F455451

General Info

Members Datasets Scaffolds Average Seq Length
499 253 998 99

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000108|Ga0500616_0000108_109988_110344
Length 118
Sequence MGAVETAPINIPGWEGEREMKPDMFRQPVSILVGLGFPAEVRGVMDAYRHLVEWPASLRDAAHSVALKACTAALRGEIEAETARGLFAAFAEKHDLLAPEANVVAAWRLRRDKDPHVR

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
45 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
88 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
95 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
96 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
99 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
100 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
163 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
172 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
178 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
179 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
180 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
181 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
182 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
183 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
184 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
185 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
186 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
187 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
188 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
189 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
190 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
191 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
192 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
193 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
194 2643221599 Rhizobium sp. Root708 Isolate Unclassified
195 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
196 2643221655 Ensifer sp. Root1252 Isolate Unclassified
197 2643221659 Ensifer sp. Root127 Isolate Unclassified
198 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
199 2643221698 Ensifer sp. Root142 Isolate Unclassified
200 2643221712 Ensifer sp. Root258 Isolate Unclassified
201 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
202 2718217927 Rhizobium sp. N324 Isolate Nodule
203 2738541293 Rhizobium sp. GV031 Isolate Unclassified
204 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
205 2791355261 Rhizobium sp. J15 Isolate Nodule
206 2791355262 Rhizobium sp. M1 Isolate Nodule
207 2791355263 Rhizobium chutanense C5 Isolate Nodule
208 2791355264 Rhizobium sp. S9 Isolate Nodule
209 2791355267 Rhizobium sp. L18 Isolate Nodule
210 2802429633 Rhizobium anhuiense J3 Isolate Nodule
211 2802429634 Rhizobium anhuiense S10 Isolate Nodule
212 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
213 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
214 2802429637 Rhizobium anhuiense C15 Isolate Nodule
215 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
216 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
217 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
218 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
219 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
220 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
221 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
222 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
223 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
224 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
225 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
226 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
227 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
228 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
229 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
230 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
231 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
232 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
233 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
234 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
235 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
236 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
237 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
238 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
239 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
240 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
241 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
242 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
243 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
244 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
245 8005258706 Rhizobium sp. R693 Isolate Nodule
246 8005275841 Rhizobium sp. N4311 Isolate Nodule
247 8005382845 Rhizobium sp. R634 Isolate Nodule
248 8005395548 Rhizobium sp. R339 Isolate Nodule
249 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
250 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
251 8018176218 Rhizobium sp. N122 Isolate Nodule
252 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
