria 2392
294 Ga0307415_100173949 3300032126 Bacteria 1682
295 Ga0307415_100199800 3300032126 Bacteria 1585
296 Ga0307415_100292250 3300032126 Bacteria 1346
297 Ga0307415_100509911 3300032126 Bacteria 1053
298 Ga0307415_100850741 3300032126 Bacteria 837
299 Ga0307415_101634077 3300032126 Bacteria 620
300 Ga0373947_0304578 3300035725 Bacteria 1063
301 Ga0373937_1909528 3300036401 Bacteria 540
302 Ga0395900_0199598 3300037418 Bacteria 2025
303 Ga0395900_0736355 3300037418 Bacteria 917
304 Ga0395898_0138078 3300037466 Bacteria 2334
305 Ga0395898_0199232 3300037466 Bacteria 1912
306 Ga0395898_0487944 3300037466 Bacteria 1172
307 Ga0395898_0828610 3300037466 Bacteria 865
308 Ga0395905_0528005 3300037471 Bacteria 1081
309 Ga0395905_0852058 3300037471 Bacteria 814
310 Ga0395905_0985155 3300037471 Bacteria 746
311 Ga0436364_1134712 3300037853 Bacteria 4619
312 Ga0436364_1229417 3300037853 Bacteria 1915
313 Ga0436364_1426665 3300037853 Bacteria 33049
314 Ga0395901_0050708 3300038443 Bacteria 4311
315 Ga0395901_0058545 3300038443 Bacteria 4007
316 Ga0395901_0267175 3300038443 Bacteria 1780
317 Ga0395901_0347317 3300038443 Bacteria 1532
318 Ga0436363_1036979 3300039450 Bacteria 1566
319 Ga0436363_1430072 3300039450 Bacteria 1770
320 Ga0451789_0107835 3300041443 Bacteria 638
321 Ga0451800_0787809 3300041459 Bacteria 674
322 Ga0451802_1573351 3300041460 Bacteria 984
323 Ga0451833_1279285 3300041491 Bacteria 1127
324 Ga0451839_0958179 3300041496 Bacteria 906
325 Ga0451855_0419185 3300041511 Bacteria 868
326 Ga0451853_2165100 3300041512 Bacteria 1045
327 Ga0451853_2596443 3300041512 Bacteria 1192
328 Ga0451853_3357721 3300041512 Bacteria 807
329 Ga0466969_0026716 3300044656 Bacteria 2960
330 Ga0466969_0037959 3300044656 Bacteria 2427
331 Ga0466972_0116653 3300044658 Bacteria 1260
332 Ga0466965_0006216 3300044683 Bacteria 5402
333 Ga0466965_0252784 3300044683 Bacteria 946
334 Ga0466966_0060967 3300044684 Bacteria 2380
335 Ga0466966_0100011 3300044684 Bacteria 1794
336 Ga0466966_0105890 3300044684 Bacteria 1736
337 Ga0466961_0006650 3300044693 Bacteria 7353
338 Ga0466961_0047106 3300044693 Bacteria 2757
339 Ga0466961_0159571 3300044693 Bacteria 1406
340 Ga0466961_0171349 3300044693 Bacteria 1350
341 Ga0466961_0689112 3300044693 Bacteria 612
342 Ga0466961_0832683 3300044693 Bacteria 550
343 Ga0466961_0898195 3300044693 Bacteria 527
344 Ga0466963_0000696 3300044694 Bacteria 16373
345 Ga0466963_0031412 3300044694 Bacteria 3433
346 Ga0466963_0158294 3300044694 Bacteria 1576
347 Ga0466963_0362053 3300044694 Bacteria 1022
348 Ga0466963_0571870 3300044694 Bacteria 798
349 Ga0466963_0578486 3300044694 Bacteria 793
350 Ga0466964_0114908 3300044706 Bacteria 1205
351 Ga0466964_0212705 3300044706 Bacteria 935
352 Ga0466971_0041940 3300044719 Bacteria 2056
353 Ga0466971_0051952 3300044719 Bacteria 1846
