metagRoot

F455453

General Info

Members	Datasets	Scaffolds	Average Seq Length
499	208	499	294

Family's Representative Sequence

Representative Sequence	3300060353\|Ga0501082_0277536\|Ga0501082_0277536_185_1225
Length	346
Sequence	VIGRYRELATSREVSYVEEKGTQCELHGHRRNHTIPEHLTAVVAAVTIAVVHRSVDPHTTFKSARAAFRFYLGDCLDVLSRLPDRSVDVIVTSPPYNLGIRYRSYDDTMPRHDYLKWTGEWVQHVARLLAPDGSLFLNVGAKPTDPWTAMDVAQAVRPHLRLQNTIHWIKSIAIEKSLAGARANLEDDLAVGHYKPINSRRFVHDCHEFVFHFSASGETPIDRRAIGVRYQDQSNVGRWRTAASGVRCRGNTWFIPYETIQSREKDRPHPATFPPKLPEMCLRLHGLERTRLVADPFLGLGSTAVACAELGVSFIGIEMDEGYLEEAVERTRAALPPAATGRARAR

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
26	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
27	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
28	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
29	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
30	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
31	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
32	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
35	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
39	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
40	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
43	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
44	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
47	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
48	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
49	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
52	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
53	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
54	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
55	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
61	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
62	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
63	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
64	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
65	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
66	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
67	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
69	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
70	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
71	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
72	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
73	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
74	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
75	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
76	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
78	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
80	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
81	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
83	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
84	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
85	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
91	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
92	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
140	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
143	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
144	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
145	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
146	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
147	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
148	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
149	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
150	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
151	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
152	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
153	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
154	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
155	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
156	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
157	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
158	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
159	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
160	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
161	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
162	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
163	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
164	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
165	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
166	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
167	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
168	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
169	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
170	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
171	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
172	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
173	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
174	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
175	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
176	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
177	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
178	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
179	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
180	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
181	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
182	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
183	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
184	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
185	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
186	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
187	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
188	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
189	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
190	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
191	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
192	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
193	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
194	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
195	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
196	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
197	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
198	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
199	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
200	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
201	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
202	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
203	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
204	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
205	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
206	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
207	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
208	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.61
Nodule	0
Rhizoplane	0.2
Rhizosphere	95.99
Stem	0
Stem Tuber	0
Unclassified	0.2