253 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.76
Metatranscriptomes 2
Isolates 17.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 33.07
Nodule 10.62
Rhizoplane 2.81
Rhizosphere 27.86
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000108 3300053153 Bacteria 152917
2 JGI24740J21852_10012234 3300001979 Bacteria 3240
3 JGI25162J39368_1000201 3300002737 Bacteria 62939
4 JGI25162J39368_1001343 3300002737 Bacteria 13652
5 JGI25162J39368_1002349 3300002737 Bacteria 7510
6 JGI25152J39213_1000020 3300002773 Bacteria 107721
7 JGI25152J39213_1000104 3300002773 Bacteria 59331
8 JGI25152J39213_1000969 3300002773 Bacteria 13988
9 JGI25152J39213_1008374 3300002773 Bacteria 2572
10 JGI25152J39213_1028430 3300002773 Bacteria 889
11 JGI25150J39212_1000078 3300002774 Bacteria 58894
12 JGI25150J39212_1015973 3300002774 Bacteria 1240
13 JGI25159J45721_1000069 3300002987 Bacteria 49124
14 JGI25151J46595_10000098 3300003187 Bacteria 117930
15 JGI25151J46595_10000885 3300003187 Bacteria 23587
16 JGI25151J46595_10002384 3300003187 Bacteria 11394
17 JGI25151J46595_10091255 3300003187 Bacteria 847
18 JGI25165J46597_1000274 3300003214 Bacteria 66514
19 JGI25165J46597_1000950 3300003214 Bacteria 19828
20 JGI25165J46597_1001436 3300003214 Bacteria 12700
21 JGI25153J46596_10000122 3300003215 Bacteria 87427
22 JGI25153J46596_10000488 3300003215 Bacteria 25408
23 JGI25153J46596_10002889 3300003215 Bacteria 9747
24 rootH1_10061658 3300003316 Bacteria 1774
25 rootL2_10048347 3300003322 Bacteria 1437
26 rootL2_10313730 3300003322 Bacteria 1607
27 rootH1_10043017 3300003323 Bacteria 3608
28 rootH1_10103914 3300003323 Bacteria 4014
29 rootH1_10327101 3300003323 Bacteria 1388
30 JGI25160J50197_1000089 3300003354 Bacteria 92500
31 JGI25161J50226_1000100 3300003374 Bacteria 70160
32 Ga0055526_1000075 3300003771 Bacteria 92533
33 Ga0055526_1017620 3300003771 Bacteria 2718
34 Ga0055526_1030014 3300003771 Bacteria 1597
35 Ga0055526_1045125 3300003771 Bacteria 1057
36 Ga0055524_1002926 3300003775 Bacteria 8521
37 Ga0055524_1008153 3300003775 Bacteria 4378
38 Ga0055524_1015103 3300003775 Bacteria 2830
39 Ga0055524_1029128 3300003775 Bacteria 1639
40 Ga0055536_1000240 3300003781 Bacteria 43954
41 Ga0055528_1002319 3300003790 Bacteria 10316
42 Ga0055528_1002697 3300003790 Bacteria 9352
43 Ga0055528_1008025 3300003790 Bacteria 4586
44 Ga0055528_1019986 3300003790 Bacteria 2192
45 Ga0055528_1021572 3300003790 Bacteria 2038
46 Ga0055530_10012811 3300003791 Bacteria 2902
47 Ga0055530_10026042 3300003791 Bacteria 1623
48 Ga0055530_10052649 3300003791 Bacteria 938
49 Ga0055540_1000216 3300003792 Bacteria 54402
50 Ga0055540_1001244 3300003792 Bacteria 15647
51 Ga0055540_1005524 3300003792 Bacteria 5287
52 Ga0055540_1013438 3300003792 Bacteria 2500
53 Ga0055531_10005643 3300003794 Bacteria 7275
54 Ga0058692_1011029 3300003856 Bacteria 2205
55 Ga0058692_1056750 3300003856 Bacteria 630
56 Ga0055543_1000173 3300004625 Bacteria 54241
57 Ga0065165_1000291 3300005262 Bacteria 85135
58 Ga0065165_1007625 3300005262 Bacteria 5266
59 Ga0065165_1011782 3300005262 Bacteria 3606
60 Ga0065165_1016305 3300005262 Bacteria 2788
61 Ga0070669_100500565 3300005353 Bacteria 1008
62 Ga0070675_101745995 3300005354 Bacteria 574
63 Ga0070663_100627908 3300005455 Bacteria 906
64 Ga0068853_100948252 3300005539 Bacteria 827
65 Ga0068853_101599805 3300005539 Bacteria 631
66 Ga0070665_100016367 3300005548 Bacteria 7437
67 Ga0070665_101053283 3300005548 Bacteria 825
68 Ga0068854_100969085 3300005578 Bacteria 751
69 Ga0068856_100238293 3300005614 Bacteria 1835
70 Ga0068852_100477849 3300005616 Bacteria 1238
71 Ga0075364_10122843 3300006051 Bacteria 1739
72 Ga0075364_10618957 3300006051 Bacteria 740
73 Ga0075364_10834140 3300006051 Bacteria 628
74 Ga0075367_10097885 3300006178 Bacteria 1790
75 Ga0075367_10325914 3300006178 Bacteria 968
76 Ga0075367_10876844 3300006178 Bacteria 572
77 Ga0075366_10500566 3300006195 Bacteria 751
78 Ga0075366_10587906 3300006195 Bacteria 690
79 Ga0075370_10033692 3300006353 Bacteria 2868
80 Ga0075370_10246074 3300006353 Bacteria 1059
81 Ga0075370_10338853 3300006353 Bacteria 897
82 Ga0075370_10787021 3300006353 Bacteria 580
83 Ga0099826_10000038 3300006948 Bacteria 101106
84 Ga0099826_10000081 3300006948 Bacteria 48659
85 Ga0105251_10367531 3300009011 Bacteria 658
86 Ga0105244_10294356 3300009036 Bacteria 752
87 Ga0105244_10445314 3300009036 Bacteria 596
88 Ga0105250_10411731 3300009092 Bacteria 601
89 Ga0105243_10257235 3300009148 Bacteria 1562
90 Ga0105237_10000038 3300009545 Bacteria 190707
91 Ga0105249_12276363 3300009553 Bacteria 615
92 Ga0105249_13029140 3300009553 Bacteria 540
93 Ga0123341_1000008 3300009765 Bacteria 134834
94 Ga0123341_1000010 3300009765 Bacteria 118450
95 Ga0123341_1000046 3300009765 Bacteria 52317
96 Ga0123342_1020909 3300009766 Bacteria 4690
97 Ga0123342_1022276 3300009766 Bacteria 4313
98 Ga0105239_10002418 3300010375 Bacteria 23771
99 Ga0105239_10309815 3300010375 Bacteria 1779
100 Ga0105246_10864019 3300011119 Bacteria 808
101 Ga0157373_10006195 3300013100 Bacteria 8939
102 Ga0157370_10000054 3300013104 Bacteria 118718
