F455453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 499 | 208 | 499 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300060353|Ga0501082_0277536|Ga0501082_0277536_185_1225 |
| Length | 346 |
| Sequence | VIGRYRELATSREVSYVEEKGTQCELHGHRRNHTIPEHLTAVVAAVTIAVVHRSVDPHTTFKSARAAFRFYLGDCLDVLSRLPDRSVDVIVTSPPYNLGIRYRSYDDTMPRHDYLKWTGEWVQHVARLLAPDGSLFLNVGAKPTDPWTAMDVAQAVRPHLRLQNTIHWIKSIAIEKSLAGARANLEDDLAVGHYKPINSRRFVHDCHEFVFHFSASGETPIDRRAIGVRYQDQSNVGRWRTAASGVRCRGNTWFIPYETIQSREKDRPHPATFPPKLPEMCLRLHGLERTRLVADPFLGLGSTAVACAELGVSFIGIEMDEGYLEEAVERTRAALPPAATGRARAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 159 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 160 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 186 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 188 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 190 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 191 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 192 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 201 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 205 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 206 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 207 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 208 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.61 |
| Nodule | 0 |
| Rhizoplane | 0.2 |
| Rhizosphere | 95.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1002469 | 3300001977 | Bacteria | 2942 |
| 2 | JGI25406J46586_10005196 | 3300003203 | Bacteria | 6037 |
| 3 | JGI25406J46586_10034937 | 3300003203 | Bacteria | 1839 |
| 4 | Ga0065712_10017582 | 3300005290 | Bacteria | 2379 |
| 5 | Ga0065712_10021874 | 3300005290 | Bacteria | 1475 |
| 6 | Ga0065712_10136853 | 3300005290 | Bacteria | 1489 |
| 7 | Ga0065715_10108241 | 3300005293 | Bacteria | 2729 |
| 8 | Ga0065715_10162833 | 3300005293 | Bacteria | 1613 |
| 9 | Ga0070676_10049700 | 3300005328 | Bacteria | 2456 |
| 10 | Ga0070676_10114112 | 3300005328 | Unclassified | 1686 |
| 11 | Ga0070676_10154193 | 3300005328 | Bacteria | 1473 |
| 12 | Ga0070683_100165917 | 3300005329 | Bacteria | 2095 |
| 13 | Ga0070690_100052224 | 3300005330 | Bacteria | 2612 |
| 14 | Ga0070690_100094924 | 3300005330 | Unclassified | 1969 |
| 15 | Ga0070670_100021290 | 3300005331 | Bacteria | 5578 |
| 16 | Ga0070670_100052011 | 3300005331 | Unclassified | 3517 |
| 17 | Ga0070670_100092042 | 3300005331 | Unclassified | 2607 |
| 18 | Ga0070677_10004874 | 3300005333 | Bacteria | 4406 |
| 19 | Ga0070677_10009832 | 3300005333 | Unclassified | 3254 |
| 20 | Ga0068869_100001451 | 3300005334 | Bacteria | 14018 |
| 21 | Ga0070666_10028101 | 3300005335 | Bacteria | 3689 |
| 22 | Ga0070680_100110881 | 3300005336 | Bacteria | 2284 |
| 23 | Ga0070680_100220353 | 3300005336 | Bacteria | 1601 |
| 24 | Ga0070680_100241786 | 3300005336 | Bacteria | 1526 |
| 25 | Ga0068868_100017242 | 3300005338 | Bacteria | 5375 |
| 26 | Ga0070689_100020315 | 3300005340 | Bacteria | 4926 |
| 27 | Ga0070689_100092388 | 3300005340 | Unclassified | 2387 |
| 28 | Ga0070687_100017018 | 3300005343 | Unclassified | 3333 |
| 29 | Ga0070661_100017755 | 3300005344 | Bacteria | 5050 |
| 30 | Ga0070661_100020971 | 3300005344 | Bacteria | 4665 |
| 31 | Ga0070668_100007025 | 3300005347 | Bacteria | 8342 |
| 32 | Ga0070668_100071459 | 3300005347 | Unclassified | 2703 |
| 33 | Ga0070669_100003108 | 3300005353 | Bacteria | 11951 |
| 34 | Ga0070669_100011311 | 3300005353 | Bacteria | 6336 |
| 35 | Ga0070669_100067002 | 3300005353 | Bacteria | 2647 |
| 36 | Ga0070675_100000181 | 3300005354 | Bacteria | 39301 |
| 37 | Ga0070675_100001605 | 3300005354 | Bacteria | 16679 |
| 38 | Ga0070675_100014095 | 3300005354 | Bacteria | 6298 |
| 39 | Ga0070675_100025498 | 3300005354 | Unclassified | 4739 |
| 40 | Ga0070675_100036220 | 3300005354 | Bacteria | 4014 |
| 41 | Ga0070675_100069088 | 3300005354 | Bacteria | 2926 |
| 42 | Ga0070675_100091413 | 3300005354 | Bacteria | 2550 |
| 43 | Ga0070675_100111428 | 3300005354 | Bacteria | 2316 |
| 44 | Ga0070675_100197040 | 3300005354 | Bacteria | 1747 |
| 45 | Ga0070671_100014421 | 3300005355 | Bacteria | 6386 |
| 46 | Ga0070671_100027688 | 3300005355 | Bacteria | 4666 |
| 47 | Ga0070671_100047463 | 3300005355 | Unclassified | 3571 |
| 48 | Ga0070674_100001218 | 3300005356 | Bacteria | 13509 |
| 49 | Ga0070674_100226985 | 3300005356 | Unclassified | 1455 |
| 50 | Ga0070673_100005331 | 3300005364 | Bacteria | 8210 |
| 51 | Ga0070673_100005828 | 3300005364 | Bacteria | 7941 |
| 52 | Ga0070673_100065159 | 3300005364 | Bacteria | 2905 |
| 53 | Ga0070673_100078190 | 3300005364 | Bacteria | 2676 |
| 54 | Ga0070688_100045516 | 3300005365 | Bacteria | 2712 |
| 55 | Ga0070667_100008511 | 3300005367 | Bacteria | 8505 |
| 56 | Ga0070667_100327767 | 3300005367 | Unclassified | 1383 |
| 57 | Ga0070701_10001595 | 3300005438 | Bacteria | 8444 |
| 58 | Ga0070701_10021309 | 3300005438 | Bacteria | 3090 |
| 59 | Ga0070701_10122190 | 3300005438 | Unclassified | 1469 |
| 60 | Ga0070705_100006602 | 3300005440 | Bacteria | 5696 |
| 61 | Ga0070705_100023905 | 3300005440 | Bacteria | 3290 |
| 62 | Ga0070700_100006546 | 3300005441 | Bacteria | 6231 |
| 63 | Ga0070700_100041666 | 3300005441 | Unclassified | 2816 |
| 64 | Ga0070700_100126219 | 3300005441 | Unclassified | 1721 |
| 65 | Ga0070700_100172659 | 3300005441 | Bacteria | 1498 |
| 66 | Ga0070694_100010078 | 3300005444 | Bacteria | 5812 |
| 67 | Ga0070694_100023863 | 3300005444 | Bacteria | 3941 |
| 68 | Ga0070694_100129835 | 3300005444 | Bacteria | 1819 |
| 69 | Ga0070708_100113193 | 3300005445 | Unclassified | 2496 |
| 70 | Ga0070678_100002418 | 3300005456 | Bacteria | 10229 |
| 71 | Ga0070678_100059144 | 3300005456 | Bacteria | 2816 |
| 72 | Ga0070678_100490911 | 3300005456 | Bacteria | 1082 |
| 73 | Ga0070662_100006797 | 3300005457 | Bacteria | 7394 |
| 74 | Ga0070662_100281725 | 3300005457 | Unclassified | 1345 |
| 75 | Ga0070681_10008640 | 3300005458 | Bacteria | 9985 |
| 76 | Ga0068867_100005657 | 3300005459 | Bacteria | 8863 |
| 77 | Ga0068867_100007526 | 3300005459 | Bacteria | 7702 |