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1002469	3300001977	Bacteria	2942
2	JGI25406J46586_10005196	3300003203	Bacteria	6037
3	JGI25406J46586_10034937	3300003203	Bacteria	1839
4	Ga0065712_10017582	3300005290	Bacteria	2379
5	Ga0065712_10021874	3300005290	Bacteria	1475
6	Ga0065712_10136853	3300005290	Bacteria	1489
7	Ga0065715_10108241	3300005293	Bacteria	2729
8	Ga0065715_10162833	3300005293	Bacteria	1613
9	Ga0070676_10049700	3300005328	Bacteria	2456
10	Ga0070676_10114112	3300005328	Unclassified	1686
11	Ga0070676_10154193	3300005328	Bacteria	1473
12	Ga0070683_100165917	3300005329	Bacteria	2095
13	Ga0070690_100052224	3300005330	Bacteria	2612
14	Ga0070690_100094924	3300005330	Unclassified	1969
15	Ga0070670_100021290	3300005331	Bacteria	5578
16	Ga0070670_100052011	3300005331	Unclassified	3517
17	Ga0070670_100092042	3300005331	Unclassified	2607
18	Ga0070677_10004874	3300005333	Bacteria	4406
19	Ga0070677_10009832	3300005333	Unclassified	3254
20	Ga0068869_100001451	3300005334	Bacteria	14018
21	Ga0070666_10028101	3300005335	Bacteria	3689
22	Ga0070680_100110881	3300005336	Bacteria	2284
23	Ga0070680_100220353	3300005336	Bacteria	1601
24	Ga0070680_100241786	3300005336	Bacteria	1526
25	Ga0068868_100017242	3300005338	Bacteria	5375
26	Ga0070689_100020315	3300005340	Bacteria	4926
27	Ga0070689_100092388	3300005340	Unclassified	2387
28	Ga0070687_100017018	3300005343	Unclassified	3333
29	Ga0070661_100017755	3300005344	Bacteria	5050
30	Ga0070661_100020971	3300005344	Bacteria	4665
31	Ga0070668_100007025	3300005347	Bacteria	8342
32	Ga0070668_100071459	3300005347	Unclassified	2703
33	Ga0070669_100003108	3300005353	Bacteria	11951
34	Ga0070669_100011311	3300005353	Bacteria	6336
35	Ga0070669_100067002	3300005353	Bacteria	2647
36	Ga0070675_100000181	3300005354	Bacteria	39301
37	Ga0070675_100001605	3300005354	Bacteria	16679
38	Ga0070675_100014095	3300005354	Bacteria	6298
39	Ga0070675_100025498	3300005354	Unclassified	4739
40	Ga0070675_100036220	3300005354	Bacteria	4014
41	Ga0070675_100069088	3300005354	Bacteria	2926
42	Ga0070675_100091413	3300005354	Bacteria	2550
43	Ga0070675_100111428	3300005354	Bacteria	2316
44	Ga0070675_100197040	3300005354	Bacteria	1747
45	Ga0070671_100014421	3300005355	Bacteria	6386
46	Ga0070671_100027688	3300005355	Bacteria	4666
47	Ga0070671_100047463	3300005355	Unclassified	3571
48	Ga0070674_100001218	3300005356	Bacteria	13509
49	Ga0070674_100226985	3300005356	Unclassified	1455
50	Ga0070673_100005331	3300005364	Bacteria	8210
51	Ga0070673_100005828	3300005364	Bacteria	7941
52	Ga0070673_100065159	3300005364	Bacteria	2905
53	Ga0070673_100078190	3300005364	Bacteria	2676
54	Ga0070688_100045516	3300005365	Bacteria	2712
55	Ga0070667_100008511	3300005367	Bacteria	8505
56	Ga0070667_100327767	3300005367	Unclassified	1383
57	Ga0070701_10001595	3300005438	Bacteria	8444
58	Ga0070701_10021309	3300005438	Bacteria	3090
59	Ga0070701_10122190	3300005438	Unclassified	1469
60	Ga0070705_100006602	3300005440	Bacteria	5696
61	Ga0070705_100023905	3300005440	Bacteria	3290
62	Ga0070700_100006546	3300005441	Bacteria	6231
63	Ga0070700_100041666	3300005441	Unclassified	2816
64	Ga0070700_100126219	3300005441	Unclassified	1721
65	Ga0070700_100172659	3300005441	Bacteria	1498
66	Ga0070694_100010078	3300005444	Bacteria	5812
67	Ga0070694_100023863	3300005444	Bacteria	3941
68	Ga0070694_100129835	3300005444	Bacteria	1819
69	Ga0070708_100113193	3300005445	Unclassified	2496
70	Ga0070678_100002418	3300005456	Bacteria	10229
71	Ga0070678_100059144	3300005456	Bacteria	2816
72	Ga0070678_100490911	3300005456	Bacteria	1082
73	Ga0070662_100006797	3300005457	Bacteria	7394
74	Ga0070662_100281725	3300005457	Unclassified	1345
75	Ga0070681_10008640	3300005458	Bacteria	9985
76	Ga0068867_100005657	3300005459	Bacteria	8863
77	Ga0068867_100007526	3300005459	Bacteria	7702
78	Ga0068867_100038928	3300005459	Bacteria	3464
79	Ga0068867_100067384	3300005459	Bacteria	2669
80	Ga0070685_10016873	3300005466	Unclassified	3898
81	Ga0070706_100221511	3300005467	Unclassified	1766
82	Ga0070698_100000806	3300005471	Bacteria	34225
83	Ga0070699_100000386	3300005518	Bacteria	42744
84	Ga0070699_100003990	3300005518	Bacteria	13037
85	Ga0070699_100006186	3300005518	Bacteria	10458
86	Ga0070699_100026606	3300005518	Unclassified	4988
87	Ga0070699_100054894	3300005518	Unclassified	3450
88	Ga0070679_100247043	3300005530	Unclassified	1741
89	Ga0070684_100030172	3300005535	Unclassified	4605
90	Ga0070697_100016970	3300005536	Bacteria	5724
91	Ga0070697_100314417	3300005536	Bacteria	1348
92	Ga0068853_100663495	3300005539	Bacteria	993
93	Ga0070672_100017524	3300005543	Bacteria	5158
94	Ga0070672_100046838	3300005543	Bacteria	3352
95	Ga0070672_100061936	3300005543	Unclassified	2951
96	Ga0070672_100106192	3300005543	Bacteria	2284
97	Ga0070672_100243087	3300005543	Bacteria	1514
98	Ga0070672_100255593	3300005543	Unclassified	1476
99	Ga0070686_100002140	3300005544	Bacteria	10884
100	Ga0070686_100042313	3300005544	Unclassified	2853
101	Ga0070686_100060861	3300005544	Unclassified	2438
102	Ga0070686_100078451	3300005544	Unclassified	2180
103	Ga0070695_100013403	3300005545	Unclassified	4926
104	Ga0070695_100023179	3300005545	Bacteria	3812
105	Ga0070696_100001143	3300005546	Bacteria	17208
106	Ga0070696_100017816	3300005546	Bacteria	4795
107	Ga0070696_100028407	3300005546	Bacteria	3818
108	Ga0070693_100011703	3300005547	Bacteria	4424
109	Ga0070704_100003993	3300005549	Bacteria	8507
110	Ga0070704_100004914	3300005549	Bacteria	7759
111	Ga0070704_100013198	3300005549	Bacteria	5121
112	Ga0070704_100063525	3300005549	Bacteria	2650
113	Ga0070704_100069631	3300005549	Bacteria	2550
114	Ga0070664_100011840	3300005564	Bacteria	7081
115	Ga0070664_100017829	3300005564	Bacteria	5830
116	Ga0070664_100023446	3300005564	Bacteria	5098
117	Ga0070664_100031216	3300005564	Unclassified	4449
118	Ga0070664_100078369	3300005564	Bacteria	2843
119	Ga0070664_100087213	3300005564	Bacteria	2698
120	Ga0068857_100103886	3300005577	Bacteria	2551
121	Ga0068857_100365836	3300005577	Bacteria	1337
122	Ga0070702_100038082	3300005615	Bacteria	2675
123	Ga0070702_100054594	3300005615	Unclassified	2300
124	Ga0070702_100129238	3300005615	Bacteria	1593
125	Ga0068859_100002081	3300005617	Bacteria	20395
126	Ga0068859_100026056	3300005617	Bacteria	5867
127	Ga0068859_100031902	3300005617	Bacteria	5292
128	Ga0068859_100055985	3300005617	Bacteria	3968
129	Ga0068859_100077691	3300005617	Bacteria	3360
130	Ga0068859_100146620	3300005617	Bacteria	2435
131	Ga0068859_100259028	3300005617	Unclassified	1830
132	Ga0068864_100005332	3300005618	Bacteria	10533
133	Ga0068866_10135934	3300005718	Bacteria	1405
134	Ga0068861_100001769	3300005719	Bacteria	13895
135	Ga0068861_100001989	3300005719	Bacteria	13206
136	Ga0068861_100040666	3300005719	Bacteria	3479
137	Ga0068870_10025353	3300005840	Unclassified	2942
138	Ga0068863_100012272	3300005841	Bacteria	8273
139	Ga0068863_100425109	3300005841	Bacteria	1302
140	Ga0068858_100008296	3300005842	Bacteria	9989
141	Ga0068858_100032206	3300005842	Bacteria	4869
142	Ga0068860_100030186	3300005843	Bacteria	5214
143	Ga0068860_100157178	3300005843	Bacteria	2191
144	Ga0068862_100001000	3300005844	Bacteria	27052
145	Ga0068862_100004508	3300005844	Bacteria	11744
146	Ga0068862_100306821	3300005844	Bacteria	1462
147	Ga0068862_100668177	3300005844	Bacteria	1004
148	Ga0081539_10000034	3300005985	Bacteria	307597
149	Ga0081539_10000190	3300005985	Bacteria	142511
150	Ga0081539_10013318	3300005985	Bacteria	6204
151	Ga0070717_10154992	3300006028	Bacteria	1984
152	Ga0075368_10009717	3300006042	Bacteria	3465
153	Ga0075364_10002442	3300006051	Bacteria	10411
154	Ga0075364_10008338	3300006051	Bacteria	6189
155	Ga0075364_10008612	3300006051	Bacteria	6101
156	Ga0075362_10002470	3300006177	Bacteria	6218
157	Ga0075367_10000547	3300006178	Bacteria	14249
158	Ga0075367_10013077	3300006178	Bacteria	4448
159	Ga0075366_10149229	3300006195	Unclassified	1415
160	Ga0097621_100020236	3300006237	Bacteria	5126
161	Ga0068871_100054844	3300006358	Unclassified	3235
162	Ga0068871_100101262	3300006358	Bacteria	2414
163	Ga0075428_100003245	3300006844	Bacteria	17800
164	Ga0075428_100031532	3300006844	Bacteria	5857
165	Ga0075428_100039996	3300006844	Bacteria	5160
166	Ga0075428_100189115	3300006844	Bacteria	2227
167	Ga0075428_100215185	3300006844	Bacteria	2076
168	Ga0075430_100007736	3300006846	Bacteria	9078
169	Ga0075430_100008767	3300006846	Bacteria	8534
170	Ga0075431_100000506	3300006847	Bacteria	32563
171	Ga0075431_100020297	3300006847	Bacteria	6787
172	Ga0075431_100022643	3300006847	Bacteria	6423
173	Ga0075431_100028278	3300006847	Bacteria	5758
174	Ga0075431_100054247	3300006847	Bacteria	4133
175	Ga0075431_100123405	3300006847	Unclassified	2672
176	Ga0075433_10003776	3300006852	Bacteria	11725
177	Ga0075433_10018488	3300006852	Bacteria	5795
178	Ga0075433_10072686	3300006852	Bacteria	3025
179	Ga0075433_10187539	3300006852	Unclassified	1840
180	Ga0075434_100011335	3300006871	Bacteria	8402
181	Ga0075434_100011713	3300006871	Bacteria	8282
182	Ga0075434_100199459	3300006871	Unclassified	2021
183	Ga0075429_100004353	3300006880	Bacteria	12164
184	Ga0075429_100014564	3300006880	Bacteria	6815
185	Ga0075429_100026929	3300006880	Bacteria	4992
186	Ga0075429_100124680	3300006880	Bacteria	2252