354 Ga0466968_0103183 3300044735 Bacteria 1275
355 Ga0466968_0134309 3300044735 Bacteria 1128
356 Ga0466968_0207025 3300044735 Bacteria 920
357 Ga0466968_0270305 3300044735 Bacteria 811
358 Ga0466968_0278836 3300044735 Bacteria 799
359 Ga0466970_0030634 3300044765 Bacteria 2838
360 Ga0466970_0212093 3300044765 Bacteria 1079
361 Ga0466957_0069205 3300044842 Bacteria 2180
362 Ga0466957_0203486 3300044842 Bacteria 1301
363 Ga0466957_0212026 3300044842 Bacteria 1276
364 Ga0466957_0482352 3300044842 Bacteria 858
365 Ga0466960_0000011 3300044901 Bacteria 60167
366 Ga0466960_0025574 3300044901 Bacteria 2672
367 Ga0466960_0046248 3300044901 Bacteria 2083
368 Ga0466960_0086203 3300044901 Bacteria 1592
369 Ga0466960_0097603 3300044901 Bacteria 1508
370 Ga0466960_0106723 3300044901 Bacteria 1449
371 Ga0466960_0218194 3300044901 Bacteria 1048
372 Ga0466960_0229921 3300044901 Bacteria 1023
373 Ga0466959_0003999 3300045049 Bacteria 9796
374 Ga0466959_0017231 3300045049 Bacteria 5291
375 Ga0466959_0036104 3300045049 Bacteria 3652
376 Ga0466959_0053727 3300045049 Bacteria 2944
377 Ga0466959_0119714 3300045049 Bacteria 1873
378 Ga0466959_0199688 3300045049 Bacteria 1393
379 Ga0466959_0316413 3300045049 Bacteria 1067
380 Ga0466958_0003252 3300045836 Bacteria 8392
381 Ga0466958_0021402 3300045836 Bacteria 3779
382 Ga0466958_0026156 3300045836 Bacteria 3447
383 Ga0466958_0035334 3300045836 Bacteria 2985
384 Ga0466958_0124534 3300045836 Bacteria 1615
385 Ga0466958_0525869 3300045836 Bacteria 768
386 Ga0466967_0003189 3300045976 Bacteria 10582
387 Ga0466967_0005224 3300045976 Bacteria 8945
388 Ga0466967_0012155 3300045976 Bacteria 6568
389 Ga0466967_0017966 3300045976 Bacteria 5637
390 Ga0466967_0239101 3300045976 Bacteria 1732
391 Ga0466967_0243574 3300045976 Bacteria 1716
392 Ga0466967_0287731 3300045976 Bacteria 1578
393 Ga0466967_0317949 3300045976 Bacteria 1501
394 Ga0466967_0861214 3300045976 Bacteria 901
395 Ga0466967_0905856 3300045976 Bacteria 877
396 Ga0466967_0994684 3300045976 Bacteria 835
397 Ga0466967_2231461 3300045976 Bacteria 543
398 Ga0466967_2508799 3300045976 Bacteria 510
399 Ga0495592_0556802 3300046454 Bacteria 704
400 Ga0495629_0178285 3300046459 Bacteria 1473
401 Ga0495641_0025521 3300046461 Bacteria 2901
402 Ga0495653_0000673 3300046463 Bacteria 26112
403 Ga0495664_0000011 3300046477 Bacteria 253351
404 Ga0495664_0930923 3300046477 Bacteria 507
405 Ga0495596_0208237 3300046500 Bacteria 760
406 Ga0495596_0383927 3300046500 Bacteria 547
407 Ga0495583_0153583 3300046506 Bacteria 953
408 Ga0495618_0000033 3300046514 Bacteria 104345
409 Ga0495630_0002094 3300046517 Bacteria 13874
410 Ga0495642_0536237 3300046528 Bacteria 519
411 Ga0495652_1147469 3300046529 Bacteria 503
412 Ga0495645_0000098 3300046543 Bacteria 59944
413 Ga0495645_0000204 3300046543 Bacteria 42318