| 78 | Ga0068867_100038928 | 3300005459 | Bacteria | 3464 |
| 79 | Ga0068867_100067384 | 3300005459 | Bacteria | 2669 |
| 80 | Ga0070685_10016873 | 3300005466 | Unclassified | 3898 |
| 81 | Ga0070706_100221511 | 3300005467 | Unclassified | 1766 |
| 82 | Ga0070698_100000806 | 3300005471 | Bacteria | 34225 |
| 83 | Ga0070699_100000386 | 3300005518 | Bacteria | 42744 |
| 84 | Ga0070699_100003990 | 3300005518 | Bacteria | 13037 |
| 85 | Ga0070699_100006186 | 3300005518 | Bacteria | 10458 |
| 86 | Ga0070699_100026606 | 3300005518 | Unclassified | 4988 |
| 87 | Ga0070699_100054894 | 3300005518 | Unclassified | 3450 |
| 88 | Ga0070679_100247043 | 3300005530 | Unclassified | 1741 |
| 89 | Ga0070684_100030172 | 3300005535 | Unclassified | 4605 |
| 90 | Ga0070697_100016970 | 3300005536 | Bacteria | 5724 |
| 91 | Ga0070697_100314417 | 3300005536 | Bacteria | 1348 |
| 92 | Ga0068853_100663495 | 3300005539 | Bacteria | 993 |
| 93 | Ga0070672_100017524 | 3300005543 | Bacteria | 5158 |
| 94 | Ga0070672_100046838 | 3300005543 | Bacteria | 3352 |
| 95 | Ga0070672_100061936 | 3300005543 | Unclassified | 2951 |
| 96 | Ga0070672_100106192 | 3300005543 | Bacteria | 2284 |
| 97 | Ga0070672_100243087 | 3300005543 | Bacteria | 1514 |
| 98 | Ga0070672_100255593 | 3300005543 | Unclassified | 1476 |
| 99 | Ga0070686_100002140 | 3300005544 | Bacteria | 10884 |
| 100 | Ga0070686_100042313 | 3300005544 | Unclassified | 2853 |
| 101 | Ga0070686_100060861 | 3300005544 | Unclassified | 2438 |
| 102 | Ga0070686_100078451 | 3300005544 | Unclassified | 2180 |
| 103 | Ga0070695_100013403 | 3300005545 | Unclassified | 4926 |
| 104 | Ga0070695_100023179 | 3300005545 | Bacteria | 3812 |
| 105 | Ga0070696_100001143 | 3300005546 | Bacteria | 17208 |
| 106 | Ga0070696_100017816 | 3300005546 | Bacteria | 4795 |
| 107 | Ga0070696_100028407 | 3300005546 | Bacteria | 3818 |
| 108 | Ga0070693_100011703 | 3300005547 | Bacteria | 4424 |
| 109 | Ga0070704_100003993 | 3300005549 | Bacteria | 8507 |
| 110 | Ga0070704_100004914 | 3300005549 | Bacteria | 7759 |
| 111 | Ga0070704_100013198 | 3300005549 | Bacteria | 5121 |
| 112 | Ga0070704_100063525 | 3300005549 | Bacteria | 2650 |
| 113 | Ga0070704_100069631 | 3300005549 | Bacteria | 2550 |
| 114 | Ga0070664_100011840 | 3300005564 | Bacteria | 7081 |
| 115 | Ga0070664_100017829 | 3300005564 | Bacteria | 5830 |
| 116 | Ga0070664_100023446 | 3300005564 | Bacteria | 5098 |
| 117 | Ga0070664_100031216 | 3300005564 | Unclassified | 4449 |
| 118 | Ga0070664_100078369 | 3300005564 | Bacteria | 2843 |
| 119 | Ga0070664_100087213 | 3300005564 | Bacteria | 2698 |
| 120 | Ga0068857_100103886 | 3300005577 | Bacteria | 2551 |
| 121 | Ga0068857_100365836 | 3300005577 | Bacteria | 1337 |
| 122 | Ga0070702_100038082 | 3300005615 | Bacteria | 2675 |
| 123 | Ga0070702_100054594 | 3300005615 | Unclassified | 2300 |
| 124 | Ga0070702_100129238 | 3300005615 | Bacteria | 1593 |
| 125 | Ga0068859_100002081 | 3300005617 | Bacteria | 20395 |
| 126 | Ga0068859_100026056 | 3300005617 | Bacteria | 5867 |
| 127 | Ga0068859_100031902 | 3300005617 | Bacteria | 5292 |
| 128 | Ga0068859_100055985 | 3300005617 | Bacteria | 3968 |
| 129 | Ga0068859_100077691 | 3300005617 | Bacteria | 3360 |
| 130 | Ga0068859_100146620 | 3300005617 | Bacteria | 2435 |
| 131 | Ga0068859_100259028 | 3300005617 | Unclassified | 1830 |
| 132 | Ga0068864_100005332 | 3300005618 | Bacteria | 10533 |
| 133 | Ga0068866_10135934 | 3300005718 | Bacteria | 1405 |
| 134 | Ga0068861_100001769 | 3300005719 | Bacteria | 13895 |
| 135 | Ga0068861_100001989 | 3300005719 | Bacteria | 13206 |
| 136 | Ga0068861_100040666 | 3300005719 | Bacteria | 3479 |
| 137 | Ga0068870_10025353 | 3300005840 | Unclassified | 2942 |
| 138 | Ga0068863_100012272 | 3300005841 | Bacteria | 8273 |
| 139 | Ga0068863_100425109 | 3300005841 | Bacteria | 1302 |
| 140 | Ga0068858_100008296 | 3300005842 | Bacteria | 9989 |
| 141 | Ga0068858_100032206 | 3300005842 | Bacteria | 4869 |
| 142 | Ga0068860_100030186 | 3300005843 | Bacteria | 5214 |
| 143 | Ga0068860_100157178 | 3300005843 | Bacteria | 2191 |
| 144 | Ga0068862_100001000 | 3300005844 | Bacteria | 27052 |
| 145 | Ga0068862_100004508 | 3300005844 | Bacteria | 11744 |
| 146 | Ga0068862_100306821 | 3300005844 | Bacteria | 1462 |
| 147 | Ga0068862_100668177 | 3300005844 | Bacteria | 1004 |
| 148 | Ga0081539_10000034 | 3300005985 | Bacteria | 307597 |
| 149 | Ga0081539_10000190 | 3300005985 | Bacteria | 142511 |
| 150 | Ga0081539_10013318 | 3300005985 | Bacteria | 6204 |
| 151 | Ga0070717_10154992 | 3300006028 | Bacteria | 1984 |
| 152 | Ga0075368_10009717 | 3300006042 | Bacteria | 3465 |
| 153 | Ga0075364_10002442 | 3300006051 | Bacteria | 10411 |
| 154 | Ga0075364_10008338 | 3300006051 | Bacteria | 6189 |
| 155 | Ga0075364_10008612 | 3300006051 | Bacteria | 6101 |
| 156 | Ga0075362_10002470 | 3300006177 | Bacteria | 6218 |
| 157 | Ga0075367_10000547 | 3300006178 | Bacteria | 14249 |
| 158 | Ga0075367_10013077 | 3300006178 | Bacteria | 4448 |
| 159 | Ga0075366_10149229 | 3300006195 | Unclassified | 1415 |
| 160 | Ga0097621_100020236 | 3300006237 | Bacteria | 5126 |
| 161 | Ga0068871_100054844 | 3300006358 | Unclassified | 3235 |
| 162 | Ga0068871_100101262 | 3300006358 | Bacteria | 2414 |
| 163 | Ga0075428_100003245 | 3300006844 | Bacteria | 17800 |
| 164 | Ga0075428_100031532 | 3300006844 | Bacteria | 5857 |
| 165 | Ga0075428_100039996 | 3300006844 | Bacteria | 5160 |
| 166 | Ga0075428_100189115 | 3300006844 | Bacteria | 2227 |
| 167 | Ga0075428_100215185 | 3300006844 | Bacteria | 2076 |
| 168 | Ga0075430_100007736 | 3300006846 | Bacteria | 9078 |
| 169 | Ga0075430_100008767 | 3300006846 | Bacteria | 8534 |
| 170 | Ga0075431_100000506 | 3300006847 | Bacteria | 32563 |
| 171 | Ga0075431_100020297 | 3300006847 | Bacteria | 6787 |
| 172 | Ga0075431_100022643 | 3300006847 | Bacteria | 6423 |
| 173 | Ga0075431_100028278 | 3300006847 | Bacteria | 5758 |
| 174 | Ga0075431_100054247 | 3300006847 | Bacteria | 4133 |
| 175 | Ga0075431_100123405 | 3300006847 | Unclassified | 2672 |
| 176 | Ga0075433_10003776 | 3300006852 | Bacteria | 11725 |