187	Ga0075429_100138674	3300006880	Bacteria	2129
188	Ga0068865_100005969	3300006881	Bacteria	7421
189	Ga0068865_100260830	3300006881	Unclassified	1372
190	Ga0097620_100002081	3300006931	Bacteria	20395
191	Ga0097620_100026053	3300006931	Bacteria	5867
192	Ga0097620_100031901	3300006931	Bacteria	5292
193	Ga0097620_100055986	3300006931	Bacteria	3968
194	Ga0097620_100077696	3300006931	Bacteria	3360
195	Ga0097620_100146611	3300006931	Bacteria	2435
196	Ga0097620_100259030	3300006931	Unclassified	1830
197	Ga0075435_100004954	3300007076	Bacteria	9239
198	Ga0075435_100040943	3300007076	Bacteria	3701
199	Ga0075435_100111452	3300007076	Unclassified	2276
200	Ga0111539_10000065	3300009094	Bacteria	106698
201	Ga0111539_10003505	3300009094	Bacteria	20690
202	Ga0111539_10006236	3300009094	Bacteria	15389
203	Ga0111539_10029612	3300009094	Bacteria	6665
204	Ga0111539_10098221	3300009094	Bacteria	3439
205	Ga0111539_10100896	3300009094	Unclassified	3389
206	Ga0111539_10104734	3300009094	Unclassified	3319
207	Ga0111539_10471932	3300009094	Unclassified	1461
208	Ga0105245_10050194	3300009098	Bacteria	3738
209	Ga0105247_10096603	3300009101	Bacteria	1883
210	Ga0114129_10003827	3300009147	Bacteria	21202
211	Ga0114129_10004740	3300009147	Bacteria	19213
212	Ga0114129_10007052	3300009147	Bacteria	15997
213	Ga0114129_10013194	3300009147	Bacteria	11772
214	Ga0114129_10133015	3300009147	Bacteria	3415
215	Ga0114129_10179991	3300009147	Unclassified	2877
216	Ga0114129_10324495	3300009147	Unclassified	2046
217	Ga0114129_10823718	3300009147	Bacteria	1182
218	Ga0105243_10049270	3300009148	Unclassified	3322
219	Ga0105243_10073284	3300009148	Bacteria	2774
220	Ga0105243_10113070	3300009148	Bacteria	2276
221	Ga0105241_10011519	3300009174	Bacteria	6482
222	Ga0105242_10058736	3300009176	Unclassified	3155
223	Ga0105242_10343627	3300009176	Bacteria	1376
224	Ga0105248_10127391	3300009177	Unclassified	2872
225	Ga0105248_10243533	3300009177	Unclassified	2024
226	Ga0105238_10018652	3300009551	Bacteria	7064
227	Ga0105238_10134942	3300009551	Unclassified	2446
228	Ga0105249_10001042	3300009553	Bacteria	24508
229	Ga0105249_10004359	3300009553	Bacteria	12241
230	Ga0105249_10383441	3300009553	Bacteria	1432
231	Ga0105239_10673862	3300010375	Unclassified	1182
232	Ga0105246_10124941	3300011119	Bacteria	1913
233	Ga0157378_10353734	3300013297	Bacteria	1436
234	Ga0163162_10003027	3300013306	Bacteria	16062
235	Ga0163162_10155873	3300013306	Bacteria	2404
236	Ga0157372_10825026	3300013307	Unclassified	1077
237	Ga0157375_10062316	3300013308	Unclassified	3705
238	Ga0157375_10067283	3300013308	Bacteria	3579
239	Ga0157375_10078844	3300013308	Bacteria	3328
240	Ga0157375_10153377	3300013308	Bacteria	2441
241	Ga0163163_10230907	3300014325	Bacteria	1899
242	Ga0157380_10004723	3300014326	Bacteria	9481
243	Ga0157380_10007696	3300014326	Bacteria	7668
244	Ga0157380_10037466	3300014326	Bacteria	3758
245	Ga0157380_10049787	3300014326	Bacteria	3306
246	Ga0157380_10055066	3300014326	Unclassified	3157
247	Ga0157380_10073950	3300014326	Bacteria	2765
248	Ga0157380_10535090	3300014326	Archaea	1146
249	Ga0157377_10084601	3300014745	Unclassified	1861
250	Ga0157377_10092196	3300014745	Bacteria	1791
251	Ga0157379_10003743	3300014968	Bacteria	12937
252	Ga0157379_10115840	3300014968	Bacteria	2409
253	Ga0157376_10319767	3300014969	Unclassified	1475
254	Ga0163161_10040797	3300017792	Unclassified	3334
255	Ga0207697_10000085	3300025315	Bacteria	41401
256	Ga0207682_10004340	3300025893	Bacteria	5958
257	Ga0207682_10098339	3300025893	Unclassified	1276
258	Ga0207682_10133363	3300025893	Bacteria	1110
259	Ga0207688_10000477	3300025901	Bacteria	19238
260	Ga0207645_10003702	3300025907	Bacteria	11524
261	Ga0207645_10062267	3300025907	Unclassified	2383
262	Ga0207643_10000621	3300025908	Bacteria	22386
263	Ga0207684_10212459	3300025910	Unclassified	1669
264	Ga0207660_10073388	3300025917	Bacteria	2494
265	Ga0207660_10103712	3300025917	Bacteria	2128
266	Ga0207660_10254882	3300025917	Bacteria	1386
267	Ga0207662_10002877	3300025918	Bacteria	8720
268	Ga0207662_10014197	3300025918	Unclassified	4464
269	Ga0207662_10040127	3300025918	Bacteria	2750
270	Ga0207652_10178074	3300025921	Bacteria	1910
271	Ga0207681_10028097	3300025923	Unclassified	3642
272	Ga0207681_10052137	3300025923	Unclassified	2773
273	Ga0207681_10077536	3300025923	Bacteria	2336
274	Ga0207694_10128725	3300025924	Unclassified	2028
275	Ga0207650_10077603	3300025925	Bacteria	2511
276	Ga0207650_10106941	3300025925	Bacteria	2161
277	Ga0207650_10112395	3300025925	Bacteria	2110
278	Ga0207659_10000547	3300025926	Bacteria	22456
279	Ga0207659_10116422	3300025926	Bacteria	2041
280	Ga0207659_10189335	3300025926	Bacteria	1636
281	Ga0207659_10214664	3300025926	Bacteria	1544
282	Ga0207659_10331607	3300025926	Bacteria	1258
283	Ga0207659_10479231	3300025926	Bacteria	1051
284	Ga0207700_10031883	3300025928	Unclassified	3750
285	Ga0207706_10020983	3300025933	Bacteria	5867
286	Ga0207706_10042590	3300025933	Unclassified	4024
287	Ga0207706_10192384	3300025933	Unclassified	1790
288	Ga0207706_10222844	3300025933	Bacteria	1651
289	Ga0207686_10003823	3300025934	Bacteria	8078
290	Ga0207670_10003124	3300025936	Bacteria	8763
291	Ga0207704_10032951	3300025938	Unclassified	2940
292	Ga0207704_10044612	3300025938	Unclassified	2628
293	Ga0207691_10003154	3300025940	Bacteria	16120
294	Ga0207691_10007941	3300025940	Bacteria	10211
295	Ga0207691_10021840	3300025940	Bacteria	6040
296	Ga0207691_10024570	3300025940	Bacteria	5667
297	Ga0207691_10067367	3300025940	Unclassified	3237
298	Ga0207691_10120000	3300025940	Bacteria	2331
299	Ga0207691_10133152	3300025940	Unclassified	2194
300	Ga0207711_10076965	3300025941	Bacteria	2907
301	Ga0207711_10149237	3300025941	Unclassified	2108
302	Ga0207689_10000730	3300025942	Bacteria	31588
303	Ga0207689_10026601	3300025942	Bacteria	4847
304	Ga0207689_10297269	3300025942	Bacteria	1338
305	Ga0207661_10032991	3300025944	Bacteria	4017
306	Ga0207679_10005523	3300025945	Bacteria	7923
307	Ga0207679_10009365	3300025945	Bacteria	6272
308	Ga0207679_10029965	3300025945	Bacteria	3794
309	Ga0207679_10044628	3300025945	Bacteria	3199
310	Ga0207679_10136554	3300025945	Bacteria	1975
311	Ga0207679_10306229	3300025945	Bacteria	1371
312	Ga0207651_10002308	3300025960	Bacteria	9081
313	Ga0207651_10011973	3300025960	Bacteria	4882
314	Ga0207651_10077908	3300025960	Bacteria	2375
315	Ga0207651_10280912	3300025960	Bacteria	1376
316	Ga0207712_10036037	3300025961	Bacteria	3366
317	Ga0207668_10040494	3300025972	Unclassified	3144
318	Ga0207668_10229840	3300025972	Bacteria	1495
319	Ga0207640_10159506	3300025981	Unclassified	1667
320	Ga0207658_10474987	3300025986	Bacteria	1110
321	Ga0207703_10081061	3300026035	Bacteria	2704
322	Ga0207708_10004080	3300026075	Bacteria	10735
323	Ga0207708_10036402	3300026075	Bacteria	3746
324	Ga0207708_10056667	3300026075	Unclassified	2989
325	Ga0207641_10031880	3300026088	Unclassified	4373
326	Ga0207641_10047429	3300026088	Bacteria	3623
327	Ga0207641_10165122	3300026088	Unclassified	2016
328	Ga0207648_10001255	3300026089	Bacteria	28363
329	Ga0207648_10076683	3300026089	Bacteria	2914
330	Ga0207648_10176409	3300026089	Bacteria	1890
331	Ga0207676_10006765	3300026095	Bacteria	8116
332	Ga0207676_10027097	3300026095	Unclassified	4265
333	Ga0207676_10053732	3300026095	Bacteria	3153
334	Ga0207676_10157447	3300026095	Unclassified	1964
335	Ga0207674_10065431	3300026116	Unclassified	3664
336	Ga0207674_10123552	3300026116	Bacteria	2554
337	Ga0207674_10157618	3300026116	Bacteria	2225
338	Ga0207675_100006796	3300026118	Bacteria	10827
339	Ga0207675_100064392	3300026118	Bacteria	3427
340	Ga0207683_10001698	3300026121	Bacteria	19704
341	Ga0207683_10006182	3300026121	Bacteria	10259
342	Ga0207683_10040293	3300026121	Unclassified	4075
343	Ga0207683_10059793	3300026121	Unclassified	3348
344	Ga0207683_10351075	3300026121	Bacteria	1354
345	Ga0207683_10456042	3300026121	Bacteria	1179
346	Ga0207698_10105434	3300026142	Bacteria	2349
347	Ga0210000_1019767	3300027462	Bacteria	1026
348	Ga0210002_1019359	3300027617	Bacteria	1092
349	Ga0207428_10000345	3300027907	Bacteria	60424
350	Ga0207428_10000442	3300027907	Bacteria	50837
351	Ga0207428_10000936	3300027907	Bacteria	32455
352	Ga0207428_10001419	3300027907	Bacteria	25210
353	Ga0207428_10045473	3300027907	Bacteria	3535
354	Ga0268265_10000237	3300028380	Bacteria	62935
355	Ga0268265_10069547	3300028380	Bacteria	2734
356	Ga0268264_10014068	3300028381	Bacteria	6577
357	Ga0268264_10093247	3300028381	Bacteria	2601
358	Ga0268264_10175491	3300028381	Bacteria	1942
359	Ga0268264_10583070	3300028381	Bacteria	1100
360	Ga0307408_100010751	3300031548	Bacteria	6039
361	Ga0307408_100052266	3300031548	Bacteria	2946
362	Ga0307408_100073015	3300031548	Unclassified	2541
363	Ga0307408_100154870	3300031548	Unclassified	1813
364	Ga0307405_10011890	3300031731	Bacteria	4583
365	Ga0307405_10026288	3300031731	Unclassified	3356
366	Ga0307413_10000281	3300031824	Bacteria	15624
367	Ga0307413_10003677	3300031824	Bacteria	6515
368	Ga0307413_10090714	3300031824	Archaea	1989
369	Ga0307413_10392968	3300031824	Unclassified	1084
370	Ga0307410_10001116	3300031852	Bacteria	11737
371	Ga0307410_10007315	3300031852	Bacteria	6035
372	Ga0307406_10038085	3300031901	Bacteria	2975
373	Ga0307407_10000476	3300031903	Bacteria	12313