414 Ga0495634_0384183 3300046642 Bacteria 836
415 Ga0495635_0511835 3300046663 Bacteria 789
416 Ga0495657_0000069 3300046675 Bacteria 92455
417 Ga0495599_0755586 3300046678 Bacteria 558
418 Ga0495658_0094569 3300046683 Bacteria 1775
419 Ga0495589_0293070 3300046794 Bacteria 755
420 Ga0495581_0321056 3300047315 Bacteria 905
421 Ga0495676_0062729 3300047321 Bacteria 2900
422 Ga0495680_0075482 3300047322 Bacteria 2558
423 Ga0495675_0619528 3300047444 Bacteria 612
424 Ga0495684_0038132 3300047471 Bacteria 3685
425 Ga0495593_0382996 3300047673 Bacteria 703
426 Ga0495615_0133945 3300048090 Bacteria 727
427 Ga0496100_0388544 3300048903 Bacteria 1061
428 Ga0496100_0481391 3300048903 Bacteria 955
429 Ga0496100_1578121 3300048903 Bacteria 519
430 Ga0496101_0534396 3300048904 Bacteria 927
431 Ga0496102_0000148 3300048905 Bacteria 95925
432 Ga0496102_0399135 3300048905 Bacteria 1293
433 Ga0496102_0816204 3300048905 Bacteria 855
434 Ga0496102_1230173 3300048905 Bacteria 668
435 Ga0496102_1717293 3300048905 Bacteria 545
436 Ga0496103_0000141 3300048906 Bacteria 75035
437 Ga0496104_0000028 3300048907 Bacteria 203377
438 Ga0496104_0057202 3300048907 Bacteria 3690
439 Ga0496104_0305292 3300048907 Bacteria 1504
440 Ga0496104_0828857 3300048907 Unclassified 831
441 Ga0496104_1091823 3300048907 Bacteria 701
442 Ga0496105_0004110 3300048908 Bacteria 10910
443 Ga0496105_0164766 3300048908 Bacteria 1819
444 Ga0496105_0942817 3300048908 Bacteria 648
445 Ga0496106_0717585 3300048909 Bacteria 796
446 Ga0496106_1530377 3300048909 Bacteria 512
447 Ga0496107_0062859 3300048910 Bacteria 2690
448 Ga0496107_0132032 3300048910 Bacteria 1844
449 Ga0496107_0382032 3300048910 Bacteria 1048
450 Ga0496108_1236942 3300048911 Bacteria 630
451 Ga0496109_0016444 3300048912 Bacteria 6468
452 Ga0496109_0132245 3300048912 Bacteria 2329
453 Ga0496109_0155701 3300048912 Bacteria 2140
454 Ga0496109_0211047 3300048912 Bacteria 1826
455 Ga0496109_0350503 3300048912 Bacteria 1395
456 Ga0496109_0602640 3300048912 Bacteria 1035
457 Ga0496109_1236530 3300048912 Bacteria 683
458 Ga0496109_1309498 3300048912 Bacteria 660
459 Ga0496109_2058003 3300048912 Bacteria 503
460 Ga0496110_0002053 3300048913 Bacteria 15007
461 Ga0496110_0188863 3300048913 Bacteria 1871
462 Ga0496110_0739230 3300048913 Bacteria 887
463 Ga0496110_0846922 3300048913 Bacteria 820
464 Ga0496110_1736657 3300048913 Bacteria 534
465 Ga0496111_0000187 3300048914 Bacteria 28438
466 Ga0496111_0178502 3300048914 Bacteria 1578
467 Ga0496111_0565115 3300048914 Bacteria 834
468 Ga0496112_0003494 3300048915 Bacteria 13018
469 Ga0496112_0087343 3300048915 Bacteria 3085
470 Ga0496112_0190755 3300048915 Bacteria 2011
471 Ga0496112_0320785 3300048915 Bacteria 1493
472 Ga0496112_1491255 3300048915 Unclassified 590
473 Ga0496113_0011814 3300048916 Bacteria 5849
474 Ga0496113_0050928 3300048916 Bacteria 3089