| 177 | Ga0075433_10018488 | 3300006852 | Bacteria | 5795 |
| 178 | Ga0075433_10072686 | 3300006852 | Bacteria | 3025 |
| 179 | Ga0075433_10187539 | 3300006852 | Unclassified | 1840 |
| 180 | Ga0075434_100011335 | 3300006871 | Bacteria | 8402 |
| 181 | Ga0075434_100011713 | 3300006871 | Bacteria | 8282 |
| 182 | Ga0075434_100199459 | 3300006871 | Unclassified | 2021 |
| 183 | Ga0075429_100004353 | 3300006880 | Bacteria | 12164 |
| 184 | Ga0075429_100014564 | 3300006880 | Bacteria | 6815 |
| 185 | Ga0075429_100026929 | 3300006880 | Bacteria | 4992 |
| 186 | Ga0075429_100124680 | 3300006880 | Bacteria | 2252 |
| 187 | Ga0075429_100138674 | 3300006880 | Bacteria | 2129 |
| 188 | Ga0068865_100005969 | 3300006881 | Bacteria | 7421 |
| 189 | Ga0068865_100260830 | 3300006881 | Unclassified | 1372 |
| 190 | Ga0097620_100002081 | 3300006931 | Bacteria | 20395 |
| 191 | Ga0097620_100026053 | 3300006931 | Bacteria | 5867 |
| 192 | Ga0097620_100031901 | 3300006931 | Bacteria | 5292 |
| 193 | Ga0097620_100055986 | 3300006931 | Bacteria | 3968 |
| 194 | Ga0097620_100077696 | 3300006931 | Bacteria | 3360 |
| 195 | Ga0097620_100146611 | 3300006931 | Bacteria | 2435 |
| 196 | Ga0097620_100259030 | 3300006931 | Unclassified | 1830 |
| 197 | Ga0075435_100004954 | 3300007076 | Bacteria | 9239 |
| 198 | Ga0075435_100040943 | 3300007076 | Bacteria | 3701 |
| 199 | Ga0075435_100111452 | 3300007076 | Unclassified | 2276 |
| 200 | Ga0111539_10000065 | 3300009094 | Bacteria | 106698 |
| 201 | Ga0111539_10003505 | 3300009094 | Bacteria | 20690 |
| 202 | Ga0111539_10006236 | 3300009094 | Bacteria | 15389 |
| 203 | Ga0111539_10029612 | 3300009094 | Bacteria | 6665 |
| 204 | Ga0111539_10098221 | 3300009094 | Bacteria | 3439 |
| 205 | Ga0111539_10100896 | 3300009094 | Unclassified | 3389 |
| 206 | Ga0111539_10104734 | 3300009094 | Unclassified | 3319 |
| 207 | Ga0111539_10471932 | 3300009094 | Unclassified | 1461 |
| 208 | Ga0105245_10050194 | 3300009098 | Bacteria | 3738 |
| 209 | Ga0105247_10096603 | 3300009101 | Bacteria | 1883 |
| 210 | Ga0114129_10003827 | 3300009147 | Bacteria | 21202 |
| 211 | Ga0114129_10004740 | 3300009147 | Bacteria | 19213 |
| 212 | Ga0114129_10007052 | 3300009147 | Bacteria | 15997 |
| 213 | Ga0114129_10013194 | 3300009147 | Bacteria | 11772 |
| 214 | Ga0114129_10133015 | 3300009147 | Bacteria | 3415 |
| 215 | Ga0114129_10179991 | 3300009147 | Unclassified | 2877 |
| 216 | Ga0114129_10324495 | 3300009147 | Unclassified | 2046 |
| 217 | Ga0114129_10823718 | 3300009147 | Bacteria | 1182 |
| 218 | Ga0105243_10049270 | 3300009148 | Unclassified | 3322 |
| 219 | Ga0105243_10073284 | 3300009148 | Bacteria | 2774 |
| 220 | Ga0105243_10113070 | 3300009148 | Bacteria | 2276 |
| 221 | Ga0105241_10011519 | 3300009174 | Bacteria | 6482 |
| 222 | Ga0105242_10058736 | 3300009176 | Unclassified | 3155 |
| 223 | Ga0105242_10343627 | 3300009176 | Bacteria | 1376 |
| 224 | Ga0105248_10127391 | 3300009177 | Unclassified | 2872 |
| 225 | Ga0105248_10243533 | 3300009177 | Unclassified | 2024 |
| 226 | Ga0105238_10018652 | 3300009551 | Bacteria | 7064 |
| 227 | Ga0105238_10134942 | 3300009551 | Unclassified | 2446 |
| 228 | Ga0105249_10001042 | 3300009553 | Bacteria | 24508 |
| 229 | Ga0105249_10004359 | 3300009553 | Bacteria | 12241 |
| 230 | Ga0105249_10383441 | 3300009553 | Bacteria | 1432 |
| 231 | Ga0105239_10673862 | 3300010375 | Unclassified | 1182 |
| 232 | Ga0105246_10124941 | 3300011119 | Bacteria | 1913 |
| 233 | Ga0157378_10353734 | 3300013297 | Bacteria | 1436 |
| 234 | Ga0163162_10003027 | 3300013306 | Bacteria | 16062 |
| 235 | Ga0163162_10155873 | 3300013306 | Bacteria | 2404 |
| 236 | Ga0157372_10825026 | 3300013307 | Unclassified | 1077 |
| 237 | Ga0157375_10062316 | 3300013308 | Unclassified | 3705 |
| 238 | Ga0157375_10067283 | 3300013308 | Bacteria | 3579 |
| 239 | Ga0157375_10078844 | 3300013308 | Bacteria | 3328 |
| 240 | Ga0157375_10153377 | 3300013308 | Bacteria | 2441 |
| 241 | Ga0163163_10230907 | 3300014325 | Bacteria | 1899 |
| 242 | Ga0157380_10004723 | 3300014326 | Bacteria | 9481 |
| 243 | Ga0157380_10007696 | 3300014326 | Bacteria | 7668 |
| 244 | Ga0157380_10037466 | 3300014326 | Bacteria | 3758 |
| 245 | Ga0157380_10049787 | 3300014326 | Bacteria | 3306 |
| 246 | Ga0157380_10055066 | 3300014326 | Unclassified | 3157 |
| 247 | Ga0157380_10073950 | 3300014326 | Bacteria | 2765 |
| 248 | Ga0157380_10535090 | 3300014326 | Archaea | 1146 |
| 249 | Ga0157377_10084601 | 3300014745 | Unclassified | 1861 |
| 250 | Ga0157377_10092196 | 3300014745 | Bacteria | 1791 |
| 251 | Ga0157379_10003743 | 3300014968 | Bacteria | 12937 |
| 252 | Ga0157379_10115840 | 3300014968 | Bacteria | 2409 |
| 253 | Ga0157376_10319767 | 3300014969 | Unclassified | 1475 |
| 254 | Ga0163161_10040797 | 3300017792 | Unclassified | 3334 |
| 255 | Ga0207697_10000085 | 3300025315 | Bacteria | 41401 |
| 256 | Ga0207682_10004340 | 3300025893 | Bacteria | 5958 |
| 257 | Ga0207682_10098339 | 3300025893 | Unclassified | 1276 |
| 258 | Ga0207682_10133363 | 3300025893 | Bacteria | 1110 |
| 259 | Ga0207688_10000477 | 3300025901 | Bacteria | 19238 |
| 260 | Ga0207645_10003702 | 3300025907 | Bacteria | 11524 |
| 261 | Ga0207645_10062267 | 3300025907 | Unclassified | 2383 |
| 262 | Ga0207643_10000621 | 3300025908 | Bacteria | 22386 |
| 263 | Ga0207684_10212459 | 3300025910 | Unclassified | 1669 |
| 264 | Ga0207660_10073388 | 3300025917 | Bacteria | 2494 |
| 265 | Ga0207660_10103712 | 3300025917 | Bacteria | 2128 |
| 266 | Ga0207660_10254882 | 3300025917 | Bacteria | 1386 |
| 267 | Ga0207662_10002877 | 3300025918 | Bacteria | 8720 |
| 268 | Ga0207662_10014197 | 3300025918 | Unclassified | 4464 |
| 269 | Ga0207662_10040127 | 3300025918 | Bacteria | 2750 |
| 270 | Ga0207652_10178074 | 3300025921 | Bacteria | 1910 |
| 271 | Ga0207681_10028097 | 3300025923 | Unclassified | 3642 |
| 272 | Ga0207681_10052137 | 3300025923 | Unclassified | 2773 |
| 273 | Ga0207681_10077536 | 3300025923 | Bacteria | 2336 |
| 274 | Ga0207694_10128725 | 3300025924 | Unclassified | 2028 |