374	Ga0307407_10003129	3300031903	Bacteria	6698
375	Ga0307407_10025818	3300031903	Unclassified	3103
376	Ga0307407_10027243	3300031903	Bacteria	3037
377	Ga0307412_10048954	3300031911	Bacteria	2782
378	Ga0307412_10321698	3300031911	Bacteria	1231
379	Ga0307409_100001723	3300031995	Bacteria	11029
380	Ga0307409_100355819	3300031995	Bacteria	1383
381	Ga0307416_100001676	3300032002	Bacteria	12247
382	Ga0307416_100005491	3300032002	Bacteria	7790
383	Ga0307416_100085881	3300032002	Unclassified	2680
384	Ga0307416_100326872	3300032002	Bacteria	1539
385	Ga0307414_10005544	3300032004	Bacteria	6960
386	Ga0307411_10010660	3300032005	Bacteria	4913
387	Ga0307411_10022809	3300032005	Unclassified	3695
388	Ga0307411_10037274	3300032005	Unclassified	3056
389	Ga0307411_10072814	3300032005	Bacteria	2334
390	Ga0307411_10332986	3300032005	Bacteria	1231
391	Ga0307415_100025011	3300032126	Unclassified	3740
392	Ga0307415_100043688	3300032126	Bacteria	2991
393	Ga0307415_100068034	3300032126	Unclassified	2491
394	Ga0373935_0261142	3300035692	Bacteria	1215
395	Ga0373947_0081098	3300035725	Unclassified	2008
396	Ga0373937_0003104	3300036401	Bacteria	13890
397	Ga0373937_0016673	3300036401	Bacteria	6527
398	Ga0373925_0237126	3300037068	Bacteria	1460
399	Ga0451853_3952881	3300041512	Unclassified	1678
400	Ga0439450_001785	3300042008	Bacteria	3231
401	Ga0439450_050327	3300042008	Unclassified	988
402	Ga0439435_0028853	3300042436	Bacteria	1494
403	Ga0451577_0106293	3300042876	Bacteria	2509
404	Ga0451576_0012056	3300045051	Bacteria	9756
405	Ga0451576_0402194	3300045051	Unclassified	1436
406	Ga0495629_0001579	3300046459	Bacteria	17918
407	Ga0495594_0113710	3300046499	Unclassified	1527
408	Ga0495643_0020213	3300046522	Bacteria	3844
409	Ga0495598_0086134	3300046537	Unclassified	1016
410	Ga0495621_0003589	3300046539	Unclassified	4283
411	Ga0495659_0009863	3300046664	Bacteria	3054
412	Ga0495659_0024769	3300046664	Unclassified	2049
413	Ga0495658_0057566	3300046683	Bacteria	2221
414	Ga0495669_0054896	3300046684	Unclassified	1794
415	Ga0495636_0031978	3300047318	Unclassified	2157
416	Ga0495636_0046643	3300047318	Bacteria	1808
417	Ga0495676_0182626	3300047321	Unclassified	1469
418	Ga0496112_0240961	3300048915	Unclassified	1761
419	Ga0501031_0108958	3300049568	Bacteria	1809
420	Ga0501031_0333986	3300049568	Unclassified	981
421	Ga0501036_0112401	3300049572	Bacteria	2302
422	Ga0501036_0209311	3300049572	Bacteria	1639
423	Ga0501039_0047470	3300049575	Bacteria	3319
424	Ga0501039_0282917	3300049575	Unclassified	1304
425	Ga0501040_0275441	3300049576	Bacteria	1202
426	Ga0501042_0003074	3300049578	Bacteria	10391
427	Ga0501048_0107783	3300049582	Unclassified	1967
428	Ga0501072_0238147	3300049588	Bacteria	1449
429	Ga0501074_0193737	3300049590	Unclassified	1449
430	Ga0501076_0091208	3300049592	Bacteria	2451
431	Ga0501076_0252073	3300049592	Unclassified	1445
432	Ga0501080_0228804	3300049742	Unclassified	1700
433	Ga0501081_0001556	3300049743	Bacteria	14107
434	Ga0501081_0138184	3300049743	Unclassified	1745
435	Ga0501283_001370	3300049779	Unclassified	3177
436	Ga0501045_0396793	3300049824	Bacteria	1027
437	nmdc:mga03683_84341_c1	3300050489	Unclassified	1377
438	nmdc:mga00v17_25707_c1	3300050491	Bacteria	3425
439	nmdc:mga00v17_36200_c1	3300050491	Bacteria	2941
440	nmdc:mga0k408_38599_c1	3300050493	Bacteria	2741
441	nmdc:mga0k408_8736_c1	3300050493	Bacteria	5450
442	nmdc:mga06z11_3097_c1	3300050494	Bacteria	6413
443	nmdc:mga04h51_10742_c1	3300050495	Unclassified	2523
444	nmdc:mga05p37_133454_c1	3300050507	Bacteria	3046
445	nmdc:mga05p37_2349_c1	3300050507	Bacteria	22009
446	nmdc:mga05p37_238863_c1	3300050507	Bacteria	2186
447	nmdc:mga05p37_305773_c1	3300050507	Bacteria	1887
448	nmdc:mga05p37_4374_c2	3300050507	Bacteria	15031
449	nmdc:mga05p37_943148_c1	3300050507	Unclassified	925
450	nmdc:mga09592_233185_c1	3300050508	Unclassified	1595
451	nmdc:mga09592_3519_c1	3300050508	Bacteria	12655
452	nmdc:mga09592_3756_c1	3300050508	Bacteria	12236
453	nmdc:mga0qj67_159030_c1	3300050509	Unclassified	1834
454	nmdc:mga0qj67_3596_c1	3300050509	Bacteria	11187
455	nmdc:mga0qj67_38670_c1	3300050509	Unclassified	3744
456	nmdc:mga06r32_197813_c1	3300050510	Bacteria	1997
457	nmdc:mga06r32_45751_c1	3300050510	Bacteria	4173
458	nmdc:mga06r32_546362_c1	3300050510	Unclassified	1133
459	nmdc:mga06r32_57304_c1	3300050510	Bacteria	3742
460	nmdc:mga06r32_7864_c1	3300050510	Bacteria	9582
461	nmdc:mga08y16_14912_c1	3300050511	Bacteria	8176
462	nmdc:mga08y16_22565_c1	3300050511	Bacteria	6646
463	nmdc:mga08y16_3381_c1	3300050511	Bacteria	16532
464	nmdc:mga08y16_435515_c1	3300050511	Unclassified	1339
465	nmdc:mga08y16_522_c1	3300050511	Bacteria	35470
466	nmdc:mga08y16_655_c1	3300050511	Bacteria	32531
467	nmdc:mga08y16_99899_c1	3300050511	Bacteria	3021
468	nmdc:mga0n895_19699_c1	3300050512	Bacteria	6274
469	nmdc:mga0n895_200866_c1	3300050512	Bacteria	2025
470	nmdc:mga0n895_203631_c1	3300050512	Bacteria	2010
471	nmdc:mga0n895_2718_c1	3300050512	Bacteria	13953
472	nmdc:mga0n895_302214_c1	3300050512	Bacteria	1622
473	nmdc:mga0n895_44652_c1	3300050512	Unclassified	4321
474	nmdc:mga0n895_48405_c1	3300050512	Bacteria	4161
475	nmdc:mga0n895_539379_c1	3300050512	Unclassified	1173
476	nmdc:mga0n895_74865_c1	3300050512	Bacteria	3364
477	nmdc:mga0rr50_10108_c1	3300050513	Bacteria	5971
478	nmdc:mga0rr50_129949_c1	3300050513	Bacteria	2015
479	nmdc:mga0rr50_75778_c1	3300050513	Unclassified	2580
480	nmdc:mga0rr50_99129_c1	3300050513	Unclassified	2285
481	nmdc:mga0a205_1056_c1	3300050515	Bacteria	22922
482	nmdc:mga0a205_22703_c1	3300050515	Bacteria	5948
483	nmdc:mga0a205_319205_c1	3300050515	Bacteria	1425
484	nmdc:mga0a205_49009_c1	3300050515	Unclassified	4077
485	nmdc:mga0a205_577_c1	3300050515	Bacteria	29054
486	nmdc:mga0a205_9085_c1	3300050515	Bacteria	9068
487	Ga0500592_014186	3300053116	Bacteria	1277
488	Ga0500568_0009522	3300053139	Bacteria	4605
489	Ga0500645_000938	3300053730	Bacteria	16640
490	Ga0501084_0046832	3300054114	Unclassified	3622
491	Ga0590071_000261	3300059421	Bacteria	15373
492	Ga0590071_001280	3300059421	Bacteria	6752
493	Ga0590071_003210	3300059421	Bacteria	4039
494	Ga0590074_000684	3300059423	Bacteria	5160
495	Ga0590075_001776	3300059424	Bacteria	5280
496	Ga0590077_000488	3300059426	Bacteria	11123
497	Ga0590077_000949	3300059426	Bacteria	7390
498	Ga0590077_005159	3300059426	Unclassified	2674
499	Ga0501082_0277536	3300060353	Unclassified	1459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300032002	Ga0307416_100085881	Ga0307416_1000858813	276
2	3300059421	Ga0590071_003210	Ga0590071_003210_1610_2464	276
3	3300059426	Ga0590077_005159	Ga0590077_005159_1247_2101	276
4	3300049572	Ga0501036_0209311	Ga0501036_0209311_77_925	277
5	3300049582	Ga0501048_0107783	Ga0501048_0107783_495_1343	277
6	3300050491	nmdc:mga00v17_36200_c1	nmdc:mga00v17_36200_c1_1370_2221	277
7	3300050495	nmdc:mga04h51_10742_c1	nmdc:mga04h51_10742_c1_256_1107	277
8	3300059421	Ga0590071_000261	Ga0590071_000261_3315_4154	277
9	3300059421	Ga0590071_001280	Ga0590071_001280_1069_1902	277
10	3300059423	Ga0590074_000684	Ga0590074_000684_3456_4295	277
11	3300059424	Ga0590075_001776	Ga0590075_001776_1166_1999	277
12	3300059426	Ga0590077_000488	Ga0590077_000488_9688_10527	277
13	3300059426	Ga0590077_000949	Ga0590077_000949_5430_6263	277
14	3300031548	Ga0307408_100052266	Ga0307408_1000522663	278
15	3300031852	Ga0307410_10001116	Ga0307410_1000111611	278
16	3300031903	Ga0307407_10003129	Ga0307407_100031298	278
17	3300031911	Ga0307412_10048954	Ga0307412_100489541	278
18	3300032002	Ga0307416_100005491	Ga0307416_1000054913	278
19	3300032004	Ga0307414_10005544	Ga0307414_100055448	278
20	3300032005	Ga0307411_10010660	Ga0307411_100106606	278
21	3300032126	Ga0307415_100043688	Ga0307415_1000436884	278
22	3300050512	nmdc:mga0n895_200866_c1	nmdc:mga0n895_200866_c1_250_1149	278
23	3300050515	nmdc:mga0a205_319205_c1	nmdc:mga0a205_319205_c1_405_1304	278
24	3300031824	Ga0307413_10003677	Ga0307413_100036778	279
25	3300005354	Ga0070675_100036220	Ga0070675_1000362202	281
26	3300005364	Ga0070673_100078190	Ga0070673_1000781903	281
27	3300005456	Ga0070678_100490911	Ga0070678_1004909111	281
28	3300025926	Ga0207659_10479231	Ga0207659_104792311	281
29	3300026121	Ga0207683_10351075	Ga0207683_103510752	281
30	3300005518	Ga0070699_100054894	Ga0070699_1000548942	284
31	3300009147	Ga0114129_10003827	Ga0114129_1000382711	284
32	3300025928	Ga0207700_10031883	Ga0207700_100318834	284
33	3300031548	Ga0307408_100154870	Ga0307408_1001548702	284
34	3300031731	Ga0307405_10026288	Ga0307405_100262882	284
35	3300031824	Ga0307413_10392968	Ga0307413_103929681	284
36	3300031903	Ga0307407_10025818	Ga0307407_100258182	284
37	3300032126	Ga0307415_100068034	Ga0307415_1000680343	284
38	3300036401	Ga0373937_0003104	Ga0373937_0003104_1506_2360	284
39	3300046684	Ga0495669_0054896	Ga0495669_0054896_573_1427	284
40	3300005293	Ga0065715_10162833	Ga0065715_101628332	285
41	3300005330	Ga0070690_100094924	Ga0070690_1000949243	285
42	3300005331	Ga0070670_100052011	Ga0070670_1000520114	285
43	3300005336	Ga0070680_100241786	Ga0070680_1002417862	285
44	3300005340	Ga0070689_100092388	Ga0070689_1000923882	285
45	3300005343	Ga0070687_100017018	Ga0070687_1000170182	285
46	3300005353	Ga0070669_100003108	Ga0070669_1000031082	285