103 Ga0157370_11045678 3300013104 Bacteria 738
104 Ga0163162_11196105 3300013306 Bacteria 862
105 Ga0182008_10348090 3300014497 Bacteria 785
106 Ga0157379_10867902 3300014968 Bacteria 855
107 Ga0206349_1787742 3300020075 Bacteria 1219
108 Ga0206351_10509986 3300020077 Bacteria 945
109 Ga0224712_10046814 3300022467 Bacteria 1662
110 Ga0224712_10108175 3300022467 Bacteria 1189
111 Ga0224712_10175889 3300022467 Bacteria 962
112 Ga0209436_100010 3300025208 Bacteria 139804
113 Ga0209437_100023 3300025233 Bacteria 614195
114 Ga0209437_100203 3300025233 Bacteria 117490
115 Ga0209437_100614 3300025233 Bacteria 21837
116 Ga0207425_1000061 3300025245 Bacteria 138680
117 Ga0207425_1000185 3300025245 Bacteria 50928
118 Ga0207425_1004240 3300025245 Bacteria 4353
119 Ga0207425_1083298 3300025245 Bacteria 531
120 Ga0209129_1000070 3300025258 Bacteria 212476
121 Ga0209129_1000134 3300025258 Bacteria 125870
122 Ga0209129_1000155 3300025258 Bacteria 108020
123 Ga0209129_1000375 3300025258 Bacteria 36282
124 Ga0209129_1000485 3300025258 Bacteria 29021
125 Ga0209233_1000127 3300025261 Bacteria 213026
126 Ga0209233_1000205 3300025261 Bacteria 118120
127 Ga0209233_1000562 3300025261 Bacteria 19864
128 Ga0209673_1000092 3300025273 Bacteria 201615
129 Ga0209673_1000161 3300025273 Bacteria 142073
130 Ga0209673_1000165 3300025273 Bacteria 138061
131 Ga0209673_1000202 3300025273 Bacteria 119738
132 Ga0209673_1003235 3300025273 Bacteria 9849
133 Ga0209673_1007696 3300025273 Bacteria 4910
134 Ga0209673_1028408 3300025273 Bacteria 1801
135 Ga0209673_1030791 3300025273 Bacteria 1683
136 Ga0209673_1043240 3300025273 Bacteria 1260
137 Ga0209673_1079298 3300025273 Bacteria 757
138 Ga0209130_1000101 3300025284 Bacteria 139814
139 Ga0209130_1004056 3300025284 Bacteria 5796
140 Ga0209676_1001184 3300025292 Bacteria 28052
141 Ga0209676_1017204 3300025292 Bacteria 2570
142 Ga0209025_1000175 3300025294 Bacteria 158379
143 Ga0209025_1000254 3300025294 Bacteria 125870
144 Ga0209025_1000496 3300025294 Bacteria 75601
145 Ga0209025_1001740 3300025294 Bacteria 26162
146 Ga0209025_1006465 3300025294 Bacteria 9083
147 Ga0209025_1006848 3300025294 Bacteria 8697
148 Ga0209025_1010591 3300025294 Bacteria 6226
149 Ga0209564_1000126 3300025295 Bacteria 201035
150 Ga0209564_1003119 3300025295 Bacteria 11701
151 Ga0209564_1003930 3300025295 Bacteria 9490
152 Ga0209564_1014909 3300025295 Bacteria 3199
153 Ga0209564_1024560 3300025295 Bacteria 2056
154 Ga0209758_1000178 3300025297 Bacteria 142096
155 Ga0209758_1000360 3300025297 Bacteria 81364
156 Ga0209758_1001574 3300025297 Bacteria 26162
157 Ga0209758_1022594 3300025297 Bacteria 2875
158 Ga0209758_1058264 3300025297 Bacteria 1293
159 Ga0209050_1001019 3300025298 Bacteria 34942
160 Ga0209050_1039667 3300025298 Bacteria 1323
161 Ga0209050_1114178 3300025298 Bacteria 514
162 Ga0209256_1000144 3300025299 Bacteria 151157
163 Ga0209256_1000761 3300025299 Bacteria 41842
164 Ga0209256_1002022 3300025299 Bacteria 18074
165 Ga0209256_1004095 3300025299 Bacteria 9448
166 Ga0209256_1011409 3300025299 Bacteria 3558
167 Ga0209256_1034381 3300025299 Bacteria 1350
168 Ga0207426_1000205 3300025302 Bacteria 141339
169 Ga0207426_1000222 3300025302 Bacteria 134756
170 Ga0207426_1000302 3300025302 Bacteria 96742
171 Ga0209051_1000032 3300025303 Bacteria 383445
172 Ga0209051_1000129 3300025303 Bacteria 141968
173 Ga0209051_1000600 3300025303 Bacteria 42450
174 Ga0209051_1001719 3300025303 Bacteria 17475
175 Ga0209051_1070399 3300025303 Bacteria 1055
176 Ga0209051_1116383 3300025303 Bacteria 686
177 Ga0209257_1000675 3300025304 Bacteria 53452
178 Ga0209257_1002769 3300025304 Bacteria 16579
179 Ga0209257_1012979 3300025304 Bacteria 3766
180 Ga0209257_1074953 3300025304 Bacteria 882
181 Ga0207655_1249480 3300025728 Bacteria 504
182 Ga0207680_11043808 3300025903 Bacteria 585
183 Ga0207647_10681602 3300025904 Bacteria 562
184 Ga0207671_10000418 3300025914 Bacteria 58941
185 Ga0207681_10228791 3300025923 Bacteria 1442
186 Ga0207650_11792851 3300025925 Bacteria 519
187 Ga0207640_10318767 3300025981 Bacteria 1237
188 Ga0207639_11238087 3300026041 Bacteria 700
189 Ga0207639_12090715 3300026041 Bacteria 527
190 Ga0207678_10199525 3300026067 Bacteria 1710
191 Ga0207702_10165853 3300026078 Bacteria 2021
192 Ga0207674_10608556 3300026116 Bacteria 1055
193 Ga0209371_1000064 3300027312 Bacteria 218637
194 Ga0209371_1023568 3300027312 Bacteria 1448
195 Ga0209282_1000093 3300027666 Bacteria 62036
196 Ga0209282_1001951 3300027666 Bacteria 11648
197 Ga0268266_10034218 3300028379 Bacteria 4321
198 Ga0268266_10392321 3300028379 Bacteria 1311
199 Ga0268256_1000028 3300030500 Bacteria 433179
200 Ga0268256_1019756 3300030500 Bacteria 1835
201 Ga0268256_1038784 3300030500 Bacteria 1081
202 Ga0314311_1016877 3300030733 Bacteria 912
203 Ga0316181_1146291 3300030744 Bacteria 5276
204 Ga0307513_10072846 3300031456 Bacteria 3579
205 Ga0307513_10729025 3300031456 Bacteria 697
206 Ga0307406_10003620 3300031901 Bacteria 8415
207 Ga0307412_10002041 3300031911 Bacteria 11210
208 Ga0307412_10054734 3300031911 Bacteria 2650
209 Ga0237819_21121 3300038705 Bacteria 670