| 275 | Ga0207650_10077603 | 3300025925 | Bacteria | 2511 |
| 276 | Ga0207650_10106941 | 3300025925 | Bacteria | 2161 |
| 277 | Ga0207650_10112395 | 3300025925 | Bacteria | 2110 |
| 278 | Ga0207659_10000547 | 3300025926 | Bacteria | 22456 |
| 279 | Ga0207659_10116422 | 3300025926 | Bacteria | 2041 |
| 280 | Ga0207659_10189335 | 3300025926 | Bacteria | 1636 |
| 281 | Ga0207659_10214664 | 3300025926 | Bacteria | 1544 |
| 282 | Ga0207659_10331607 | 3300025926 | Bacteria | 1258 |
| 283 | Ga0207659_10479231 | 3300025926 | Bacteria | 1051 |
| 284 | Ga0207700_10031883 | 3300025928 | Unclassified | 3750 |
| 285 | Ga0207706_10020983 | 3300025933 | Bacteria | 5867 |
| 286 | Ga0207706_10042590 | 3300025933 | Unclassified | 4024 |
| 287 | Ga0207706_10192384 | 3300025933 | Unclassified | 1790 |
| 288 | Ga0207706_10222844 | 3300025933 | Bacteria | 1651 |
| 289 | Ga0207686_10003823 | 3300025934 | Bacteria | 8078 |
| 290 | Ga0207670_10003124 | 3300025936 | Bacteria | 8763 |
| 291 | Ga0207704_10032951 | 3300025938 | Unclassified | 2940 |
| 292 | Ga0207704_10044612 | 3300025938 | Unclassified | 2628 |
| 293 | Ga0207691_10003154 | 3300025940 | Bacteria | 16120 |
| 294 | Ga0207691_10007941 | 3300025940 | Bacteria | 10211 |
| 295 | Ga0207691_10021840 | 3300025940 | Bacteria | 6040 |
| 296 | Ga0207691_10024570 | 3300025940 | Bacteria | 5667 |
| 297 | Ga0207691_10067367 | 3300025940 | Unclassified | 3237 |
| 298 | Ga0207691_10120000 | 3300025940 | Bacteria | 2331 |
| 299 | Ga0207691_10133152 | 3300025940 | Unclassified | 2194 |
| 300 | Ga0207711_10076965 | 3300025941 | Bacteria | 2907 |
| 301 | Ga0207711_10149237 | 3300025941 | Unclassified | 2108 |
| 302 | Ga0207689_10000730 | 3300025942 | Bacteria | 31588 |
| 303 | Ga0207689_10026601 | 3300025942 | Bacteria | 4847 |
| 304 | Ga0207689_10297269 | 3300025942 | Bacteria | 1338 |
| 305 | Ga0207661_10032991 | 3300025944 | Bacteria | 4017 |
| 306 | Ga0207679_10005523 | 3300025945 | Bacteria | 7923 |
| 307 | Ga0207679_10009365 | 3300025945 | Bacteria | 6272 |
| 308 | Ga0207679_10029965 | 3300025945 | Bacteria | 3794 |
| 309 | Ga0207679_10044628 | 3300025945 | Bacteria | 3199 |
| 310 | Ga0207679_10136554 | 3300025945 | Bacteria | 1975 |
| 311 | Ga0207679_10306229 | 3300025945 | Bacteria | 1371 |
| 312 | Ga0207651_10002308 | 3300025960 | Bacteria | 9081 |
| 313 | Ga0207651_10011973 | 3300025960 | Bacteria | 4882 |
| 314 | Ga0207651_10077908 | 3300025960 | Bacteria | 2375 |
| 315 | Ga0207651_10280912 | 3300025960 | Bacteria | 1376 |
| 316 | Ga0207712_10036037 | 3300025961 | Bacteria | 3366 |
| 317 | Ga0207668_10040494 | 3300025972 | Unclassified | 3144 |
| 318 | Ga0207668_10229840 | 3300025972 | Bacteria | 1495 |
| 319 | Ga0207640_10159506 | 3300025981 | Unclassified | 1667 |
| 320 | Ga0207658_10474987 | 3300025986 | Bacteria | 1110 |
| 321 | Ga0207703_10081061 | 3300026035 | Bacteria | 2704 |
| 322 | Ga0207708_10004080 | 3300026075 | Bacteria | 10735 |
| 323 | Ga0207708_10036402 | 3300026075 | Bacteria | 3746 |
| 324 | Ga0207708_10056667 | 3300026075 | Unclassified | 2989 |
| 325 | Ga0207641_10031880 | 3300026088 | Unclassified | 4373 |
| 326 | Ga0207641_10047429 | 3300026088 | Bacteria | 3623 |
| 327 | Ga0207641_10165122 | 3300026088 | Unclassified | 2016 |
| 328 | Ga0207648_10001255 | 3300026089 | Bacteria | 28363 |
| 329 | Ga0207648_10076683 | 3300026089 | Bacteria | 2914 |
| 330 | Ga0207648_10176409 | 3300026089 | Bacteria | 1890 |
| 331 | Ga0207676_10006765 | 3300026095 | Bacteria | 8116 |
| 332 | Ga0207676_10027097 | 3300026095 | Unclassified | 4265 |
| 333 | Ga0207676_10053732 | 3300026095 | Bacteria | 3153 |
| 334 | Ga0207676_10157447 | 3300026095 | Unclassified | 1964 |
| 335 | Ga0207674_10065431 | 3300026116 | Unclassified | 3664 |
| 336 | Ga0207674_10123552 | 3300026116 | Bacteria | 2554 |
| 337 | Ga0207674_10157618 | 3300026116 | Bacteria | 2225 |
| 338 | Ga0207675_100006796 | 3300026118 | Bacteria | 10827 |
| 339 | Ga0207675_100064392 | 3300026118 | Bacteria | 3427 |
| 340 | Ga0207683_10001698 | 3300026121 | Bacteria | 19704 |
| 341 | Ga0207683_10006182 | 3300026121 | Bacteria | 10259 |
| 342 | Ga0207683_10040293 | 3300026121 | Unclassified | 4075 |
| 343 | Ga0207683_10059793 | 3300026121 | Unclassified | 3348 |
| 344 | Ga0207683_10351075 | 3300026121 | Bacteria | 1354 |
| 345 | Ga0207683_10456042 | 3300026121 | Bacteria | 1179 |
| 346 | Ga0207698_10105434 | 3300026142 | Bacteria | 2349 |
| 347 | Ga0210000_1019767 | 3300027462 | Bacteria | 1026 |
| 348 | Ga0210002_1019359 | 3300027617 | Bacteria | 1092 |
| 349 | Ga0207428_10000345 | 3300027907 | Bacteria | 60424 |
| 350 | Ga0207428_10000442 | 3300027907 | Bacteria | 50837 |
| 351 | Ga0207428_10000936 | 3300027907 | Bacteria | 32455 |
| 352 | Ga0207428_10001419 | 3300027907 | Bacteria | 25210 |
| 353 | Ga0207428_10045473 | 3300027907 | Bacteria | 3535 |
| 354 | Ga0268265_10000237 | 3300028380 | Bacteria | 62935 |
| 355 | Ga0268265_10069547 | 3300028380 | Bacteria | 2734 |
| 356 | Ga0268264_10014068 | 3300028381 | Bacteria | 6577 |
| 357 | Ga0268264_10093247 | 3300028381 | Bacteria | 2601 |
| 358 | Ga0268264_10175491 | 3300028381 | Bacteria | 1942 |
| 359 | Ga0268264_10583070 | 3300028381 | Bacteria | 1100 |
| 360 | Ga0307408_100010751 | 3300031548 | Bacteria | 6039 |
| 361 | Ga0307408_100052266 | 3300031548 | Bacteria | 2946 |
| 362 | Ga0307408_100073015 | 3300031548 | Unclassified | 2541 |
| 363 | Ga0307408_100154870 | 3300031548 | Unclassified | 1813 |
| 364 | Ga0307405_10011890 | 3300031731 | Bacteria | 4583 |
| 365 | Ga0307405_10026288 | 3300031731 | Unclassified | 3356 |
| 366 | Ga0307413_10000281 | 3300031824 | Bacteria | 15624 |
| 367 | Ga0307413_10003677 | 3300031824 | Bacteria | 6515 |
| 368 | Ga0307413_10090714 | 3300031824 | Archaea | 1989 |
| 369 | Ga0307413_10392968 | 3300031824 | Unclassified | 1084 |
| 370 | Ga0307410_10001116 | 3300031852 | Bacteria | 11737 |
| 371 | Ga0307410_10007315 | 3300031852 | Bacteria | 6035 |
| 372 | Ga0307406_10038085 | 3300031901 | Bacteria | 2975 |
| 373 | Ga0307407_10000476 | 3300031903 | Bacteria | 12313 |
| 374 | Ga0307407_10003129 | 3300031903 | Bacteria | 6698 |