47	3300005354	Ga0070675_100000181	Ga0070675_10000018129	285
48	3300005355	Ga0070671_100047463	Ga0070671_1000474634	285
49	3300005365	Ga0070688_100045516	Ga0070688_1000455161	285
50	3300005438	Ga0070701_10001595	Ga0070701_100015956	285
51	3300005438	Ga0070701_10122190	Ga0070701_101221902	285
52	3300005458	Ga0070681_10008640	Ga0070681_100086408	285
53	3300005459	Ga0068867_100007526	Ga0068867_1000075268	285
54	3300005466	Ga0070685_10016873	Ga0070685_100168735	285
55	3300005518	Ga0070699_100026606	Ga0070699_1000266066	285
56	3300005544	Ga0070686_100042313	Ga0070686_1000423132	285
57	3300005549	Ga0070704_100004914	Ga0070704_1000049144	285
58	3300005564	Ga0070664_100023446	Ga0070664_1000234462	285
59	3300005577	Ga0068857_100365836	Ga0068857_1003658362	285
60	3300005617	Ga0068859_100002081	Ga0068859_10000208122	285
61	3300005617	Ga0068859_100055985	Ga0068859_1000559855	285
62	3300005617	Ga0068859_100259028	Ga0068859_1002590282	285
63	3300005719	Ga0068861_100001989	Ga0068861_1000019893	285
64	3300005842	Ga0068858_100008296	Ga0068858_1000082963	285
65	3300005843	Ga0068860_100030186	Ga0068860_1000301865	285
66	3300005844	Ga0068862_100001000	Ga0068862_1000010006	285
67	3300006028	Ga0070717_10154992	Ga0070717_101549923	285
68	3300006358	Ga0068871_100054844	Ga0068871_1000548442	285
69	3300006358	Ga0068871_100101262	Ga0068871_1001012623	285
70	3300006844	Ga0075428_100031532	Ga0075428_1000315325	285
71	3300006852	Ga0075433_10072686	Ga0075433_100726864	285
72	3300006871	Ga0075434_100199459	Ga0075434_1001994592	285
73	3300006880	Ga0075429_100138674	Ga0075429_1001386742	285
74	3300006931	Ga0097620_100002081	Ga0097620_1000020812	285
75	3300006931	Ga0097620_100055986	Ga0097620_1000559865	285
76	3300006931	Ga0097620_100259030	Ga0097620_1002590302	285
77	3300007076	Ga0075435_100111452	Ga0075435_1001114523	285
78	3300009147	Ga0114129_10133015	Ga0114129_101330152	285
79	3300025907	Ga0207645_10062267	Ga0207645_100622673	285
80	3300025917	Ga0207660_10073388	Ga0207660_100733882	285
81	3300025918	Ga0207662_10014197	Ga0207662_100141973	285
82	3300025921	Ga0207652_10178074	Ga0207652_101780742	285
83	3300025923	Ga0207681_10052137	Ga0207681_100521372	285
84	3300025925	Ga0207650_10106941	Ga0207650_101069412	285
85	3300025926	Ga0207659_10000547	Ga0207659_1000054712	285
86	3300025933	Ga0207706_10042590	Ga0207706_100425904	285
87	3300025936	Ga0207670_10003124	Ga0207670_100031249	285
88	3300025938	Ga0207704_10044612	Ga0207704_100446122	285
89	3300025940	Ga0207691_10067367	Ga0207691_100673673	285
90	3300025940	Ga0207691_10133152	Ga0207691_101331523	285
91	3300025945	Ga0207679_10136554	Ga0207679_101365542	285
92	3300025945	Ga0207679_10306229	Ga0207679_103062291	285
93	3300025960	Ga0207651_10077908	Ga0207651_100779082	285
94	3300025972	Ga0207668_10040494	Ga0207668_100404944	285
95	3300026035	Ga0207703_10081061	Ga0207703_100810612	285
96	3300026075	Ga0207708_10056667	Ga0207708_100566674	285
97	3300026088	Ga0207641_10031880	Ga0207641_100318802	285
98	3300026088	Ga0207641_10165122	Ga0207641_101651221	285
99	3300026089	Ga0207648_10001255	Ga0207648_1000125517	285
100	3300026095	Ga0207676_10006765	Ga0207676_100067657	285
101	3300026095	Ga0207676_10027097	Ga0207676_100270971	285
102	3300026116	Ga0207674_10065431	Ga0207674_100654313	285
103	3300026118	Ga0207675_100006796	Ga0207675_1000067963	285
104	3300027907	Ga0207428_10000442	Ga0207428_1000044223	285
105	3300028380	Ga0268265_10000237	Ga0268265_1000023724	285
106	3300028381	Ga0268264_10014068	Ga0268264_100140687	285
107	3300036401	Ga0373937_0016673	Ga0373937_0016673_353_1228	285
108	3300050507	nmdc:mga05p37_943148_c1	nmdc:mga05p37_943148_c1_37_894	285
109	3300050511	nmdc:mga08y16_522_c1	nmdc:mga08y16_522_c1_16760_17617	285
110	3300050512	nmdc:mga0n895_203631_c1	nmdc:mga0n895_203631_c1_787_1644	285
111	3300050515	nmdc:mga0a205_22703_c1	nmdc:mga0a205_22703_c1_3656_4513	285
112	3300005344	Ga0070661_100017755	Ga0070661_1000177552	286
113	3300005354	Ga0070675_100091413	Ga0070675_1000914131	286
114	3300005354	Ga0070675_100197040	Ga0070675_1001970402	286
115	3300005445	Ga0070708_100113193	Ga0070708_1001131932	286
116	3300005467	Ga0070706_100221511	Ga0070706_1002215112	286
117	3300005518	Ga0070699_100006186	Ga0070699_10000618611	286
118	3300005536	Ga0070697_100314417	Ga0070697_1003144172	286
119	3300005564	Ga0070664_100011840	Ga0070664_1000118402	286
120	3300006051	Ga0075364_10008338	Ga0075364_100083385	286
121	3300006177	Ga0075362_10002470	Ga0075362_100024702	286
122	3300006195	Ga0075366_10149229	Ga0075366_101492292	286
123	3300006844	Ga0075428_100189115	Ga0075428_1001891152	286
124	3300006871	Ga0075434_100011713	Ga0075434_1000117136	286
125	3300009094	Ga0111539_10100896	Ga0111539_101008963	286
126	3300009147	Ga0114129_10004740	Ga0114129_100047402	286
127	3300009147	Ga0114129_10013194	Ga0114129_1001319412	286
128	3300009176	Ga0105242_10343627	Ga0105242_103436272	286
129	3300009553	Ga0105249_10004359	Ga0105249_100043591	286
130	3300010375	Ga0105239_10673862	Ga0105239_106738622	286
131	3300013297	Ga0157378_10353734	Ga0157378_103537342	286
132	3300013306	Ga0163162_10155873	Ga0163162_101558732	286
133	3300013308	Ga0157375_10062316	Ga0157375_100623164	286
134	3300014325	Ga0163163_10230907	Ga0163163_102309072	286
135	3300014745	Ga0157377_10084601	Ga0157377_100846012	286
136	3300014745	Ga0157377_10092196	Ga0157377_100921962	286
137	3300014968	Ga0157379_10115840	Ga0157379_101158403	286
138	3300025910	Ga0207684_10212459	Ga0207684_102124591	286
139	3300025926	Ga0207659_10116422	Ga0207659_101164223	286
140	3300025926	Ga0207659_10214664	Ga0207659_102146642	286
141	3300025945	Ga0207679_10029965	Ga0207679_100299654	286
142	3300042876	Ga0451577_0106293	Ga0451577_0106293_462_1322	286
143	3300045051	Ga0451576_0012056	Ga0451576_0012056_2415_3275	286
144	3300046664	Ga0495659_0009863	Ga0495659_0009863_2034_2894	286
145	3300046664	Ga0495659_0024769	Ga0495659_0024769_379_1239	286
146	3300047318	Ga0495636_0031978	Ga0495636_0031978_844_1704	286
147	3300050489	nmdc:mga03683_84341_c1	nmdc:mga03683_84341_c1_422_1300	286
148	3300050493	nmdc:mga0k408_38599_c1	nmdc:mga0k408_38599_c1_1336_2214	286
149	3300050493	nmdc:mga0k408_8736_c1	nmdc:mga0k408_8736_c1_2418_3296	286
150	3300050507	nmdc:mga05p37_2349_c1	nmdc:mga05p37_2349_c1_15259_16119	286
151	3300050507	nmdc:mga05p37_305773_c1	nmdc:mga05p37_305773_c1_401_1261	286
152	3300050509	nmdc:mga0qj67_159030_c1	nmdc:mga0qj67_159030_c1_731_1591	286
153	3300050510	nmdc:mga06r32_197813_c1	nmdc:mga06r32_197813_c1_326_1186	286
154	3300050512	nmdc:mga0n895_2718_c1	nmdc:mga0n895_2718_c1_497_1357	286
155	3300050512	nmdc:mga0n895_302214_c1	nmdc:mga0n895_302214_c1_376_1236	286
156	3300050512	nmdc:mga0n895_44652_c1	nmdc:mga0n895_44652_c1_1417_2277	286
157	3300050512	nmdc:mga0n895_539379_c1	nmdc:mga0n895_539379_c1_85_945	286
158	3300050513	nmdc:mga0rr50_75778_c1	nmdc:mga0rr50_75778_c1_604_1464	286
159	3300050513	nmdc:mga0rr50_99129_c1	nmdc:mga0rr50_99129_c1_1415_2275	286
160	3300050515	nmdc:mga0a205_49009_c1	nmdc:mga0a205_49009_c1_1548_2408	286
161	3300005340	Ga0070689_100020315	Ga0070689_1000203152	287
162	3300005353	Ga0070669_100067002	Ga0070669_1000670023	287
163	3300005438	Ga0070701_10021309	Ga0070701_100213091	287
164	3300005459	Ga0068867_100038928	Ga0068867_1000389284	287
165	3300005536	Ga0070697_100016970	Ga0070697_1000169705	287
166	3300005539	Ga0068853_100663495	Ga0068853_1006634951	287
167	3300005543	Ga0070672_100017524	Ga0070672_1000175241	287
168	3300005546	Ga0070696_100017816	Ga0070696_1000178165	287
169	3300005547	Ga0070693_100011703	Ga0070693_1000117033	287
170	3300005549	Ga0070704_100013198	Ga0070704_1000131982	287
171	3300005549	Ga0070704_100063525	Ga0070704_1000635254	287
172	3300007076	Ga0075435_100004954	Ga0075435_1000049545	287
173	3300009098	Ga0105245_10050194	Ga0105245_100501942	287
174	3300009148	Ga0105243_10073284	Ga0105243_100732842	287
175	3300013308	Ga0157375_10153377	Ga0157375_101533774	287
176	3300025917	Ga0207660_10103712	Ga0207660_101037122	287
177	3300025934	Ga0207686_10003823	Ga0207686_100038235	287
178	3300025940	Ga0207691_10007941	Ga0207691_100079413	287
179	3300025960	Ga0207651_10002308	Ga0207651_100023084	287
180	3300025981	Ga0207640_10159506	Ga0207640_101595062	287
181	3300026088	Ga0207641_10047429	Ga0207641_100474292	287
182	3300026142	Ga0207698_10105434	Ga0207698_101054343	287
183	3300046459	Ga0495629_0001579	Ga0495629_0001579_15449_16312	287
184	3300046499	Ga0495594_0113710	Ga0495594_0113710_156_1019	287
185	3300046539	Ga0495621_0003589	Ga0495621_0003589_2607_3473	287
186	3300046683	Ga0495658_0057566	Ga0495658_0057566_116_979	287
187	3300047321	Ga0495676_0182626	Ga0495676_0182626_471_1334	287
188	3300050512	nmdc:mga0n895_74865_c1	nmdc:mga0n895_74865_c1_1819_2730	287
189	3300050513	nmdc:mga0rr50_10108_c1	nmdc:mga0rr50_10108_c1_733_1644	287
190	3300005290	Ga0065712_10021874	Ga0065712_100218741	288
191	3300005328	Ga0070676_10114112	Ga0070676_101141121	288
192	3300005329	Ga0070683_100165917	Ga0070683_1001659172	288
193	3300005354	Ga0070675_100001605	Ga0070675_10000160516	288
194	3300005364	Ga0070673_100005828	Ga0070673_1000058281	288
195	3300005364	Ga0070673_100065159	Ga0070673_1000651592	288
196	3300005441	Ga0070700_100126219	Ga0070700_1001262191	288
197	3300005530	Ga0070679_100247043	Ga0070679_1002470432	288