475 Ga0496113_0259234 3300048916 Bacteria 1389
476 Ga0496113_0392776 3300048916 Bacteria 1114
477 Ga0496113_0442497 3300048916 Bacteria 1044
478 Ga0496113_0652639 3300048916 Bacteria 841
479 Ga0496114_0130969 3300048917 Bacteria 2166
480 Ga0496115_0650592 3300048918 Bacteria 833
481 Ga0496119_0339557 3300048922 Bacteria 730
482 Ga0496121_0021265 3300048924 Bacteria 6366
483 Ga0496122_0616068 3300048925 Bacteria 505
484 Ga0496124_0277445 3300048927 Bacteria 1224
485 Ga0501034_0023077 3300049571 Bacteria 6340
486 nmdc:mga08y16_1331651_c1 3300050511 Bacteria 684
487 Ga0495601_0002913 3300053077 Bacteria 9737
488 Ga0495612_0000153 3300053078 Bacteria 28809
489 Ga0495655_0091810 3300053083 Bacteria 886
490 Ga0495595_0306285 3300053084 Bacteria 799
491 Ga0495619_0244370 3300053085 Bacteria 1244
492 Ga0500568_0226920 3300053139 Bacteria 682
493 Ga0500616_0011049 3300053153 Bacteria 5369
494 Ga0500599_016025 3300053736 Bacteria 1032
495 Ga0590077_109188 3300059426 Bacteria 650
496 Ga0466962_0020519 3300061719 Bacteria 3175
497 Ga0466962_0433779 3300061719 Bacteria 660
498 Ga0466962_0673701 3300061719 Bacteria 530
499 Ga0466962_0714209 3300061719 Bacteria 514
500 Ga0501047_0070151
501 Ga0070658_10298695
502 Ga0070683_100111278
503 Ga0070683_100123430
504 Ga0070683_100147433
505 Ga0070683_100272331
506 Ga0070683_100740406
507 Ga0070680_101504531
508 Ga0070682_100372861
509 Ga0070682_101482531
510 Ga0068868_100067985
511 Ga0068868_100269035
512 Ga0070660_100967267
513 Ga0070689_100349925
514 Ga0070691_10175397
515 Ga0070687_100081631
516 Ga0070661_100273087
517 Ga0070661_101226935
518 Ga0070692_10539929
519 Ga0070668_100693360
520 Ga0070674_100783580
521 Ga0070674_101151093
522 Ga0070688_101094394
523 Ga0070659_100000043
524 Ga0070714_100000745
525 Ga0070714_100009040
526 Ga0070714_100095526
527 Ga0070714_100484495
528 Ga0070714_100705061
529 Ga0070714_100855565
530 Ga0070713_100015622
531 Ga0070713_100280785
532 Ga0070713_101152542
533 Ga0070710_10000003
534 Ga0070710_10277698
535 Ga0070711_100015599
536 Ga0070705_100000625
537 Ga0070700_100265095
538 Ga0070700_100673100
539 Ga0070663_100275549
540 Ga0070663_101721096
541 Ga0070678_101561673
542 Ga0070662_100213092
543 Ga0068867_100266330
544 Ga0068867_100440461
545 Ga0070685_10480081
546 Ga0070707_100253989
547 Ga0070684_100144934
548 Ga0070684_101152739
549 Ga0068853_100402213
550 Ga0068853_101150644
551 Ga0070696_100557723
552 Ga0070693_100059351
553 Ga0070664_100083668
554 Ga0070664_100135073
555 Ga0070664_100525236
556 Ga0070664_100800942
557 Ga0068854_100148945
558 Ga0070702_100080056
559 Ga0070702_100315043
560 Ga0068852_100158016
561 Ga0068864_100185626
562 Ga0068866_10170338
563 Ga0068861_100840726
564 Ga0068861_101017277
565 Ga0068870_10157666
566 Ga0068870_10881411
567 Ga0068863_100983993
568 Ga0068863_102046305