210 Ga0439465_0007583 3300041413 Bacteria 3445
211 Ga0439465_0022863 3300041413 Bacteria 1965
212 Ga0439465_0032956 3300041413 Bacteria 1655
213 Ga0439465_0093822 3300041413 Bacteria 1030
214 Ga0451806_505774 3300041462 Bacteria 1513
215 Ga0451833_0973055 3300041491 Bacteria 1042
216 Ga0451835_0190452 3300041492 Bacteria 2225
217 Ga0451835_0417259 3300041492 Bacteria 1796
218 Ga0451835_0488717 3300041492 Bacteria 1036
219 Ga0451837_0199540 3300041494 Bacteria 2616
220 Ga0451837_0362977 3300041494 Bacteria 910
221 Ga0451839_0548082 3300041496 Bacteria 1461
222 Ga0451839_0820037 3300041496 Bacteria 1007
223 Ga0451845_0253365 3300041501 Bacteria 1028
224 Ga0451845_0454190 3300041501 Bacteria 659
225 Ga0451847_0060512 3300041503 Bacteria 7697
226 Ga0451849_0038906 3300041505 Bacteria 681
227 Ga0451849_0562189 3300041505 Bacteria 3693
228 Ga0451849_1064662 3300041505 Bacteria 1663
229 Ga0451851_0125201 3300041507 Bacteria 1403
230 Ga0451851_0798657 3300041507 Bacteria 2654
231 Ga0451843_0395337 3300041509 Bacteria 2192
232 Ga0451843_0798157 3300041509 Bacteria 2462
233 Ga0451843_1008512 3300041509 Bacteria 5342
234 Ga0451843_1457649 3300041509 Bacteria 978
235 Ga0451855_1623486 3300041511 Bacteria 1621
236 Ga0451855_1787357 3300041511 Bacteria 3409
237 Ga0451853_0749073 3300041512 Bacteria 755
238 Ga0451853_1532742 3300041512 Bacteria 1098
239 Ga0451853_2518453 3300041512 Bacteria 3015
240 Ga0450900_020531 3300042136 Bacteria 918
241 Ga0495617_131559 3300046452 Bacteria 802
242 Ga0495650_0137397 3300046471 Bacteria 887
243 Ga0495607_0282377 3300046501 Bacteria 787
244 Ga0495583_0106564 3300046506 Bacteria 1191
245 Ga0495606_0017360 3300046507 Bacteria 5443
246 Ga0495606_0052850 3300046507 Bacteria 2639
247 Ga0495606_0067012 3300046507 Bacteria 2274
248 Ga0495606_0251852 3300046507 Bacteria 979
249 Ga0495606_0533331 3300046507 Bacteria 587
250 Ga0495610_0003705 3300046512 Bacteria 11712
251 Ga0495610_0064109 3300046512 Bacteria 1738
252 Ga0495610_0136117 3300046512 Bacteria 1062
253 Ga0495616_0154265 3300046513 Bacteria 1037
254 Ga0495620_0060000 3300046515 Bacteria 1587
255 Ga0495631_0513213 3300046518 Bacteria 511
256 Ga0495632_0038291 3300046519 Bacteria 2429
257 Ga0495632_0371068 3300046519 Bacteria 627
258 Ga0495632_0439038 3300046519 Bacteria 567
259 Ga0495643_0006272 3300046522 Bacteria 7871
260 Ga0495643_0038219 3300046522 Bacteria 2629
261 Ga0495643_0046472 3300046522 Bacteria 2353
262 Ga0495643_0048565 3300046522 Bacteria 2293
263 Ga0495644_0182029 3300046523 Bacteria 808
264 Ga0495648_0096445 3300046524 Bacteria 1643
265 Ga0495654_0248829 3300046530 Bacteria 741
266 Ga0495609_0095433 3300046538 Bacteria 1291
267 Ga0495609_0388635 3300046538 Bacteria 559
268 Ga0495597_0080320 3300046542 Bacteria 1395
269 Ga0495633_0588205 3300046558 Bacteria 501
270 Ga0495668_0046993 3300046616 Bacteria 2396
271 Ga0495668_0110163 3300046616 Bacteria 1506
272 Ga0495625_0053673 3300046660 Bacteria 2881
273 Ga0495649_0160676 3300046694 Bacteria 1178
274 Ga0495649_0334891 3300046694 Bacteria 766
275 Ga0495660_0020450 3300046810 Bacteria 3794
276 Ga0495683_0238558 3300047323 Bacteria 803
277 Ga0495687_022843 3300047443 Bacteria 2997
278 Ga0495687_137055 3300047443 Bacteria 857
279 Ga0495687_194862 3300047443 Bacteria 649
280 Ga0495687_241642 3300047443 Bacteria 544
281 Ga0495685_149727 3300047447 Bacteria 758
282 Ga0495686_0000895 3300047472 Bacteria 37513
283 Ga0495686_0006687 3300047472 Bacteria 8775
284 Ga0495686_0077315 3300047472 Bacteria 2038
285 Ga0495686_0115755 3300047472 Bacteria 1603
286 Ga0495686_0218673 3300047472 Bacteria 1085
287 Ga0495686_0231807 3300047472 Bacteria 1045
288 Ga0495686_0288207 3300047472 Bacteria 910
289 Ga0495615_0019361 3300048090 Bacteria 1511
290 Ga0495626_0268585 3300048091 Bacteria 680
291 Ga0496100_0114915 3300048903 Bacteria 1876
292 Ga0496101_0188157 3300048904 Bacteria 1592
293 Ga0496101_0762938 3300048904 Bacteria 763
294 Ga0496102_0711291 3300048905 Bacteria 927
295 Ga0496103_0414444 3300048906 Bacteria 865
296 Ga0496106_0025232 3300048909 Bacteria 4422
297 Ga0496113_1073049 3300048916 Unclassified 632
298 Ga0496116_0014809 3300048919 Bacteria 6201
299 Ga0496116_0018236 3300048919 Bacteria 5418
300 Ga0496116_0023164 3300048919 Bacteria 4632
301 Ga0496116_0052504 3300048919 Bacteria 2700
302 Ga0496116_0079098 3300048919 Bacteria 2047
303 Ga0496116_0088277 3300048919 Bacteria 1895
304 Ga0496116_0143206 3300048919 Bacteria 1341
305 Ga0496116_0149769 3300048919 Bacteria 1298
306 Ga0496116_0248134 3300048919 Bacteria 888
307 Ga0496116_0304997 3300048919 Bacteria 755
308 Ga0496117_0019887 3300048920 Bacteria 5494
309 Ga0496117_0033002 3300048920 Bacteria 3921
310 Ga0496117_0314390 3300048920 Bacteria 823
311 Ga0496117_0367356 3300048920 Bacteria 737
312 Ga0496117_0459093 3300048920 Bacteria 628
313 Ga0496118_0012575 3300048921 Bacteria 8106
314 Ga0496118_0015409 3300048921 Bacteria 7077
315 Ga0496118_0261074 3300048921 Bacteria 977
316 Ga0496118_0372849 3300048921 Bacteria 752
317 Ga0496119_0000887 3300048922 Bacteria 39179
318 Ga0496119_0028768 3300048922 Bacteria 3785