| 375 | Ga0307407_10025818 | 3300031903 | Unclassified | 3103 |
| 376 | Ga0307407_10027243 | 3300031903 | Bacteria | 3037 |
| 377 | Ga0307412_10048954 | 3300031911 | Bacteria | 2782 |
| 378 | Ga0307412_10321698 | 3300031911 | Bacteria | 1231 |
| 379 | Ga0307409_100001723 | 3300031995 | Bacteria | 11029 |
| 380 | Ga0307409_100355819 | 3300031995 | Bacteria | 1383 |
| 381 | Ga0307416_100001676 | 3300032002 | Bacteria | 12247 |
| 382 | Ga0307416_100005491 | 3300032002 | Bacteria | 7790 |
| 383 | Ga0307416_100085881 | 3300032002 | Unclassified | 2680 |
| 384 | Ga0307416_100326872 | 3300032002 | Bacteria | 1539 |
| 385 | Ga0307414_10005544 | 3300032004 | Bacteria | 6960 |
| 386 | Ga0307411_10010660 | 3300032005 | Bacteria | 4913 |
| 387 | Ga0307411_10022809 | 3300032005 | Unclassified | 3695 |
| 388 | Ga0307411_10037274 | 3300032005 | Unclassified | 3056 |
| 389 | Ga0307411_10072814 | 3300032005 | Bacteria | 2334 |
| 390 | Ga0307411_10332986 | 3300032005 | Bacteria | 1231 |
| 391 | Ga0307415_100025011 | 3300032126 | Unclassified | 3740 |
| 392 | Ga0307415_100043688 | 3300032126 | Bacteria | 2991 |
| 393 | Ga0307415_100068034 | 3300032126 | Unclassified | 2491 |
| 394 | Ga0373935_0261142 | 3300035692 | Bacteria | 1215 |
| 395 | Ga0373947_0081098 | 3300035725 | Unclassified | 2008 |
| 396 | Ga0373937_0003104 | 3300036401 | Bacteria | 13890 |
| 397 | Ga0373937_0016673 | 3300036401 | Bacteria | 6527 |
| 398 | Ga0373925_0237126 | 3300037068 | Bacteria | 1460 |
| 399 | Ga0451853_3952881 | 3300041512 | Unclassified | 1678 |
| 400 | Ga0439450_001785 | 3300042008 | Bacteria | 3231 |
| 401 | Ga0439450_050327 | 3300042008 | Unclassified | 988 |
| 402 | Ga0439435_0028853 | 3300042436 | Bacteria | 1494 |
| 403 | Ga0451577_0106293 | 3300042876 | Bacteria | 2509 |
| 404 | Ga0451576_0012056 | 3300045051 | Bacteria | 9756 |
| 405 | Ga0451576_0402194 | 3300045051 | Unclassified | 1436 |
| 406 | Ga0495629_0001579 | 3300046459 | Bacteria | 17918 |
| 407 | Ga0495594_0113710 | 3300046499 | Unclassified | 1527 |
| 408 | Ga0495643_0020213 | 3300046522 | Bacteria | 3844 |
| 409 | Ga0495598_0086134 | 3300046537 | Unclassified | 1016 |
| 410 | Ga0495621_0003589 | 3300046539 | Unclassified | 4283 |
| 411 | Ga0495659_0009863 | 3300046664 | Bacteria | 3054 |
| 412 | Ga0495659_0024769 | 3300046664 | Unclassified | 2049 |
| 413 | Ga0495658_0057566 | 3300046683 | Bacteria | 2221 |
| 414 | Ga0495669_0054896 | 3300046684 | Unclassified | 1794 |
| 415 | Ga0495636_0031978 | 3300047318 | Unclassified | 2157 |
| 416 | Ga0495636_0046643 | 3300047318 | Bacteria | 1808 |
| 417 | Ga0495676_0182626 | 3300047321 | Unclassified | 1469 |
| 418 | Ga0496112_0240961 | 3300048915 | Unclassified | 1761 |
| 419 | Ga0501031_0108958 | 3300049568 | Bacteria | 1809 |
| 420 | Ga0501031_0333986 | 3300049568 | Unclassified | 981 |
| 421 | Ga0501036_0112401 | 3300049572 | Bacteria | 2302 |
| 422 | Ga0501036_0209311 | 3300049572 | Bacteria | 1639 |
| 423 | Ga0501039_0047470 | 3300049575 | Bacteria | 3319 |
| 424 | Ga0501039_0282917 | 3300049575 | Unclassified | 1304 |
| 425 | Ga0501040_0275441 | 3300049576 | Bacteria | 1202 |
| 426 | Ga0501042_0003074 | 3300049578 | Bacteria | 10391 |
| 427 | Ga0501048_0107783 | 3300049582 | Unclassified | 1967 |
| 428 | Ga0501072_0238147 | 3300049588 | Bacteria | 1449 |
| 429 | Ga0501074_0193737 | 3300049590 | Unclassified | 1449 |
| 430 | Ga0501076_0091208 | 3300049592 | Bacteria | 2451 |
| 431 | Ga0501076_0252073 | 3300049592 | Unclassified | 1445 |
| 432 | Ga0501080_0228804 | 3300049742 | Unclassified | 1700 |
| 433 | Ga0501081_0001556 | 3300049743 | Bacteria | 14107 |
| 434 | Ga0501081_0138184 | 3300049743 | Unclassified | 1745 |
| 435 | Ga0501283_001370 | 3300049779 | Unclassified | 3177 |
| 436 | Ga0501045_0396793 | 3300049824 | Bacteria | 1027 |
| 437 | nmdc:mga03683_84341_c1 | 3300050489 | Unclassified | 1377 |
| 438 | nmdc:mga00v17_25707_c1 | 3300050491 | Bacteria | 3425 |
| 439 | nmdc:mga00v17_36200_c1 | 3300050491 | Bacteria | 2941 |
| 440 | nmdc:mga0k408_38599_c1 | 3300050493 | Bacteria | 2741 |
| 441 | nmdc:mga0k408_8736_c1 | 3300050493 | Bacteria | 5450 |
| 442 | nmdc:mga06z11_3097_c1 | 3300050494 | Bacteria | 6413 |
| 443 | nmdc:mga04h51_10742_c1 | 3300050495 | Unclassified | 2523 |
| 444 | nmdc:mga05p37_133454_c1 | 3300050507 | Bacteria | 3046 |
| 445 | nmdc:mga05p37_2349_c1 | 3300050507 | Bacteria | 22009 |
| 446 | nmdc:mga05p37_238863_c1 | 3300050507 | Bacteria | 2186 |
| 447 | nmdc:mga05p37_305773_c1 | 3300050507 | Bacteria | 1887 |
| 448 | nmdc:mga05p37_4374_c2 | 3300050507 | Bacteria | 15031 |
| 449 | nmdc:mga05p37_943148_c1 | 3300050507 | Unclassified | 925 |
| 450 | nmdc:mga09592_233185_c1 | 3300050508 | Unclassified | 1595 |
| 451 | nmdc:mga09592_3519_c1 | 3300050508 | Bacteria | 12655 |
| 452 | nmdc:mga09592_3756_c1 | 3300050508 | Bacteria | 12236 |
| 453 | nmdc:mga0qj67_159030_c1 | 3300050509 | Unclassified | 1834 |
| 454 | nmdc:mga0qj67_3596_c1 | 3300050509 | Bacteria | 11187 |
| 455 | nmdc:mga0qj67_38670_c1 | 3300050509 | Unclassified | 3744 |
| 456 | nmdc:mga06r32_197813_c1 | 3300050510 | Bacteria | 1997 |
| 457 | nmdc:mga06r32_45751_c1 | 3300050510 | Bacteria | 4173 |
| 458 | nmdc:mga06r32_546362_c1 | 3300050510 | Unclassified | 1133 |
| 459 | nmdc:mga06r32_57304_c1 | 3300050510 | Bacteria | 3742 |
| 460 | nmdc:mga06r32_7864_c1 | 3300050510 | Bacteria | 9582 |
| 461 | nmdc:mga08y16_14912_c1 | 3300050511 | Bacteria | 8176 |
| 462 | nmdc:mga08y16_22565_c1 | 3300050511 | Bacteria | 6646 |
| 463 | nmdc:mga08y16_3381_c1 | 3300050511 | Bacteria | 16532 |
| 464 | nmdc:mga08y16_435515_c1 | 3300050511 | Unclassified | 1339 |
| 465 | nmdc:mga08y16_522_c1 | 3300050511 | Bacteria | 35470 |
| 466 | nmdc:mga08y16_655_c1 | 3300050511 | Bacteria | 32531 |
| 467 | nmdc:mga08y16_99899_c1 | 3300050511 | Bacteria | 3021 |
| 468 | nmdc:mga0n895_19699_c1 | 3300050512 | Bacteria | 6274 |
| 469 | nmdc:mga0n895_200866_c1 | 3300050512 | Bacteria | 2025 |
| 470 | nmdc:mga0n895_203631_c1 | 3300050512 | Bacteria | 2010 |
| 471 | nmdc:mga0n895_2718_c1 | 3300050512 | Bacteria | 13953 |