569 Ga0068858_100822193
570 Ga0068858_101317668
571 Ga0081455_10091095
572 Ga0081540_1118066
573 Ga0081539_10274320
574 Ga0070717_10022385
575 Ga0070717_10059896
576 Ga0070717_10804737
577 Ga0070712_100191260
578 Ga0070712_101200915
579 Ga0068871_102282229
580 Ga0075428_101194334
581 Ga0075433_10091267
582 Ga0068865_100055698
583 Ga0068865_100101640
584 Ga0068865_100994933
585 Ga0097620_101093541
586 Ga0105240_10134768
587 Ga0105240_11431006
588 Ga0111539_11458047
589 Ga0111539_11758754
590 Ga0105245_10338397
591 Ga0105245_10917095
592 Ga0105245_11090811
593 Ga0105245_12044935
594 Ga0114129_12386066
595 Ga0105243_10143782
596 Ga0105243_10188122
597 Ga0105243_10410209
598 Ga0105243_10580055
599 Ga0105243_12416889
600 Ga0105241_10852770
601 Ga0105241_11030347
602 Ga0105242_11435859
603 Ga0105242_11595673
604 Ga0105242_11892706
605 Ga0105248_12379425
606 Ga0105237_10000495
607 Ga0105238_10575693
608 Ga0105238_10729885
609 Ga0105249_11235175
610 Ga0105239_10084576
611 Ga0105239_10261611
612 Ga0105239_10436818
613 Ga0105239_11179197
614 Ga0105239_13465024
615 Ga0105246_10059520
616 Ga0105246_10097914
617 Ga0105246_10223759
618 Ga0105246_10964796
619 Ga0105246_11101827
620 Ga0157373_11003126
621 Ga0157371_10677097
622 Ga0157371_10797636
623 Ga0157374_11294181
624 Ga0157378_11600043
625 Ga0163162_10710771
626 Ga0157372_10258134
627 Ga0157372_10533365
628 Ga0157375_10282983
629 Ga0157375_12501180
630 Ga0163163_10213057
631 Ga0163163_11282920
632 Ga0163163_11789725
633 Ga0163163_13074799
634 Ga0157380_10893938
635 Ga0157380_11274923
636 Ga0157380_11428924
637 Ga0157380_11825092
638 Ga0157377_10015658
639 Ga0157377_10115422
640 Ga0157377_10812071
641 Ga0157377_10923304
642 Ga0157379_10149260
643 Ga0157379_10301028
644 Ga0157379_12096784
645 Ga0157376_10247044
646 Ga0206356_10592591
647 Ga0206353_10298795
648 Ga0206353_11399968
649 Ga0213874_10314901
650 Ga0213875_10000351
651 Ga0207692_10000016
652 Ga0207692_10483765
653 Ga0207642_10083461
654 Ga0207642_10227181
655 Ga0207688_10031334
656 Ga0207688_10059605
657 Ga0207705_10634525
658 Ga0207654_10370863
659 Ga0207654_10638432
660 Ga0207695_10171946
661 Ga0207695_10943864
662 Ga0207671_10004500
663 Ga0207693_10185390
664 Ga0207693_10193049
665 Ga0207693_10856704
666 Ga0207663_10053581
667 Ga0207663_10191297
668 Ga0207663_10834551
669 Ga0207663_11411659
670 Ga0207662_10051641
671 Ga0207657_10821781
672 Ga0207652_10985098
673 Ga0207646_10257522
674 Ga0207650_10530731
675 Ga0207650_10836360
676 Ga0207687_10063232
677 Ga0207687_10311513
678 Ga0207687_11476629
679 Ga0207687_11833685
680 Ga0207700_10243106
681 Ga0207700_10704042
682 Ga0207664_10000004
683 Ga0207664_10003392
684 Ga0207664_10186494
685 Ga0207664_10308289
686 Ga0207664_10410134
687 Ga0207664_10761381
688 Ga0207664_11471826
689 Ga0207690_10000095
690 Ga0207690_10513241
691 Ga0207690_10890412