319 Ga0496119_0137986 3300048922 Bacteria 1320
320 Ga0496119_0241060 3300048922 Bacteria 916
321 Ga0496120_0149705 3300048923 Bacteria 1175
322 Ga0496121_0022083 3300048924 Bacteria 6195
323 Ga0496121_0031731 3300048924 Bacteria 4819
324 Ga0496121_0036954 3300048924 Bacteria 4345
325 Ga0496121_0044642 3300048924 Bacteria 3820
326 Ga0496121_0047968 3300048924 Bacteria 3638
327 Ga0496121_0055337 3300048924 Bacteria 3306
328 Ga0496121_0088520 3300048924 Bacteria 2427
329 Ga0496121_0119231 3300048924 Bacteria 1996
330 Ga0496121_0188158 3300048924 Bacteria 1483
331 Ga0496121_0250324 3300048924 Bacteria 1229
332 Ga0496121_0254188 3300048924 Bacteria 1217
333 Ga0496122_0001221 3300048925 Bacteria 43548
334 Ga0496122_0001241 3300048925 Bacteria 43048
335 Ga0496122_0002116 3300048925 Bacteria 29353
336 Ga0496122_0052404 3300048925 Bacteria 3089
337 Ga0496122_0057008 3300048925 Bacteria 2906
338 Ga0496122_0070259 3300048925 Bacteria 2503
339 Ga0496122_0119250 3300048925 Bacteria 1707
340 Ga0496122_0186232 3300048925 Bacteria 1231
341 Ga0496122_0219389 3300048925 Bacteria 1093
342 Ga0496122_0254709 3300048925 Bacteria 978
343 Ga0496122_0337373 3300048925 Bacteria 793
344 Ga0496123_0000980 3300048926 Bacteria 44056
345 Ga0496123_0001704 3300048926 Bacteria 29372
346 Ga0496123_0039452 3300048926 Bacteria 3303
347 Ga0496123_0040031 3300048926 Bacteria 3271
348 Ga0496123_0049425 3300048926 Bacteria 2820
349 Ga0496123_0076004 3300048926 Bacteria 2069
350 Ga0496123_0090898 3300048926 Bacteria 1813
351 Ga0496123_0241913 3300048926 Bacteria 895
352 Ga0496124_0000254 3300048927 Bacteria 103551
353 Ga0496124_0006901 3300048927 Bacteria 12201
354 Ga0496124_0009924 3300048927 Bacteria 9733
355 Ga0496124_0021811 3300048927 Bacteria 5890
356 Ga0496124_0023877 3300048927 Bacteria 5570
357 Ga0496124_0064422 3300048927 Bacteria 3059
358 Ga0496124_0096527 3300048927 Bacteria 2401
359 Ga0496124_0246095 3300048927 Bacteria 1326
360 Ga0496124_0436640 3300048927 Bacteria 897
361 Ga0496125_0005508 3300048928 Bacteria 14035
362 Ga0496125_0067425 3300048928 Bacteria 2819
363 Ga0496125_0107509 3300048928 Bacteria 2032
364 Ga0496125_0196605 3300048928 Bacteria 1325
365 Ga0496125_0280532 3300048928 Bacteria 1032
366 Ga0496125_0287206 3300048928 Bacteria 1015
367 Ga0496125_0729930 3300048928 Bacteria 522
368 Ga0496126_0023396 3300048929 Bacteria 5988
369 Ga0496126_0042165 3300048929 Bacteria 4216
370 Ga0496126_0214820 3300048929 Bacteria 1618
371 Ga0496126_0313537 3300048929 Bacteria 1291
372 Ga0501034_0055379 3300049571 Bacteria 3991
373 Ga0501036_0279652 3300049572 Bacteria 1397
374 Ga0501037_0372409 3300049573 Bacteria 982
375 Ga0501043_0020413 3300049579 Bacteria 5196
376 nmdc:mga03n38_71510_c2 3300050490 Bacteria 1203
377 nmdc:mga00v17_137466_c1 3300050491 Bacteria 1565
378 nmdc:mga00v17_989616_c1 3300050491 Bacteria 530
379 nmdc:mga0k408_676364_c1 3300050493 Bacteria 606
380 nmdc:mga07m45_365576_c1 3300050496 Bacteria 838
381 nmdc:mga07m45_4382_c1 3300050496 Bacteria 6909
382 nmdc:mga07m45_466895_c1 3300050496 Bacteria 732
383 nmdc:mga0sz30_252103_c1 3300050516 Bacteria 786
384 Ga0500578_0001512 3300053086 Bacteria 23074
385 Ga0500578_0076417 3300053086 Bacteria 2132
386 Ga0500578_0110640 3300053086 Bacteria 1731
387 Ga0500651_0213846 3300053093 Bacteria 1133
388 Ga0500651_0656121 3300053093 Bacteria 564
389 Ga0500569_001550 3300053109 Bacteria 4362
390 Ga0500569_059027 3300053109 Bacteria 1179
391 Ga0500594_0070373 3300053118 Bacteria 1027
392 Ga0500618_000019 3300053125 Bacteria 161916
393 Ga0500618_000118 3300053125 Bacteria 64472
394 Ga0500618_000614 3300053125 Bacteria 21748
395 Ga0500658_0016611 3300053134 Bacteria 2743
396 Ga0500568_0000358 3300053139 Bacteria 35482
397 Ga0500568_0010390 3300053139 Bacteria 4362
398 Ga0500568_0041856 3300053139 Bacteria 1839
399 Ga0500604_0105050 3300053151 Bacteria 934
400 Ga0500616_0000533 3300053153 Bacteria 47588
401 Ga0500616_0044531 3300053153 Bacteria 2367
402 Ga0500616_0072356 3300053153 Bacteria 1752
403 Ga0500620_173367 3300053155 Bacteria 745
404 Ga0500622_0000687 3300053156 Bacteria 29908
405 Ga0500622_0435931 3300053156 Bacteria 524
406 Ga0500627_0060612 3300053158 Bacteria 1664
407 Ga0500627_0185849 3300053158 Bacteria 934
408 Ga0500633_0000587 3300053160 Bacteria 5963
409 Ga0587077_031254 3300059493 Bacteria 1016
410 Ga0587088_144469 3300059508 Bacteria 570
411 Ga0587090_080140 3300059510 Bacteria 653
412 Ga0587072_024600 3300059643 Bacteria 1090
413 Ga0587071_170041 3300060344 Bacteria 553
414 2511171062 2510917026 Bacteria 7046020
415 2513580980 2513237085 Bacteria 7695351
416 2513871539 2513237138 Bacteria 7368160
417 2513871869 2513237138 Bacteria 7368160
418 2585169894 2582581283 Bacteria 6030556
419 2585205898 2582581294 Bacteria 6626667
420 2585258125 2582581304 Bacteria 5831370
421 2585282762 2582581308 Bacteria 7413247
422 2585333092 2582581316 Bacteria 7774528
423 2585529749 2585427526 Bacteria 7258840
424 2585530415 2585427526 Bacteria 7258840
425 2585542915 2585427528 Bacteria 6842387
426 2585841267 2585427593 Bacteria 7141551
427 2599722924 2599185236 Bacteria 6875203