198	3300005535	Ga0070684_100030172	Ga0070684_1000301725	288
199	3300005543	Ga0070672_100046838	Ga0070672_1000468383	288
200	3300005545	Ga0070695_100013403	Ga0070695_1000134033	288
201	3300005549	Ga0070704_100069631	Ga0070704_1000696314	288
202	3300005564	Ga0070664_100017829	Ga0070664_1000178292	288
203	3300005564	Ga0070664_100078369	Ga0070664_1000783692	288
204	3300005615	Ga0070702_100129238	Ga0070702_1001292382	288
205	3300005617	Ga0068859_100031902	Ga0068859_1000319023	288
206	3300005617	Ga0068859_100146620	Ga0068859_1001466202	288
207	3300005618	Ga0068864_100005332	Ga0068864_10000533211	288
208	3300005719	Ga0068861_100040666	Ga0068861_1000406661	288
209	3300005842	Ga0068858_100032206	Ga0068858_1000322063	288
210	3300005843	Ga0068860_100157178	Ga0068860_1001571783	288
211	3300005844	Ga0068862_100668177	Ga0068862_1006681771	288
212	3300006051	Ga0075364_10002442	Ga0075364_100024426	288
213	3300006178	Ga0075367_10000547	Ga0075367_100005473	288
214	3300006846	Ga0075430_100007736	Ga0075430_1000077365	288
215	3300006847	Ga0075431_100028278	Ga0075431_1000282784	288
216	3300006931	Ga0097620_100031901	Ga0097620_1000319013	288
217	3300006931	Ga0097620_100146611	Ga0097620_1001466112	288
218	3300009094	Ga0111539_10098221	Ga0111539_100982212	288
219	3300009147	Ga0114129_10179991	Ga0114129_101799912	288
220	3300009147	Ga0114129_10823718	Ga0114129_108237181	288
221	3300009174	Ga0105241_10011519	Ga0105241_100115191	288
222	3300009551	Ga0105238_10134942	Ga0105238_101349424	288
223	3300009553	Ga0105249_10383441	Ga0105249_103834412	288
224	3300014326	Ga0157380_10535090	Ga0157380_105350902	288
225	3300025907	Ga0207645_10003702	Ga0207645_100037029	288
226	3300025918	Ga0207662_10002877	Ga0207662_100028771	288
227	3300025918	Ga0207662_10040127	Ga0207662_100401272	288
228	3300025925	Ga0207650_10077603	Ga0207650_100776032	288
229	3300025926	Ga0207659_10331607	Ga0207659_103316072	288
230	3300025940	Ga0207691_10021840	Ga0207691_100218403	288
231	3300025941	Ga0207711_10149237	Ga0207711_101492373	288
232	3300025944	Ga0207661_10032991	Ga0207661_100329913	288
233	3300025945	Ga0207679_10009365	Ga0207679_100093652	288
234	3300025960	Ga0207651_10011973	Ga0207651_100119734	288
235	3300025961	Ga0207712_10036037	Ga0207712_100360374	288
236	3300026075	Ga0207708_10036402	Ga0207708_100364021	288
237	3300026089	Ga0207648_10076683	Ga0207648_100766835	288
238	3300026095	Ga0207676_10053732	Ga0207676_100537322	288
239	3300026116	Ga0207674_10157618	Ga0207674_101576183	288
240	3300026118	Ga0207675_100064392	Ga0207675_1000643924	288
241	3300028381	Ga0268264_10175491	Ga0268264_101754913	288
242	3300028381	Ga0268264_10583070	Ga0268264_105830701	288
243	3300031548	Ga0307408_100010751	Ga0307408_1000107512	288
244	3300031824	Ga0307413_10090714	Ga0307413_100907143	288
245	3300031903	Ga0307407_10000476	Ga0307407_100004763	288
246	3300031903	Ga0307407_10027243	Ga0307407_100272433	288
247	3300031995	Ga0307409_100001723	Ga0307409_10000172312	288
248	3300032005	Ga0307411_10022809	Ga0307411_100228092	288
249	3300032005	Ga0307411_10072814	Ga0307411_100728141	288
250	3300032005	Ga0307411_10332986	Ga0307411_103329861	288
251	3300035725	Ga0373947_0081098	Ga0373947_0081098_977_1864	288
252	3300046522	Ga0495643_0020213	Ga0495643_0020213_1971_2846	288
253	3300046537	Ga0495598_0086134	Ga0495598_0086134_79_945	288
254	3300047318	Ga0495636_0046643	Ga0495636_0046643_794_1663	288
255	3300048915	Ga0496112_0240961	Ga0496112_0240961_266_1156	288
256	3300049568	Ga0501031_0108958	Ga0501031_0108958_689_1588	288
257	3300049572	Ga0501036_0112401	Ga0501036_0112401_293_1192	288
258	3300049575	Ga0501039_0047470	Ga0501039_0047470_1678_2577	288
259	3300049588	Ga0501072_0238147	Ga0501072_0238147_268_1167	288
260	3300049592	Ga0501076_0091208	Ga0501076_0091208_346_1245	288
261	3300049592	Ga0501076_0252073	Ga0501076_0252073_362_1246	288
262	3300050491	nmdc:mga00v17_25707_c1	nmdc:mga00v17_25707_c1_1630_2514	288
263	3300050494	nmdc:mga06z11_3097_c1	nmdc:mga06z11_3097_c1_2212_3096	288
264	3300050507	nmdc:mga05p37_4374_c2	nmdc:mga05p37_4374_c2_11770_12666	288
265	3300050509	nmdc:mga0qj67_38670_c1	nmdc:mga0qj67_38670_c1_2806_3702	288
266	3300050511	nmdc:mga08y16_3381_c1	nmdc:mga08y16_3381_c1_13350_14216	288
267	3300053116	Ga0500592_014186	Ga0500592_014186_209_1093	288
268	3300053730	Ga0500645_000938	Ga0500645_000938_4553_5437	288
269	3300005440	Ga0070705_100006602	Ga0070705_1000066024	289
270	3300005440	Ga0070705_100023905	Ga0070705_1000239052	289
271	3300005441	Ga0070700_100172659	Ga0070700_1001726592	289
272	3300005444	Ga0070694_100010078	Ga0070694_1000100784	289
273	3300005545	Ga0070695_100023179	Ga0070695_1000231792	289
274	3300005546	Ga0070696_100001143	Ga0070696_1000011434	289
275	3300005549	Ga0070704_100003993	Ga0070704_1000039934	289
276	3300006847	Ga0075431_100022643	Ga0075431_1000226432	289
277	3300006852	Ga0075433_10018488	Ga0075433_100184885	289
278	3300006871	Ga0075434_100011335	Ga0075434_1000113358	289
279	3300006880	Ga0075429_100124680	Ga0075429_1001246802	289
280	3300009094	Ga0111539_10471932	Ga0111539_104719322	289
281	3300009147	Ga0114129_10007052	Ga0114129_100070528	289
282	3300009148	Ga0105243_10113070	Ga0105243_101130702	289
283	3300025917	Ga0207660_10254882	Ga0207660_102548822	289
284	3300025933	Ga0207706_10222844	Ga0207706_102228443	289
285	3300027907	Ga0207428_10045473	Ga0207428_100454734	289
286	3300031731	Ga0307405_10011890	Ga0307405_100118903	289
287	3300031824	Ga0307413_10000281	Ga0307413_100002817	289
288	3300031852	Ga0307410_10007315	Ga0307410_100073152	289
289	3300031901	Ga0307406_10038085	Ga0307406_100380853	289
290	3300031995	Ga0307409_100355819	Ga0307409_1003558192	289
291	3300032002	Ga0307416_100001676	Ga0307416_10000167611	289
292	3300035692	Ga0373935_0261142	Ga0373935_0261142_165_1040	289
293	3300037068	Ga0373925_0237126	Ga0373925_0237126_161_1036	289
294	3300041512	Ga0451853_3952881	Ga0451853_3952881_497_1372	289
295	3300049779	Ga0501283_001370	Ga0501283_001370_1722_2609	289
296	3300049824	Ga0501045_0396793	Ga0501045_0396793_132_1001	289
297	3300050508	nmdc:mga09592_233185_c1	nmdc:mga09592_233185_c1_98_985	289
298	3300050510	nmdc:mga06r32_45751_c1	nmdc:mga06r32_45751_c1_619_1506	289
299	3300050511	nmdc:mga08y16_435515_c1	nmdc:mga08y16_435515_c1_181_1068	289
300	3300050515	nmdc:mga0a205_9085_c1	nmdc:mga0a205_9085_c1_4107_5003	289
301	3300005459	Ga0068867_100067384	Ga0068867_1000673844	290
302	3300031548	Ga0307408_100073015	Ga0307408_1000730152	290
303	3300031911	Ga0307412_10321698	Ga0307412_103216982	290
304	3300032126	Ga0307415_100025011	Ga0307415_1000250114	290
305	3300005444	Ga0070694_100129835	Ga0070694_1001298351	291
306	3300005471	Ga0070698_100000806	Ga0070698_10000080626	291
307	3300005518	Ga0070699_100000386	Ga0070699_1000003867	291
308	3300005543	Ga0070672_100255593	Ga0070672_1002555932	291
309	3300005546	Ga0070696_100028407	Ga0070696_1000284072	291
310	3300006042	Ga0075368_10009717	Ga0075368_100097173	291
311	3300006051	Ga0075364_10008612	Ga0075364_100086123	291
312	3300006178	Ga0075367_10013077	Ga0075367_100130773	291
313	3300009147	Ga0114129_10324495	Ga0114129_103244952	291
314	3300013308	Ga0157375_10078844	Ga0157375_100788443	291
315	3300014326	Ga0157380_10073950	Ga0157380_100739504	291
316	3300050507	nmdc:mga05p37_133454_c1	nmdc:mga05p37_133454_c1_1228_2115	291
317	3300053139	Ga0500568_0009522	Ga0500568_0009522_800_1693	291
318	3300014326	Ga0157380_10037466	Ga0157380_100374662	292
319	3300049743	Ga0501081_0138184	Ga0501081_0138184_581_1486	293
320	3300005331	Ga0070670_100021290	Ga0070670_1000212906	294
321	3300005333	Ga0070677_10009832	Ga0070677_100098322	294
322	3300005334	Ga0068869_100001451	Ga0068869_10000145112	294
323	3300005353	Ga0070669_100011311	Ga0070669_1000113113	294
324	3300005354	Ga0070675_100014095	Ga0070675_1000140955	294
325	3300005441	Ga0070700_100041666	Ga0070700_1000416662	294
326	3300005459	Ga0068867_100005657	Ga0068867_1000056573	294
327	3300005543	Ga0070672_100061936	Ga0070672_1000619362	294
328	3300005543	Ga0070672_100106192	Ga0070672_1001061923	294
329	3300005544	Ga0070686_100060861	Ga0070686_1000608612	294
330	3300005564	Ga0070664_100087213	Ga0070664_1000872132	294
331	3300005615	Ga0070702_100054594	Ga0070702_1000545943	294
332	3300005841	Ga0068863_100425109	Ga0068863_1004251091	294
333	3300009148	Ga0105243_10049270	Ga0105243_100492704	294
334	3300009176	Ga0105242_10058736	Ga0105242_100587362	294
335	3300009177	Ga0105248_10127391	Ga0105248_101273912	294
336	3300009177	Ga0105248_10243533	Ga0105248_102435333	294
337	3300009551	Ga0105238_10018652	Ga0105238_100186525	294
338	3300013307	Ga0157372_10825026	Ga0157372_108250261	294
339	3300014326	Ga0157380_10007696	Ga0157380_100076963	294
340	3300014326	Ga0157380_10055066	Ga0157380_100550662	294
341	3300014969	Ga0157376_10319767	Ga0157376_103197672	294
342	3300025893	Ga0207682_10133363	Ga0207682_101333631	294
343	3300025924	Ga0207694_10128725	Ga0207694_101287253	294
344	3300025925	Ga0207650_10112395	Ga0207650_101123952	294
345	3300025940	Ga0207691_10120000	Ga0207691_101200003	294
346	3300025941	Ga0207711_10076965	Ga0207711_100769652	294
347	3300025945	Ga0207679_10044628	Ga0207679_100446283	294
348	3300025960	Ga0207651_10280912	Ga0207651_102809121	294
349	3300026121	Ga0207683_10040293	Ga0207683_100402932	294