692 Ga0207686_10510017
693 Ga0207709_10160385
694 Ga0207670_10331869
695 Ga0207669_10319531
696 Ga0207704_10748996
697 Ga0207691_10330466
698 Ga0207689_10191674
699 Ga0207689_10690571
700 Ga0207661_10173313
701 Ga0207661_10361887
702 Ga0207661_10630091
703 Ga0207679_10056239
704 Ga0207679_10172565
705 Ga0207679_10279558
706 Ga0207679_10745866
707 Ga0207679_10929875
708 Ga0207679_11065689
709 Ga0207712_10339714
710 Ga0207712_10856915
711 Ga0207712_10979562
712 Ga0207712_11791558
713 Ga0207668_11314360
714 Ga0207640_10145994
715 Ga0207677_10252380
716 Ga0207677_10904750
717 Ga0207678_10405451
718 Ga0207678_10544546
719 Ga0207678_10626158
720 Ga0207678_11862490
721 Ga0207708_10105337
722 Ga0207708_10357158
723 Ga0207702_10375849
724 Ga0207648_10174672
725 Ga0207676_10080854
726 Ga0207674_10261710
727 Ga0207675_100046287
728 Ga0207675_100764600
729 Ga0207698_10273434
730 Ga0207698_10581659
731 Ga0207698_10703065
732 Ga0268266_10664038
733 Ga0268265_10714038
734 Ga0268264_12084245
735 Ga0265337_1003227
736 Ga0265326_10000006
737 Ga0265326_10000595
738 Ga0265319_1000280
739 Ga0265319_1000861
740 Ga0265334_10000016
741 Ga0265334_10104145
742 Ga0265334_10289420
743 Ga0265318_10001633
744 Ga0265318_10028777
745 Ga0265318_10152598
746 Ga0265322_10056684
747 Ga0265336_10000002
748 Ga0265338_10000001
749 Ga0265338_10000961
750 Ga0265338_10041316
751 Ga0265338_10268014
752 Ga0265324_10005485
753 Ga0265324_10011445
754 Ga0265329_10238674
755 Ga0265340_10000001
756 Ga0265327_10006873
757 Ga0265327_10064640
758 Ga0265327_10267476
759 Ga0265327_10313836
760 Ga0307408_100275710
761 Ga0307408_101183247
762 Ga0265342_10028369
763 Ga0307405_10298651
764 Ga0307405_10750135
765 Ga0307413_10082801
766 Ga0307410_10011564
767 Ga0307410_10696953
768 Ga0307410_10856625
769 Ga0307410_11738381
770 Ga0307406_11756972
771 Ga0307407_10100014
772 Ga0307407_10136994
773 Ga0307407_10481828
774 Ga0307412_10014682
775 Ga0307412_10939587
776 Ga0307412_11229741
777 Ga0307409_100011701
778 Ga0307409_100045835
779 Ga0307409_100333271
780 Ga0307409_100559978
781 Ga0307409_100649025
782 Ga0307409_101135589
783 Ga0307416_100075257
784 Ga0307416_100555605
785 Ga0307416_100693288
786 Ga0307416_100820044
787 Ga0307414_10226330
788 Ga0307414_11079785
789 Ga0307411_10098453
790 Ga0307411_10670883
791 Ga0307411_10724538
792 Ga0307415_100075017
793 Ga0307415_100173949
794 Ga0307415_100199800
795 Ga0307415_100292250
796 Ga0307415_100509911
797 Ga0307415_100850741
798 Ga0307415_101634077
799 Ga0373947_0304578
800 Ga0373937_1909528
801 Ga0395900_0199598
802 Ga0395900_0736355
803 Ga0395898_0138078
804 Ga0395898_0199232
805 Ga0395898_0487944
806 Ga0395898_0828610
807 Ga0395905_0528005
808 Ga0395905_0852058
809 Ga0395905_0985155
810 Ga0436364_1134712
811 Ga0436364_1229417
812 Ga0436364_1426665
813 Ga0395901_0050708
814 Ga0395901_0058545