428 2599723642 2599185236 Bacteria 6875203
429 2600377257 2600254933 Bacteria 4750527
430 2601612350 2600255279 Bacteria 5605316
431 2601749262 2600255308 Bacteria 5611129
432 2616309889 2615840626 Bacteria 7921970
433 2616550841 2615840698 Bacteria 7319877
434 2644005642 2643221599 Bacteria 6292121
435 2644192304 2643221634 Bacteria 6705461
436 2644312622 2643221655 Bacteria 7722067
437 2644336826 2643221659 Bacteria 7890716
438 2644501545 2643221689 Bacteria 6042950
439 2644540938 2643221698 Bacteria 7756764
440 2644618353 2643221712 Bacteria 7729434
441 2671116852 2667528174 Bacteria 6435400
442 2719383350 2718217927 Bacteria 6972593
443 2738803495 2738541293 Bacteria 7065685
444 2793316578 2791355259 Bacteria 7254731
445 2793317062 2791355259 Bacteria 7254731
446 2793318999 2791355259 Bacteria 7254731
447 2793329186 2791355261 Bacteria 6661293
448 2793337405 2791355262 Bacteria 6774204
449 2793343653 2791355263 Bacteria 6872478
450 2793351252 2791355264 Bacteria 6429314
451 2793370641 2791355267 Bacteria 7222458
452 2806049561 2802429633 Bacteria 7341974
453 2806051205 2802429634 Bacteria 7083200
454 2806057622 2802429635 Bacteria 7650140
455 2806071075 2802429636 Bacteria 7597525
456 2806076143 2802429637 Bacteria 7067217
457 2819561536 2818991439 Bacteria 6907412
458 2819612973 2818991448 Bacteria 6772224
459 2819613768 2818991448 Bacteria 6772224
460 2819689095 2818991461 Bacteria 7026071
461 2821129567 2821123053 Bacteria 7836056
462 2838026040 2838022645 Bacteria 6494267
463 2838718555 2838714209 Bacteria 5525906
464 2838723553 2838719591 Bacteria 5523910
465 2841851227 2841846520 Bacteria 5345850
466 2842129201 2842124991 Bacteria 5346824
467 2842174848 2842170452 Bacteria 5525737
468 2842191329 2842187318 Bacteria 5524014
469 2842204114 2842198810 Bacteria 6608673
470 2842211240 2842205361 Bacteria 6340321
471 2842215597 2842211629 Bacteria 5523832
472 2842228318 2842224351 Bacteria 5524473
473 2842284694 2842278818 Bacteria 6340002
474 2842309169 2842304105 Bacteria 7023636
475 2857535909 2857531043 Bacteria 6754041
476 2919104919 2919100787 Bacteria 7710546
477 2919105153 2919100787 Bacteria 7710546
478 2919119363 2919114240 Bacteria 5700270
479 2933575729 2933570622 Bacteria 7023390
480 2933598588 2933594066 Bacteria 5594265
481 2979103125 2979100975 Bacteria 5423623
482 2984514359 2984509177 Bacteria 5274802
483 2984523390 2984518228 Bacteria 5277463
484 2984542588 2984537506 Bacteria 5277481
485 2984606475 2984601300 Bacteria 5455244
486 3005416383 3005409236 Bacteria 7188837
487 3005455311 3005452660 Bacteria 5889319
488 650741534 650716007 Bacteria 5573770
489 8005259112 8005258706 Bacteria 6184835
490 8005276567 8005275841 Bacteria 6929066
491 8005386735 8005382845 Bacteria 6732062
492 8005387001 8005382845 Bacteria 6732062
493 8005399268 8005395548 Bacteria 6806915
494 8005567662 8005563573 Bacteria 7153261
495 8005647790 8005645114 Bacteria 6950293
496 8018182522 8018176218 Bacteria 6896178
497 8023681465 8023680758 Bacteria 7729763
498 8056378754 8056375014 Bacteria 7006639
499 8056378861 8056375014 Bacteria 7006639
500 Ga0500616_0000108
501 JGI24740J21852_10012234
502 JGI25162J39368_1000201
503 JGI25162J39368_1001343
504 JGI25162J39368_1002349
505 JGI25152J39213_1000020
506 JGI25152J39213_1000104
507 JGI25152J39213_1000969
508 JGI25152J39213_1008374
509 JGI25152J39213_1028430
510 JGI25150J39212_1000078
511 JGI25150J39212_1015973
512 JGI25159J45721_1000069
513 JGI25151J46595_10000098
514 JGI25151J46595_10000885
515 JGI25151J46595_10002384
516 JGI25151J46595_10091255
517 JGI25165J46597_1000274
518 JGI25165J46597_1000950
519 JGI25165J46597_1001436
520 JGI25153J46596_10000122
521 JGI25153J46596_10000488
522 JGI25153J46596_10002889
523 rootH1_10061658
524 rootL2_10048347
525 rootL2_10313730
526 rootH1_10043017
527 rootH1_10103914
528 rootH1_10327101
529 JGI25160J50197_1000089
530 JGI25161J50226_1000100
531 Ga0055526_1000075
532 Ga0055526_1017620
533 Ga0055526_1030014
534 Ga0055526_1045125
535 Ga0055524_1002926
536 Ga0055524_1008153
537 Ga0055524_1015103
538 Ga0055524_1029128
539 Ga0055536_1000240
540 Ga0055528_1002319
541 Ga0055528_1002697
542 Ga0055528_1008025
543 Ga0055528_1019986
544 Ga0055528_1021572
545 Ga0055530_10012811
546 Ga0055530_10026042
547 Ga0055530_10052649
548 Ga0055540_1000216
549 Ga0055540_1001244
550 Ga0055540_1005524
551 Ga0055540_1013438
552 Ga0055531_10005643
553 Ga0058692_1011029
554 Ga0058692_1056750
555 Ga0055543_1000173
556 Ga0065165_1000291
557 Ga0065165_1007625
558 Ga0065165_1011782
559 Ga0065165_1016305
560 Ga0070669_100500565
561 Ga0070675_101745995
562 Ga0070663_100627908
563 Ga0068853_100948252
564 Ga0068853_101599805
565 Ga0070665_100016367
566 Ga0070665_101053283
567 Ga0068854_100969085
568 Ga0068856_100238293
569 Ga0068852_100477849
570 Ga0075364_10122843
571 Ga0075364_10618957
572 Ga0075364_10834140
573 Ga0075367_10097885
574 Ga0075367_10325914
575 Ga0075367_10876844
576 Ga0075366_10500566
577 Ga0075366_10587906
578 Ga0075370_10033692
579 Ga0075370_10246074
580 Ga0075370_10338853
581 Ga0075370_10787021
582 Ga0099826_10000038