350	3300005355	Ga0070671_100027688	Ga0070671_1000276886	295
351	3300005364	Ga0070673_100005331	Ga0070673_1000053314	295
352	3300009094	Ga0111539_10029612	Ga0111539_100296125	295
353	3300042436	Ga0439435_0028853	Ga0439435_0028853_247_1149	295
354	3300045051	Ga0451576_0402194	Ga0451576_0402194_509_1405	295
355	3300050507	nmdc:mga05p37_238863_c1	nmdc:mga05p37_238863_c1_194_1117	295
356	3300050511	nmdc:mga08y16_14912_c1	nmdc:mga08y16_14912_c1_2286_3209	295
357	3300050512	nmdc:mga0n895_19699_c1	nmdc:mga0n895_19699_c1_4693_5616	295
358	3300050515	nmdc:mga0a205_577_c1	nmdc:mga0a205_577_c1_8285_9208	295
359	3300005336	Ga0070680_100220353	Ga0070680_1002203531	296
360	3300005354	Ga0070675_100111428	Ga0070675_1001114281	296
361	3300006844	Ga0075428_100215185	Ga0075428_1002151852	296
362	3300009094	Ga0111539_10000065	Ga0111539_1000006573	296
363	3300009094	Ga0111539_10104734	Ga0111539_101047344	296
364	3300027907	Ga0207428_10000936	Ga0207428_1000093620	296
365	3300032002	Ga0307416_100326872	Ga0307416_1003268721	296
366	3300049568	Ga0501031_0333986	Ga0501031_0333986_64_957	296
367	3300049575	Ga0501039_0282917	Ga0501039_0282917_226_1119	296
368	3300049576	Ga0501040_0275441	Ga0501040_0275441_147_1037	296
369	3300049578	Ga0501042_0003074	Ga0501042_0003074_557_1450	296
370	3300049590	Ga0501074_0193737	Ga0501074_0193737_226_1119	296
371	3300049742	Ga0501080_0228804	Ga0501080_0228804_647_1540	296
372	3300049743	Ga0501081_0001556	Ga0501081_0001556_5917_6810	296
373	3300050511	nmdc:mga08y16_655_c1	nmdc:mga08y16_655_c1_29707_30621	296
374	3300054114	Ga0501084_0046832	Ga0501084_0046832_392_1285	296
375	3300060353	Ga0501082_0277536	Ga0501082_0277536_185_1225	296
376	3300006844	Ga0075428_100039996	Ga0075428_1000399963	297
377	3300003203	JGI25406J46586_10005196	JGI25406J46586_100051967	298
378	3300003203	JGI25406J46586_10034937	JGI25406J46586_100349371	298
379	3300005518	Ga0070699_100003990	Ga0070699_1000039903	298
380	3300005985	Ga0081539_10000034	Ga0081539_1000003431	298
381	3300005985	Ga0081539_10000190	Ga0081539_10000190115	298
382	3300005985	Ga0081539_10013318	Ga0081539_100133187	298
383	3300006852	Ga0075433_10187539	Ga0075433_101875392	298
384	3300009094	Ga0111539_10006236	Ga0111539_1000623612	298
385	3300026121	Ga0207683_10456042	Ga0207683_104560421	298
386	3300032005	Ga0307411_10037274	Ga0307411_100372742	298
387	3300050511	nmdc:mga08y16_99899_c1	nmdc:mga08y16_99899_c1_1535_2446	298
388	3300001977	JGI24746J21847_1002469	JGI24746J21847_10024692	299
389	3300005290	Ga0065712_10017582	Ga0065712_100175823	299
390	3300005290	Ga0065712_10136853	Ga0065712_101368531	299
391	3300005293	Ga0065715_10108241	Ga0065715_101082412	299
392	3300005328	Ga0070676_10049700	Ga0070676_100497002	299
393	3300005328	Ga0070676_10154193	Ga0070676_101541932	299
394	3300005330	Ga0070690_100052224	Ga0070690_1000522243	299
395	3300005331	Ga0070670_100092042	Ga0070670_1000920422	299
396	3300005333	Ga0070677_10004874	Ga0070677_100048745	299
397	3300005335	Ga0070666_10028101	Ga0070666_100281013	299
398	3300005336	Ga0070680_100110881	Ga0070680_1001108812	299
399	3300005338	Ga0068868_100017242	Ga0068868_1000172423	299
400	3300005344	Ga0070661_100020971	Ga0070661_1000209712	299
401	3300005347	Ga0070668_100007025	Ga0070668_1000070256	299
402	3300005347	Ga0070668_100071459	Ga0070668_1000714593	299
403	3300005354	Ga0070675_100025498	Ga0070675_1000254983	299
404	3300005354	Ga0070675_100069088	Ga0070675_1000690883	299
405	3300005355	Ga0070671_100014421	Ga0070671_1000144212	299
406	3300005356	Ga0070674_100001218	Ga0070674_10000121813	299
407	3300005356	Ga0070674_100226985	Ga0070674_1002269852	299
408	3300005367	Ga0070667_100008511	Ga0070667_1000085114	299
409	3300005367	Ga0070667_100327767	Ga0070667_1003277672	299
410	3300005441	Ga0070700_100006546	Ga0070700_1000065462	299
411	3300005444	Ga0070694_100023863	Ga0070694_1000238634	299
412	3300005456	Ga0070678_100002418	Ga0070678_1000024185	299
413	3300005456	Ga0070678_100059144	Ga0070678_1000591441	299
414	3300005457	Ga0070662_100006797	Ga0070662_1000067975	299
415	3300005457	Ga0070662_100281725	Ga0070662_1002817252	299
416	3300005543	Ga0070672_100243087	Ga0070672_1002430871	299
417	3300005544	Ga0070686_100002140	Ga0070686_10000214010	299
418	3300005544	Ga0070686_100078451	Ga0070686_1000784512	299
419	3300005564	Ga0070664_100031216	Ga0070664_1000312163	299
420	3300005577	Ga0068857_100103886	Ga0068857_1001038862	299
421	3300005615	Ga0070702_100038082	Ga0070702_1000380823	299
422	3300005617	Ga0068859_100026056	Ga0068859_1000260563	299
423	3300005617	Ga0068859_100077691	Ga0068859_1000776912	299
424	3300005718	Ga0068866_10135934	Ga0068866_101359341	299
425	3300005719	Ga0068861_100001769	Ga0068861_1000017693	299
426	3300005840	Ga0068870_10025353	Ga0068870_100253532	299
427	3300005841	Ga0068863_100012272	Ga0068863_1000122726	299
428	3300005844	Ga0068862_100004508	Ga0068862_1000045087	299
429	3300005844	Ga0068862_100306821	Ga0068862_1003068212	299
430	3300006237	Ga0097621_100020236	Ga0097621_1000202365	299
431	3300006844	Ga0075428_100003245	Ga0075428_1000032459	299
432	3300006846	Ga0075430_100008767	Ga0075430_1000087674	299
433	3300006847	Ga0075431_100000506	Ga0075431_10000050633	299
434	3300006847	Ga0075431_100020297	Ga0075431_1000202971	299
435	3300006847	Ga0075431_100054247	Ga0075431_1000542474	299
436	3300006847	Ga0075431_100123405	Ga0075431_1001234052	299
437	3300006852	Ga0075433_10003776	Ga0075433_100037766	299
438	3300006880	Ga0075429_100004353	Ga0075429_10000435312	299
439	3300006880	Ga0075429_100014564	Ga0075429_1000145644	299
440	3300006880	Ga0075429_100026929	Ga0075429_1000269291	299
441	3300006881	Ga0068865_100005969	Ga0068865_1000059693	299
442	3300006881	Ga0068865_100260830	Ga0068865_1002608302	299
443	3300006931	Ga0097620_100026053	Ga0097620_1000260533	299
444	3300006931	Ga0097620_100077696	Ga0097620_1000776963	299
445	3300007076	Ga0075435_100040943	Ga0075435_1000409433	299
446	3300009094	Ga0111539_10003505	Ga0111539_1000350524	299
447	3300009101	Ga0105247_10096603	Ga0105247_100966032	299
448	3300009553	Ga0105249_10001042	Ga0105249_1000104212	299
449	3300011119	Ga0105246_10124941	Ga0105246_101249413	299
450	3300013306	Ga0163162_10003027	Ga0163162_100030275	299
451	3300013308	Ga0157375_10067283	Ga0157375_100672833	299
452	3300014326	Ga0157380_10004723	Ga0157380_100047232	299
453	3300014326	Ga0157380_10049787	Ga0157380_100497873	299
454	3300014968	Ga0157379_10003743	Ga0157379_100037437	299
455	3300017792	Ga0163161_10040797	Ga0163161_100407973	299
456	3300025315	Ga0207697_10000085	Ga0207697_1000008520	299
457	3300025893	Ga0207682_10004340	Ga0207682_100043401	299
458	3300025893	Ga0207682_10098339	Ga0207682_100983392	299
459	3300025901	Ga0207688_10000477	Ga0207688_1000047716	299
460	3300025908	Ga0207643_10000621	Ga0207643_1000062116	299
461	3300025923	Ga0207681_10028097	Ga0207681_100280973	299
462	3300025923	Ga0207681_10077536	Ga0207681_100775362	299
463	3300025926	Ga0207659_10189335	Ga0207659_101893351	299
464	3300025933	Ga0207706_10020983	Ga0207706_100209833	299
465	3300025933	Ga0207706_10192384	Ga0207706_101923842	299
466	3300025938	Ga0207704_10032951	Ga0207704_100329512	299
467	3300025940	Ga0207691_10003154	Ga0207691_1000315417	299
468	3300025940	Ga0207691_10024570	Ga0207691_100245705	299
469	3300025942	Ga0207689_10000730	Ga0207689_100007308	299
470	3300025942	Ga0207689_10026601	Ga0207689_100266015	299
471	3300025942	Ga0207689_10297269	Ga0207689_102972691	299
472	3300025945	Ga0207679_10005523	Ga0207679_100055233	299
473	3300025972	Ga0207668_10229840	Ga0207668_102298401	299
474	3300025986	Ga0207658_10474987	Ga0207658_104749872	299
475	3300026075	Ga0207708_10004080	Ga0207708_100040807	299
476	3300026089	Ga0207648_10176409	Ga0207648_101764091	299
477	3300026095	Ga0207676_10157447	Ga0207676_101574471	299
478	3300026116	Ga0207674_10123552	Ga0207674_101235522	299
479	3300026121	Ga0207683_10001698	Ga0207683_1000169813	299
480	3300026121	Ga0207683_10006182	Ga0207683_100061822	299
481	3300026121	Ga0207683_10059793	Ga0207683_100597932	299
482	3300027462	Ga0210000_1019767	Ga0210000_10197672	299
483	3300027617	Ga0210002_1019359	Ga0210002_10193592	299
484	3300027907	Ga0207428_10000345	Ga0207428_1000034516	299
485	3300027907	Ga0207428_10001419	Ga0207428_1000141912	299
486	3300028380	Ga0268265_10069547	Ga0268265_100695473	299
487	3300028381	Ga0268264_10093247	Ga0268264_100932472	299
488	3300042008	Ga0439450_001785	Ga0439450_001785_950_1852	299
489	3300042008	Ga0439450_050327	Ga0439450_050327_74_973	299
490	3300050508	nmdc:mga09592_3519_c1	nmdc:mga09592_3519_c1_2552_3451	299
491	3300050508	nmdc:mga09592_3756_c1	nmdc:mga09592_3756_c1_9708_10643	299
492	3300050509	nmdc:mga0qj67_3596_c1	nmdc:mga0qj67_3596_c1_3035_3970	299
493	3300050510	nmdc:mga06r32_546362_c1	nmdc:mga06r32_546362_c1_20_991	299
494	3300050510	nmdc:mga06r32_57304_c1	nmdc:mga06r32_57304_c1_2372_3271	299
495	3300050510	nmdc:mga06r32_7864_c1	nmdc:mga06r32_7864_c1_6078_7013	299
496	3300050511	nmdc:mga08y16_22565_c1	nmdc:mga08y16_22565_c1_3922_4821	299
497	3300050512	nmdc:mga0n895_48405_c1	nmdc:mga0n895_48405_c1_1775_2674	299
498	3300050513	nmdc:mga0rr50_129949_c1	nmdc:mga0rr50_129949_c1_661_1560	299
499	3300050515	nmdc:mga0a205_1056_c1	nmdc:mga0a205_1056_c1_15859_16758	299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