815 Ga0395901_0267175
816 Ga0395901_0347317
817 Ga0436363_1036979
818 Ga0436363_1430072
819 Ga0451789_0107835
820 Ga0451800_0787809
821 Ga0451802_1573351
822 Ga0451833_1279285
823 Ga0451839_0958179
824 Ga0451855_0419185
825 Ga0451853_2165100
826 Ga0451853_2596443
827 Ga0451853_3357721
828 Ga0466969_0026716
829 Ga0466969_0037959
830 Ga0466972_0116653
831 Ga0466965_0006216
832 Ga0466965_0252784
833 Ga0466966_0060967
834 Ga0466966_0100011
835 Ga0466966_0105890
836 Ga0466961_0006650
837 Ga0466961_0047106
838 Ga0466961_0159571
839 Ga0466961_0171349
840 Ga0466961_0689112
841 Ga0466961_0832683
842 Ga0466961_0898195
843 Ga0466963_0000696
844 Ga0466963_0031412
845 Ga0466963_0158294
846 Ga0466963_0362053
847 Ga0466963_0571870
848 Ga0466963_0578486
849 Ga0466964_0114908
850 Ga0466964_0212705
851 Ga0466971_0041940
852 Ga0466971_0051952
853 Ga0466968_0103183
854 Ga0466968_0134309
855 Ga0466968_0207025
856 Ga0466968_0270305
857 Ga0466968_0278836
858 Ga0466970_0030634
859 Ga0466970_0212093
860 Ga0466957_0069205
861 Ga0466957_0203486
862 Ga0466957_0212026
863 Ga0466957_0482352
864 Ga0466960_0000011
865 Ga0466960_0025574
866 Ga0466960_0046248
867 Ga0466960_0086203
868 Ga0466960_0097603
869 Ga0466960_0106723
870 Ga0466960_0218194
871 Ga0466960_0229921
872 Ga0466959_0003999
873 Ga0466959_0017231
874 Ga0466959_0036104
875 Ga0466959_0053727
876 Ga0466959_0119714
877 Ga0466959_0199688
878 Ga0466959_0316413
879 Ga0466958_0003252
880 Ga0466958_0021402
881 Ga0466958_0026156
882 Ga0466958_0035334
883 Ga0466958_0124534
884 Ga0466958_0525869
885 Ga0466967_0003189
886 Ga0466967_0005224
887 Ga0466967_0012155
888 Ga0466967_0017966
889 Ga0466967_0239101
890 Ga0466967_0243574
891 Ga0466967_0287731
892 Ga0466967_0317949
893 Ga0466967_0861214
894 Ga0466967_0905856
895 Ga0466967_0994684
896 Ga0466967_2231461
897 Ga0466967_2508799
898 Ga0495592_0556802
899 Ga0495629_0178285
900 Ga0495641_0025521
901 Ga0495653_0000673
902 Ga0495664_0000011
903 Ga0495664_0930923
904 Ga0495596_0208237
905 Ga0495596_0383927
906 Ga0495583_0153583
907 Ga0495618_0000033
908 Ga0495630_0002094
909 Ga0495642_0536237
910 Ga0495652_1147469
911 Ga0495645_0000098
912 Ga0495645_0000204
913 Ga0495634_0384183
914 Ga0495635_0511835
915 Ga0495657_0000069
916 Ga0495599_0755586
917 Ga0495658_0094569
918 Ga0495589_0293070
919 Ga0495581_0321056
920 Ga0495676_0062729
921 Ga0495680_0075482
922 Ga0495675_0619528
923 Ga0495684_0038132
924 Ga0495593_0382996
925 Ga0495615_0133945
926 Ga0496100_0388544
927 Ga0496100_0481391
928 Ga0496100_1578121
929 Ga0496101_0534396
930 Ga0496102_0000148
931 Ga0496102_0399135
932 Ga0496102_0816204
933 Ga0496102_1230173
934 Ga0496102_1717293
935 Ga0496103_0000141
936 Ga0496104_0000028
937 Ga0496104_0057202
938 Ga0496104_0305292
939 Ga0496104_0828857
940 Ga0496104_1091823
941 Ga0496105_0004110
942 Ga0496105_0164766