583 Ga0099826_10000081
584 Ga0105251_10367531
585 Ga0105244_10294356
586 Ga0105244_10445314
587 Ga0105250_10411731
588 Ga0105243_10257235
589 Ga0105237_10000038
590 Ga0105249_12276363
591 Ga0105249_13029140
592 Ga0123341_1000008
593 Ga0123341_1000010
594 Ga0123341_1000046
595 Ga0123342_1020909
596 Ga0123342_1022276
597 Ga0105239_10002418
598 Ga0105239_10309815
599 Ga0105246_10864019
600 Ga0157373_10006195
601 Ga0157370_10000054
602 Ga0157370_11045678
603 Ga0163162_11196105
604 Ga0182008_10348090
605 Ga0157379_10867902
606 Ga0206349_1787742
607 Ga0206351_10509986
608 Ga0224712_10046814
609 Ga0224712_10108175
610 Ga0224712_10175889
611 Ga0209436_100010
612 Ga0209437_100023
613 Ga0209437_100203
614 Ga0209437_100614
615 Ga0207425_1000061
616 Ga0207425_1000185
617 Ga0207425_1004240
618 Ga0207425_1083298
619 Ga0209129_1000070
620 Ga0209129_1000134
621 Ga0209129_1000155
622 Ga0209129_1000375
623 Ga0209129_1000485
624 Ga0209233_1000127
625 Ga0209233_1000205
626 Ga0209233_1000562
627 Ga0209673_1000092
628 Ga0209673_1000161
629 Ga0209673_1000165
630 Ga0209673_1000202
631 Ga0209673_1003235
632 Ga0209673_1007696
633 Ga0209673_1028408
634 Ga0209673_1030791
635 Ga0209673_1043240
636 Ga0209673_1079298
637 Ga0209130_1000101
638 Ga0209130_1004056
639 Ga0209676_1001184
640 Ga0209676_1017204
641 Ga0209025_1000175
642 Ga0209025_1000254
643 Ga0209025_1000496
644 Ga0209025_1001740
645 Ga0209025_1006465
646 Ga0209025_1006848
647 Ga0209025_1010591
648 Ga0209564_1000126
649 Ga0209564_1003119
650 Ga0209564_1003930
651 Ga0209564_1014909
652 Ga0209564_1024560
653 Ga0209758_1000178
654 Ga0209758_1000360
655 Ga0209758_1001574
656 Ga0209758_1022594
657 Ga0209758_1058264
658 Ga0209050_1001019
659 Ga0209050_1039667
660 Ga0209050_1114178
661 Ga0209256_1000144
662 Ga0209256_1000761
663 Ga0209256_1002022
664 Ga0209256_1004095
665 Ga0209256_1011409
666 Ga0209256_1034381
667 Ga0207426_1000205
668 Ga0207426_1000222
669 Ga0207426_1000302
670 Ga0209051_1000032
671 Ga0209051_1000129
672 Ga0209051_1000600
673 Ga0209051_1001719
674 Ga0209051_1070399
675 Ga0209051_1116383
676 Ga0209257_1000675
677 Ga0209257_1002769
678 Ga0209257_1012979
679 Ga0209257_1074953
680 Ga0207655_1249480
681 Ga0207680_11043808
682 Ga0207647_10681602
683 Ga0207671_10000418
684 Ga0207681_10228791
685 Ga0207650_11792851
686 Ga0207640_10318767
687 Ga0207639_11238087
688 Ga0207639_12090715
689 Ga0207678_10199525
690 Ga0207702_10165853
691 Ga0207674_10608556
692 Ga0209371_1000064
693 Ga0209371_1023568
694 Ga0209282_1000093
695 Ga0209282_1001951
696 Ga0268266_10034218
697 Ga0268266_10392321
698 Ga0268256_1000028
699 Ga0268256_1019756
700 Ga0268256_1038784
701 Ga0314311_1016877
702 Ga0316181_1146291
703 Ga0307513_10072846
704 Ga0307513_10729025
705 Ga0307406_10003620
706 Ga0307412_10002041
707 Ga0307412_10054734
708 Ga0237819_21121
709 Ga0439465_0007583
710 Ga0439465_0022863
711 Ga0439465_0032956
712 Ga0439465_0093822
713 Ga0451806_505774
714 Ga0451833_0973055
715 Ga0451835_0190452
716 Ga0451835_0417259
717 Ga0451835_0488717
718 Ga0451837_0199540
719 Ga0451837_0362977
720 Ga0451839_0548082
721 Ga0451839_0820037
722 Ga0451845_0253365
723 Ga0451845_0454190
724 Ga0451847_0060512
725 Ga0451849_0038906
726 Ga0451849_0562189
727 Ga0451849_1064662
728 Ga0451851_0125201
729 Ga0451851_0798657
730 Ga0451843_0395337
731 Ga0451843_0798157
732 Ga0451843_1008512
733 Ga0451843_1457649
734 Ga0451855_1623486
735 Ga0451855_1787357
736 Ga0451853_0749073
737 Ga0451853_1532742
738 Ga0451853_2518453
739 Ga0450900_020531
740 Ga0495617_131559
741 Ga0495650_0137397
742 Ga0495607_0282377
743 Ga0495583_0106564
744 Ga0495606_0017360
745 Ga0495606_0052850
746 Ga0495606_0067012
747 Ga0495606_0251852
748 Ga0495606_0533331
749 Ga0495610_0003705
750 Ga0495610_0064109
751 Ga0495610_0136117
752 Ga0495616_0154265
753 Ga0495620_0060000
754 Ga0495631_0513213
755 Ga0495632_0038291
756 Ga0495632_0371068
757 Ga0495632_0439038
758 Ga0495643_0006272
759 Ga0495643_0038219
760 Ga0495643_0046472
761 Ga0495643_0048565
762 Ga0495644_0182029
763 Ga0495648_0096445
764 Ga0495654_0248829
765 Ga0495609_0095433
766 Ga0495609_0388635
767 Ga0495597_0080320
768 Ga0495633_0588205
769 Ga0495668_0046993
770 Ga0495668_0110163
771 Ga0495625_0053673
772 Ga0495649_0160676
773 Ga0495649_0334891
774 Ga0495660_0020450
775 Ga0495683_0238558
776 Ga0495687_022843
777 Ga0495687_137055
778 Ga0495687_194862
779 Ga0495687_241642
780 Ga0495685_149727
781 Ga0495686_0000895
782 Ga0495686_0006687
783 Ga0495686_0077315
784 Ga0495686_0115755
785 Ga0495686_0218673
786 Ga0495686_0231807
787 Ga0495686_0288207
788 Ga0495615_0019361
789 Ga0495626_0268585
790 Ga0496100_0114915
791 Ga0496101_0188157
792 Ga0496101_0762938
793 Ga0496102_0711291
794 Ga0496103_0414444
795 Ga0496106_0025232
796 Ga0496113_1073049
797 Ga0496116_0014809
798 Ga0496116_0018236
799 Ga0496116_0023164
800 Ga0496116_0052504
801 Ga0496116_0079098
802 Ga0496116_0088277
803 Ga0496116_0143206
804 Ga0496116_0149769
805 Ga0496116_0248134
806 Ga0496116_0304997
807 Ga0496117_0019887
808 Ga0496117_0033002
809 Ga0496117_0314390
810 Ga0496117_0367356
811 Ga0496117_0459093
812 Ga0496118_0012575