| 472 | nmdc:mga0n895_302214_c1 | 3300050512 | Bacteria | 1622 |
| 473 | nmdc:mga0n895_44652_c1 | 3300050512 | Unclassified | 4321 |
| 474 | nmdc:mga0n895_48405_c1 | 3300050512 | Bacteria | 4161 |
| 475 | nmdc:mga0n895_539379_c1 | 3300050512 | Unclassified | 1173 |
| 476 | nmdc:mga0n895_74865_c1 | 3300050512 | Bacteria | 3364 |
| 477 | nmdc:mga0rr50_10108_c1 | 3300050513 | Bacteria | 5971 |
| 478 | nmdc:mga0rr50_129949_c1 | 3300050513 | Bacteria | 2015 |
| 479 | nmdc:mga0rr50_75778_c1 | 3300050513 | Unclassified | 2580 |
| 480 | nmdc:mga0rr50_99129_c1 | 3300050513 | Unclassified | 2285 |
| 481 | nmdc:mga0a205_1056_c1 | 3300050515 | Bacteria | 22922 |
| 482 | nmdc:mga0a205_22703_c1 | 3300050515 | Bacteria | 5948 |
| 483 | nmdc:mga0a205_319205_c1 | 3300050515 | Bacteria | 1425 |
| 484 | nmdc:mga0a205_49009_c1 | 3300050515 | Unclassified | 4077 |
| 485 | nmdc:mga0a205_577_c1 | 3300050515 | Bacteria | 29054 |
| 486 | nmdc:mga0a205_9085_c1 | 3300050515 | Bacteria | 9068 |
| 487 | Ga0500592_014186 | 3300053116 | Bacteria | 1277 |
| 488 | Ga0500568_0009522 | 3300053139 | Bacteria | 4605 |
| 489 | Ga0500645_000938 | 3300053730 | Bacteria | 16640 |
| 490 | Ga0501084_0046832 | 3300054114 | Unclassified | 3622 |
| 491 | Ga0590071_000261 | 3300059421 | Bacteria | 15373 |
| 492 | Ga0590071_001280 | 3300059421 | Bacteria | 6752 |
| 493 | Ga0590071_003210 | 3300059421 | Bacteria | 4039 |
| 494 | Ga0590074_000684 | 3300059423 | Bacteria | 5160 |
| 495 | Ga0590075_001776 | 3300059424 | Bacteria | 5280 |
| 496 | Ga0590077_000488 | 3300059426 | Bacteria | 11123 |
| 497 | Ga0590077_000949 | 3300059426 | Bacteria | 7390 |
| 498 | Ga0590077_005159 | 3300059426 | Unclassified | 2674 |
| 499 | Ga0501082_0277536 | 3300060353 | Unclassified | 1459 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032002 | Ga0307416_100085881 | Ga0307416_1000858813 | 276 |
| 2 | 3300059421 | Ga0590071_003210 | Ga0590071_003210_1610_2464 | 276 |
| 3 | 3300059426 | Ga0590077_005159 | Ga0590077_005159_1247_2101 | 276 |
| 4 | 3300049572 | Ga0501036_0209311 | Ga0501036_0209311_77_925 | 277 |
| 5 | 3300049582 | Ga0501048_0107783 | Ga0501048_0107783_495_1343 | 277 |
| 6 | 3300050491 | nmdc:mga00v17_36200_c1 | nmdc:mga00v17_36200_c1_1370_2221 | 277 |
| 7 | 3300050495 | nmdc:mga04h51_10742_c1 | nmdc:mga04h51_10742_c1_256_1107 | 277 |
| 8 | 3300059421 | Ga0590071_000261 | Ga0590071_000261_3315_4154 | 277 |
| 9 | 3300059421 | Ga0590071_001280 | Ga0590071_001280_1069_1902 | 277 |
| 10 | 3300059423 | Ga0590074_000684 | Ga0590074_000684_3456_4295 | 277 |
| 11 | 3300059424 | Ga0590075_001776 | Ga0590075_001776_1166_1999 | 277 |
| 12 | 3300059426 | Ga0590077_000488 | Ga0590077_000488_9688_10527 | 277 |
| 13 | 3300059426 | Ga0590077_000949 | Ga0590077_000949_5430_6263 | 277 |
| 14 | 3300031548 | Ga0307408_100052266 | Ga0307408_1000522663 | 278 |
| 15 | 3300031852 | Ga0307410_10001116 | Ga0307410_1000111611 | 278 |
| 16 | 3300031903 | Ga0307407_10003129 | Ga0307407_100031298 | 278 |
| 17 | 3300031911 | Ga0307412_10048954 | Ga0307412_100489541 | 278 |
| 18 | 3300032002 | Ga0307416_100005491 | Ga0307416_1000054913 | 278 |
| 19 | 3300032004 | Ga0307414_10005544 | Ga0307414_100055448 | 278 |
| 20 | 3300032005 | Ga0307411_10010660 | Ga0307411_100106606 | 278 |
| 21 | 3300032126 | Ga0307415_100043688 | Ga0307415_1000436884 | 278 |
| 22 | 3300050512 | nmdc:mga0n895_200866_c1 | nmdc:mga0n895_200866_c1_250_1149 | 278 |
| 23 | 3300050515 | nmdc:mga0a205_319205_c1 | nmdc:mga0a205_319205_c1_405_1304 | 278 |
| 24 | 3300031824 | Ga0307413_10003677 | Ga0307413_100036778 | 279 |
| 25 | 3300005354 | Ga0070675_100036220 | Ga0070675_1000362202 | 281 |
| 26 | 3300005364 | Ga0070673_100078190 | Ga0070673_1000781903 | 281 |
| 27 | 3300005456 | Ga0070678_100490911 | Ga0070678_1004909111 | 281 |
| 28 | 3300025926 | Ga0207659_10479231 | Ga0207659_104792311 | 281 |
| 29 | 3300026121 | Ga0207683_10351075 | Ga0207683_103510752 | 281 |
| 30 | 3300005518 | Ga0070699_100054894 | Ga0070699_1000548942 | 284 |
| 31 | 3300009147 | Ga0114129_10003827 | Ga0114129_1000382711 | 284 |
| 32 | 3300025928 | Ga0207700_10031883 | Ga0207700_100318834 | 284 |
| 33 | 3300031548 | Ga0307408_100154870 | Ga0307408_1001548702 | 284 |
| 34 | 3300031731 | Ga0307405_10026288 | Ga0307405_100262882 | 284 |
| 35 | 3300031824 | Ga0307413_10392968 | Ga0307413_103929681 | 284 |
| 36 | 3300031903 | Ga0307407_10025818 | Ga0307407_100258182 | 284 |
| 37 | 3300032126 | Ga0307415_100068034 | Ga0307415_1000680343 | 284 |
| 38 | 3300036401 | Ga0373937_0003104 | Ga0373937_0003104_1506_2360 | 284 |
| 39 | 3300046684 | Ga0495669_0054896 | Ga0495669_0054896_573_1427 | 284 |
| 40 | 3300005293 | Ga0065715_10162833 | Ga0065715_101628332 | 285 |
| 41 | 3300005330 | Ga0070690_100094924 | Ga0070690_1000949243 | 285 |
| 42 | 3300005331 | Ga0070670_100052011 | Ga0070670_1000520114 | 285 |
| 43 | 3300005336 | Ga0070680_100241786 | Ga0070680_1002417862 | 285 |
| 44 | 3300005340 | Ga0070689_100092388 | Ga0070689_1000923882 | 285 |
| 45 | 3300005343 | Ga0070687_100017018 | Ga0070687_1000170182 | 285 |
| 46 | 3300005353 | Ga0070669_100003108 | Ga0070669_1000031082 | 285 |
| 47 | 3300005354 | Ga0070675_100000181 | Ga0070675_10000018129 | 285 |
| 48 | 3300005355 | Ga0070671_100047463 | Ga0070671_1000474634 | 285 |
| 49 | 3300005365 | Ga0070688_100045516 | Ga0070688_1000455161 | 285 |
| 50 | 3300005438 | Ga0070701_10001595 | Ga0070701_100015956 | 285 |
| 51 | 3300005438 | Ga0070701_10122190 | Ga0070701_101221902 | 285 |
| 52 | 3300005458 | Ga0070681_10008640 | Ga0070681_100086408 | 285 |
| 53 | 3300005459 | Ga0068867_100007526 | Ga0068867_1000075268 | 285 |
| 54 | 3300005466 | Ga0070685_10016873 | Ga0070685_100168735 | 285 |
| 55 | 3300005518 | Ga0070699_100026606 | Ga0070699_1000266066 | 285 |
| 56 | 3300005544 | Ga0070686_100042313 | Ga0070686_1000423132 | 285 |
| 57 | 3300005549 | Ga0070704_100004914 | Ga0070704_1000049144 | 285 |
| 58 | 3300005564 | Ga0070664_100023446 | Ga0070664_1000234462 | 285 |
| 59 | 3300005577 | Ga0068857_100365836 | Ga0068857_1003658362 | 285 |
| 60 | 3300005617 | Ga0068859_100002081 | Ga0068859_10000208122 | 285 |