943 Ga0496105_0942817
944 Ga0496106_0717585
945 Ga0496106_1530377
946 Ga0496107_0062859
947 Ga0496107_0132032
948 Ga0496107_0382032
949 Ga0496108_1236942
950 Ga0496109_0016444
951 Ga0496109_0132245
952 Ga0496109_0155701
953 Ga0496109_0211047
954 Ga0496109_0350503
955 Ga0496109_0602640
956 Ga0496109_1236530
957 Ga0496109_1309498
958 Ga0496109_2058003
959 Ga0496110_0002053
960 Ga0496110_0188863
961 Ga0496110_0739230
962 Ga0496110_0846922
963 Ga0496110_1736657
964 Ga0496111_0000187
965 Ga0496111_0178502
966 Ga0496111_0565115
967 Ga0496112_0003494
968 Ga0496112_0087343
969 Ga0496112_0190755
970 Ga0496112_0320785
971 Ga0496112_1491255
972 Ga0496113_0011814
973 Ga0496113_0050928
974 Ga0496113_0259234
975 Ga0496113_0392776
976 Ga0496113_0442497
977 Ga0496113_0652639
978 Ga0496114_0130969
979 Ga0496115_0650592
980 Ga0496119_0339557
981 Ga0496121_0021265
982 Ga0496122_0616068
983 Ga0496124_0277445
984 Ga0501034_0023077
985 nmdc:mga08y16_1331651_c1
986 Ga0495601_0002913
987 Ga0495612_0000153
988 Ga0495655_0091810
989 Ga0495595_0306285
990 Ga0495619_0244370
991 Ga0500568_0226920
992 Ga0500616_0011049
993 Ga0500599_016025
994 Ga0590077_109188
995 Ga0466962_0020519
996 Ga0466962_0433779
997 Ga0466962_0673701
998 Ga0466962_0714209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

4

115

0.88

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

40

125

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd7-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase from mycobacterium avium 0.801 46 116
6rwf-assembly1.cif.gz_A the dissociation mechanism of processive cellulases 0.7996 80 106
4d5i-assembly1.cif.gz_A hypocrea jecorina cellobiohydrolase cel7a e212q soaked with xylotriose. 0.768 80 107
4d5j-assembly1.cif.gz_A hypocrea jecorina cellobiohydrolase cel7a e217q soaked with xylotriose. 0.7676 80 107
4d5q-assembly1.cif.gz_A-2 hypocrea jecorina cel7a (wild type) soaked with xylopentaose. 0.7635 80 107
ID Description Score Start End Superfamily
af_A0A1D8PM62_527_608_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8439 81 106 3.30.160.20
3rd7B00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.7956 46 116 2.40.160.210
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7516 45 112 3.10.129.10
af_F8W5J5_47_242_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7488 45 114 3.10.129.10
af_Q19058_11_287_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7483 5 114 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7J9Y8B7-F1-model_v4 Dehydratase 0.9365 62 114
AF-A0A2N5X984-F1-model_v4 Enoyl-CoA hydratase 0.9262 62 114
AF-A0A1G8SK17-F1-model_v4 A-factor biosynthesis hotdog domain-containing protein 0.8812 69 115
AF-A0A3M1NU41-F1-model_v4 Acyl-ACP thioesterase 0.8768 66 114 GO:0000036
GO:0016297
AF-A0A1G7CRP7-F1-model_v4 Acyl-ACP thioesterase 0.8755 69 113 GO:0000036
GO:0016297

Map