813 Ga0496118_0015409
814 Ga0496118_0261074
815 Ga0496118_0372849
816 Ga0496119_0000887
817 Ga0496119_0028768
818 Ga0496119_0137986
819 Ga0496119_0241060
820 Ga0496120_0149705
821 Ga0496121_0022083
822 Ga0496121_0031731
823 Ga0496121_0036954
824 Ga0496121_0044642
825 Ga0496121_0047968
826 Ga0496121_0055337
827 Ga0496121_0088520
828 Ga0496121_0119231
829 Ga0496121_0188158
830 Ga0496121_0250324
831 Ga0496121_0254188
832 Ga0496122_0001221
833 Ga0496122_0001241
834 Ga0496122_0002116
835 Ga0496122_0052404
836 Ga0496122_0057008
837 Ga0496122_0070259
838 Ga0496122_0119250
839 Ga0496122_0186232
840 Ga0496122_0219389
841 Ga0496122_0254709
842 Ga0496122_0337373
843 Ga0496123_0000980
844 Ga0496123_0001704
845 Ga0496123_0039452
846 Ga0496123_0040031
847 Ga0496123_0049425
848 Ga0496123_0076004
849 Ga0496123_0090898
850 Ga0496123_0241913
851 Ga0496124_0000254
852 Ga0496124_0006901
853 Ga0496124_0009924
854 Ga0496124_0021811
855 Ga0496124_0023877
856 Ga0496124_0064422
857 Ga0496124_0096527
858 Ga0496124_0246095
859 Ga0496124_0436640
860 Ga0496125_0005508
861 Ga0496125_0067425
862 Ga0496125_0107509
863 Ga0496125_0196605
864 Ga0496125_0280532
865 Ga0496125_0287206
866 Ga0496125_0729930
867 Ga0496126_0023396
868 Ga0496126_0042165
869 Ga0496126_0214820
870 Ga0496126_0313537
871 Ga0501034_0055379
872 Ga0501036_0279652
873 Ga0501037_0372409
874 Ga0501043_0020413
875 nmdc:mga03n38_71510_c2
876 nmdc:mga00v17_137466_c1
877 nmdc:mga00v17_989616_c1
878 nmdc:mga0k408_676364_c1
879 nmdc:mga07m45_365576_c1
880 nmdc:mga07m45_4382_c1
881 nmdc:mga07m45_466895_c1
882 nmdc:mga0sz30_252103_c1
883 Ga0500578_0001512
884 Ga0500578_0076417
885 Ga0500578_0110640
886 Ga0500651_0213846
887 Ga0500651_0656121
888 Ga0500569_001550
889 Ga0500569_059027
890 Ga0500594_0070373
891 Ga0500618_000019
892 Ga0500618_000118
893 Ga0500618_000614
894 Ga0500658_0016611
895 Ga0500568_0000358
896 Ga0500568_0010390
897 Ga0500568_0041856
898 Ga0500604_0105050
899 Ga0500616_0000533
900 Ga0500616_0044531
901 Ga0500616_0072356
902 Ga0500620_173367
903 Ga0500622_0000687
904 Ga0500622_0435931
905 Ga0500627_0060612
906 Ga0500627_0185849
907 Ga0500633_0000587
908 Ga0587077_031254
909 Ga0587088_144469
910 Ga0587090_080140
911 Ga0587072_024600
912 Ga0587071_170041
913 2511171062
914 2513580980
915 2513871539
916 2513871869
917 2585169894
918 2585205898
919 2585258125
920 2585282762
921 2585333092
922 2585529749
923 2585530415
924 2585542915
925 2585841267
926 2599722924
927 2599723642
928 2600377257
929 2601612350
930 2601749262
931 2616309889
932 2616550841
933 2644005642
934 2644192304
935 2644312622
936 2644336826
937 2644501545
938 2644540938
939 2644618353
940 2671116852
941 2719383350
942 2738803495
943 2793316578
944 2793317062
945 2793318999
946 2793329186
947 2793337405
948 2793343653
949 2793351252
950 2793370641
951 2806049561
952 2806051205
953 2806057622
954 2806071075
955 2806076143
956 2819561536
957 2819612973
958 2819613768
959 2819689095
960 2821129567
961 2838026040
962 2838718555
963 2838723553
964 2841851227
965 2842129201
966 2842174848
967 2842191329
968 2842204114
969 2842211240
970 2842215597
971 2842228318
972 2842284694
973 2842309169
974 2857535909
975 2919104919
976 2919105153
977 2919119363
978 2933575729
979 2933598588
980 2979103125
981 2984514359
982 2984523390
983 2984542588
984 2984606475
985 3005416383
986 3005455311
987 650741534
988 8005259112
989 8005276567
990 8005386735
991 8005387001
992 8005399268
993 8005567662
994 8005647790
995 8018182522
996 8023681465
997 8056378754
998 8056378861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06169

DUF982

Protein of unknown function (DUF982)

27

98

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqa-assembly1.cif.gz_A x-ray sequence and crystal structure of luffaculin 1, a novel type 1 ribosome-inactivating protein 0.964 4 26
1bry-assembly2.cif.gz_Z bryodin type i rip 0.9272 4 26
1gis-assembly1.cif.gz_A a trichosanthin(tcs) mutant(e85q) complex structure with 2'-deoxy-adenosin-5'-monophosphate 0.9238 4 26
3srp-assembly1.cif.gz_A structure of rivax: a human ricin vaccine 0.9133 4 25
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.9074 4 25
ID Description Score Start End Superfamily
3ktzB02 Few Secondary Structures;Irregular;Ricin (A Subunit), domain 2;Ricin (A Subunit), domain 2 0.8392 1 28 4.10.470.10
af_Q9U0I5_569_866_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8317 25 52 3.60.40.10
1rzoC02 Few Secondary Structures;Irregular;Ricin (A Subunit), domain 2;Ricin (A Subunit), domain 2 0.8143 1 25 4.10.470.10
2kpqA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8133 4 75 6.10.250.730
2kpqA01 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7855 4 75 6.10.250.730
ID Description Score Start End GO Terms
AF-A0A7R6XVM5-F1-model_v4 DUF982 domain-containing protein 0.9854 5 78
AF-A0A2S0XJE1-F1-model_v4 DUF982 domain-containing protein 0.9742 24 81
AF-A0A0P0Z496-F1-model_v4 DUF982 domain-containing protein 0.9741 1 81
AF-A0A349XYX3-F1-model_v4 DUF982 domain-containing protein 0.9732 1 73
AF-A0A3F2UGZ1-F1-model_v4 DUF982 domain-containing protein 0.9702 5 79

Map