| 61 | 3300005617 | Ga0068859_100055985 | Ga0068859_1000559855 | 285 |
| 62 | 3300005617 | Ga0068859_100259028 | Ga0068859_1002590282 | 285 |
| 63 | 3300005719 | Ga0068861_100001989 | Ga0068861_1000019893 | 285 |
| 64 | 3300005842 | Ga0068858_100008296 | Ga0068858_1000082963 | 285 |
| 65 | 3300005843 | Ga0068860_100030186 | Ga0068860_1000301865 | 285 |
| 66 | 3300005844 | Ga0068862_100001000 | Ga0068862_1000010006 | 285 |
| 67 | 3300006028 | Ga0070717_10154992 | Ga0070717_101549923 | 285 |
| 68 | 3300006358 | Ga0068871_100054844 | Ga0068871_1000548442 | 285 |
| 69 | 3300006358 | Ga0068871_100101262 | Ga0068871_1001012623 | 285 |
| 70 | 3300006844 | Ga0075428_100031532 | Ga0075428_1000315325 | 285 |
| 71 | 3300006852 | Ga0075433_10072686 | Ga0075433_100726864 | 285 |
| 72 | 3300006871 | Ga0075434_100199459 | Ga0075434_1001994592 | 285 |
| 73 | 3300006880 | Ga0075429_100138674 | Ga0075429_1001386742 | 285 |
| 74 | 3300006931 | Ga0097620_100002081 | Ga0097620_1000020812 | 285 |
| 75 | 3300006931 | Ga0097620_100055986 | Ga0097620_1000559865 | 285 |
| 76 | 3300006931 | Ga0097620_100259030 | Ga0097620_1002590302 | 285 |
| 77 | 3300007076 | Ga0075435_100111452 | Ga0075435_1001114523 | 285 |
| 78 | 3300009147 | Ga0114129_10133015 | Ga0114129_101330152 | 285 |
| 79 | 3300025907 | Ga0207645_10062267 | Ga0207645_100622673 | 285 |
| 80 | 3300025917 | Ga0207660_10073388 | Ga0207660_100733882 | 285 |
| 81 | 3300025918 | Ga0207662_10014197 | Ga0207662_100141973 | 285 |
| 82 | 3300025921 | Ga0207652_10178074 | Ga0207652_101780742 | 285 |
| 83 | 3300025923 | Ga0207681_10052137 | Ga0207681_100521372 | 285 |
| 84 | 3300025925 | Ga0207650_10106941 | Ga0207650_101069412 | 285 |
| 85 | 3300025926 | Ga0207659_10000547 | Ga0207659_1000054712 | 285 |
| 86 | 3300025933 | Ga0207706_10042590 | Ga0207706_100425904 | 285 |
| 87 | 3300025936 | Ga0207670_10003124 | Ga0207670_100031249 | 285 |
| 88 | 3300025938 | Ga0207704_10044612 | Ga0207704_100446122 | 285 |
| 89 | 3300025940 | Ga0207691_10067367 | Ga0207691_100673673 | 285 |
| 90 | 3300025940 | Ga0207691_10133152 | Ga0207691_101331523 | 285 |
| 91 | 3300025945 | Ga0207679_10136554 | Ga0207679_101365542 | 285 |
| 92 | 3300025945 | Ga0207679_10306229 | Ga0207679_103062291 | 285 |
| 93 | 3300025960 | Ga0207651_10077908 | Ga0207651_100779082 | 285 |
| 94 | 3300025972 | Ga0207668_10040494 | Ga0207668_100404944 | 285 |
| 95 | 3300026035 | Ga0207703_10081061 | Ga0207703_100810612 | 285 |
| 96 | 3300026075 | Ga0207708_10056667 | Ga0207708_100566674 | 285 |
| 97 | 3300026088 | Ga0207641_10031880 | Ga0207641_100318802 | 285 |
| 98 | 3300026088 | Ga0207641_10165122 | Ga0207641_101651221 | 285 |
| 99 | 3300026089 | Ga0207648_10001255 | Ga0207648_1000125517 | 285 |
| 100 | 3300026095 | Ga0207676_10006765 | Ga0207676_100067657 | 285 |
| 101 | 3300026095 | Ga0207676_10027097 | Ga0207676_100270971 | 285 |
| 102 | 3300026116 | Ga0207674_10065431 | Ga0207674_100654313 | 285 |
| 103 | 3300026118 | Ga0207675_100006796 | Ga0207675_1000067963 | 285 |
| 104 | 3300027907 | Ga0207428_10000442 | Ga0207428_1000044223 | 285 |
| 105 | 3300028380 | Ga0268265_10000237 | Ga0268265_1000023724 | 285 |
| 106 | 3300028381 | Ga0268264_10014068 | Ga0268264_100140687 | 285 |
| 107 | 3300036401 | Ga0373937_0016673 | Ga0373937_0016673_353_1228 | 285 |
| 108 | 3300050507 | nmdc:mga05p37_943148_c1 | nmdc:mga05p37_943148_c1_37_894 | 285 |
| 109 | 3300050511 | nmdc:mga08y16_522_c1 | nmdc:mga08y16_522_c1_16760_17617 | 285 |
| 110 | 3300050512 | nmdc:mga0n895_203631_c1 | nmdc:mga0n895_203631_c1_787_1644 | 285 |
| 111 | 3300050515 | nmdc:mga0a205_22703_c1 | nmdc:mga0a205_22703_c1_3656_4513 | 285 |
| 112 | 3300005344 | Ga0070661_100017755 | Ga0070661_1000177552 | 286 |
| 113 | 3300005354 | Ga0070675_100091413 | Ga0070675_1000914131 | 286 |
| 114 | 3300005354 | Ga0070675_100197040 | Ga0070675_1001970402 | 286 |
| 115 | 3300005445 | Ga0070708_100113193 | Ga0070708_1001131932 | 286 |
| 116 | 3300005467 | Ga0070706_100221511 | Ga0070706_1002215112 | 286 |
| 117 | 3300005518 | Ga0070699_100006186 | Ga0070699_10000618611 | 286 |
| 118 | 3300005536 | Ga0070697_100314417 | Ga0070697_1003144172 | 286 |
| 119 | 3300005564 | Ga0070664_100011840 | Ga0070664_1000118402 | 286 |
| 120 | 3300006051 | Ga0075364_10008338 | Ga0075364_100083385 | 286 |
| 121 | 3300006177 | Ga0075362_10002470 | Ga0075362_100024702 | 286 |
| 122 | 3300006195 | Ga0075366_10149229 | Ga0075366_101492292 | 286 |
| 123 | 3300006844 | Ga0075428_100189115 | Ga0075428_1001891152 | 286 |
| 124 | 3300006871 | Ga0075434_100011713 | Ga0075434_1000117136 | 286 |
| 125 | 3300009094 | Ga0111539_10100896 | Ga0111539_101008963 | 286 |
| 126 | 3300009147 | Ga0114129_10004740 | Ga0114129_100047402 | 286 |
| 127 | 3300009147 | Ga0114129_10013194 | Ga0114129_1001319412 | 286 |
| 128 | 3300009176 | Ga0105242_10343627 | Ga0105242_103436272 | 286 |
| 129 | 3300009553 | Ga0105249_10004359 | Ga0105249_100043591 | 286 |
| 130 | 3300010375 | Ga0105239_10673862 | Ga0105239_106738622 | 286 |
| 131 | 3300013297 | Ga0157378_10353734 | Ga0157378_103537342 | 286 |
| 132 | 3300013306 | Ga0163162_10155873 | Ga0163162_101558732 | 286 |
| 133 | 3300013308 | Ga0157375_10062316 | Ga0157375_100623164 | 286 |
| 134 | 3300014325 | Ga0163163_10230907 | Ga0163163_102309072 | 286 |
| 135 | 3300014745 | Ga0157377_10084601 | Ga0157377_100846012 | 286 |
| 136 | 3300014745 | Ga0157377_10092196 | Ga0157377_100921962 | 286 |
| 137 | 3300014968 | Ga0157379_10115840 | Ga0157379_101158403 | 286 |
| 138 | 3300025910 | Ga0207684_10212459 | Ga0207684_102124591 | 286 |
| 139 | 3300025926 | Ga0207659_10116422 | Ga0207659_101164223 | 286 |
| 140 | 3300025926 | Ga0207659_10214664 | Ga0207659_102146642 | 286 |
| 141 | 3300025945 | Ga0207679_10029965 | Ga0207679_100299654 | 286 |
| 142 | 3300042876 | Ga0451577_0106293 | Ga0451577_0106293_462_1322 | 286 |
| 143 | 3300045051 | Ga0451576_0012056 | Ga0451576_0012056_2415_3275 | 286 |
| 144 | 3300046664 | Ga0495659_0009863 | Ga0495659_0009863_2034_2894 | 286 |
| 145 | 3300046664 | Ga0495659_0024769 | Ga0495659_0024769_379_1239 | 286 |