87

329

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4e2z-assembly1.cif.gz_A	x-ray structure of the h225n mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and sugar product	0.8348	226	281
8s9n-assembly1.cif.gz_A-2	dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - c2 crystal form	0.8309	21	283
8s9o-assembly1.cif.gz_B	dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form	0.8247	21	283
8s9o-assembly1.cif.gz_A	dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form	0.8127	21	283
3egi-assembly1.cif.gz_D	methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form)	0.8046	225	285

ID	Description	Score	Start	End	Superfamily
af_P9WJZ3_50_210_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8497	226	284	3.40.50.150
af_Q58893_2_289_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8134	20	286	3.40.50.150
3tmaA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.801	20	166	3.40.50.150
af_K7LNZ3_16_140_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.7762	33	88	3.40.50.150
1g60B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.7702	21	278	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A382HT07-F1-model_v4	site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113)	0.9203	3	115	GO:0003677 GO:0008170 GO:0009307 GO:0015667 GO:0032259
AF-A0A7K3Y2D8-F1-model_v4	site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113)	0.9086	24	115	GO:0003677 GO:0008170 GO:0009307 GO:0015667 GO:0032259
AF-A0A7W1TUS8-F1-model_v4	Site-specific DNA-methyltransferase	0.8739	211	286	GO:0003677 GO:0008170 GO:0032259
AF-A0A382HT07-F1-model_v4	site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113)	0.8627	3	115	GO:0003677 GO:0008170 GO:0009307 GO:0015667 GO:0032259
AF-A0A2V8AWG8-F1-model_v4	Methyltransferase (EC 2.1.1.-)	0.8481	7	286	GO:0003677 GO:0008170 GO:0009307 GO:0015667 GO:0032259

Feature Viewer

pLDDT	pTM	Quality
75.74	0.79	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455453

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01555

N6_N4_Mtase

DNA methylase

87

329

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map