| 146 | 3300047318 | Ga0495636_0031978 | Ga0495636_0031978_844_1704 | 286 |
| 147 | 3300050489 | nmdc:mga03683_84341_c1 | nmdc:mga03683_84341_c1_422_1300 | 286 |
| 148 | 3300050493 | nmdc:mga0k408_38599_c1 | nmdc:mga0k408_38599_c1_1336_2214 | 286 |
| 149 | 3300050493 | nmdc:mga0k408_8736_c1 | nmdc:mga0k408_8736_c1_2418_3296 | 286 |
| 150 | 3300050507 | nmdc:mga05p37_2349_c1 | nmdc:mga05p37_2349_c1_15259_16119 | 286 |
| 151 | 3300050507 | nmdc:mga05p37_305773_c1 | nmdc:mga05p37_305773_c1_401_1261 | 286 |
| 152 | 3300050509 | nmdc:mga0qj67_159030_c1 | nmdc:mga0qj67_159030_c1_731_1591 | 286 |
| 153 | 3300050510 | nmdc:mga06r32_197813_c1 | nmdc:mga06r32_197813_c1_326_1186 | 286 |
| 154 | 3300050512 | nmdc:mga0n895_2718_c1 | nmdc:mga0n895_2718_c1_497_1357 | 286 |
| 155 | 3300050512 | nmdc:mga0n895_302214_c1 | nmdc:mga0n895_302214_c1_376_1236 | 286 |
| 156 | 3300050512 | nmdc:mga0n895_44652_c1 | nmdc:mga0n895_44652_c1_1417_2277 | 286 |
| 157 | 3300050512 | nmdc:mga0n895_539379_c1 | nmdc:mga0n895_539379_c1_85_945 | 286 |
| 158 | 3300050513 | nmdc:mga0rr50_75778_c1 | nmdc:mga0rr50_75778_c1_604_1464 | 286 |
| 159 | 3300050513 | nmdc:mga0rr50_99129_c1 | nmdc:mga0rr50_99129_c1_1415_2275 | 286 |
| 160 | 3300050515 | nmdc:mga0a205_49009_c1 | nmdc:mga0a205_49009_c1_1548_2408 | 286 |
| 161 | 3300005340 | Ga0070689_100020315 | Ga0070689_1000203152 | 287 |
| 162 | 3300005353 | Ga0070669_100067002 | Ga0070669_1000670023 | 287 |
| 163 | 3300005438 | Ga0070701_10021309 | Ga0070701_100213091 | 287 |
| 164 | 3300005459 | Ga0068867_100038928 | Ga0068867_1000389284 | 287 |
| 165 | 3300005536 | Ga0070697_100016970 | Ga0070697_1000169705 | 287 |
| 166 | 3300005539 | Ga0068853_100663495 | Ga0068853_1006634951 | 287 |
| 167 | 3300005543 | Ga0070672_100017524 | Ga0070672_1000175241 | 287 |
| 168 | 3300005546 | Ga0070696_100017816 | Ga0070696_1000178165 | 287 |
| 169 | 3300005547 | Ga0070693_100011703 | Ga0070693_1000117033 | 287 |
| 170 | 3300005549 | Ga0070704_100013198 | Ga0070704_1000131982 | 287 |
| 171 | 3300005549 | Ga0070704_100063525 | Ga0070704_1000635254 | 287 |
| 172 | 3300007076 | Ga0075435_100004954 | Ga0075435_1000049545 | 287 |
| 173 | 3300009098 | Ga0105245_10050194 | Ga0105245_100501942 | 287 |
| 174 | 3300009148 | Ga0105243_10073284 | Ga0105243_100732842 | 287 |
| 175 | 3300013308 | Ga0157375_10153377 | Ga0157375_101533774 | 287 |
| 176 | 3300025917 | Ga0207660_10103712 | Ga0207660_101037122 | 287 |
| 177 | 3300025934 | Ga0207686_10003823 | Ga0207686_100038235 | 287 |
| 178 | 3300025940 | Ga0207691_10007941 | Ga0207691_100079413 | 287 |
| 179 | 3300025960 | Ga0207651_10002308 | Ga0207651_100023084 | 287 |
| 180 | 3300025981 | Ga0207640_10159506 | Ga0207640_101595062 | 287 |
| 181 | 3300026088 | Ga0207641_10047429 | Ga0207641_100474292 | 287 |
| 182 | 3300026142 | Ga0207698_10105434 | Ga0207698_101054343 | 287 |
| 183 | 3300046459 | Ga0495629_0001579 | Ga0495629_0001579_15449_16312 | 287 |
| 184 | 3300046499 | Ga0495594_0113710 | Ga0495594_0113710_156_1019 | 287 |
| 185 | 3300046539 | Ga0495621_0003589 | Ga0495621_0003589_2607_3473 | 287 |
| 186 | 3300046683 | Ga0495658_0057566 | Ga0495658_0057566_116_979 | 287 |
| 187 | 3300047321 | Ga0495676_0182626 | Ga0495676_0182626_471_1334 | 287 |
| 188 | 3300050512 | nmdc:mga0n895_74865_c1 | nmdc:mga0n895_74865_c1_1819_2730 | 287 |
| 189 | 3300050513 | nmdc:mga0rr50_10108_c1 | nmdc:mga0rr50_10108_c1_733_1644 | 287 |
| 190 | 3300005290 | Ga0065712_10021874 | Ga0065712_100218741 | 288 |
| 191 | 3300005328 | Ga0070676_10114112 | Ga0070676_101141121 | 288 |
| 192 | 3300005329 | Ga0070683_100165917 | Ga0070683_1001659172 | 288 |
| 193 | 3300005354 | Ga0070675_100001605 | Ga0070675_10000160516 | 288 |
| 194 | 3300005364 | Ga0070673_100005828 | Ga0070673_1000058281 | 288 |
| 195 | 3300005364 | Ga0070673_100065159 | Ga0070673_1000651592 | 288 |
| 196 | 3300005441 | Ga0070700_100126219 | Ga0070700_1001262191 | 288 |
| 197 | 3300005530 | Ga0070679_100247043 | Ga0070679_1002470432 | 288 |
| 198 | 3300005535 | Ga0070684_100030172 | Ga0070684_1000301725 | 288 |
| 199 | 3300005543 | Ga0070672_100046838 | Ga0070672_1000468383 | 288 |
| 200 | 3300005545 | Ga0070695_100013403 | Ga0070695_1000134033 | 288 |
| 201 | 3300005549 | Ga0070704_100069631 | Ga0070704_1000696314 | 288 |
| 202 | 3300005564 | Ga0070664_100017829 | Ga0070664_1000178292 | 288 |
| 203 | 3300005564 | Ga0070664_100078369 | Ga0070664_1000783692 | 288 |
| 204 | 3300005615 | Ga0070702_100129238 | Ga0070702_1001292382 | 288 |
| 205 | 3300005617 | Ga0068859_100031902 | Ga0068859_1000319023 | 288 |
| 206 | 3300005617 | Ga0068859_100146620 | Ga0068859_1001466202 | 288 |
| 207 | 3300005618 | Ga0068864_100005332 | Ga0068864_10000533211 | 288 |
| 208 | 3300005719 | Ga0068861_100040666 | Ga0068861_1000406661 | 288 |
| 209 | 3300005842 | Ga0068858_100032206 | Ga0068858_1000322063 | 288 |
| 210 | 3300005843 | Ga0068860_100157178 | Ga0068860_1001571783 | 288 |
| 211 | 3300005844 | Ga0068862_100668177 | Ga0068862_1006681771 | 288 |
| 212 | 3300006051 | Ga0075364_10002442 | Ga0075364_100024426 | 288 |
| 213 | 3300006178 | Ga0075367_10000547 | Ga0075367_100005473 | 288 |
| 214 | 3300006846 | Ga0075430_100007736 | Ga0075430_1000077365 | 288 |
| 215 | 3300006847 | Ga0075431_100028278 | Ga0075431_1000282784 | 288 |
| 216 | 3300006931 | Ga0097620_100031901 | Ga0097620_1000319013 | 288 |
| 217 | 3300006931 | Ga0097620_100146611 | Ga0097620_1001466112 | 288 |
| 218 | 3300009094 | Ga0111539_10098221 | Ga0111539_100982212 | 288 |
| 219 | 3300009147 | Ga0114129_10179991 | Ga0114129_101799912 | 288 |
| 220 | 3300009147 | Ga0114129_10823718 | Ga0114129_108237181 | 288 |
| 221 | 3300009174 | Ga0105241_10011519 | Ga0105241_100115191 | 288 |
| 222 | 3300009551 | Ga0105238_10134942 | Ga0105238_101349424 | 288 |
| 223 | 3300009553 | Ga0105249_10383441 | Ga0105249_103834412 | 288 |
| 224 | 3300014326 | Ga0157380_10535090 | Ga0157380_105350902 | 288 |
| 225 | 3300025907 | Ga0207645_10003702 | Ga0207645_100037029 | 288 |
| 226 | 3300025918 | Ga0207662_10002877 | Ga0207662_100028771 | 288 |
| 227 | 3300025918 | Ga0207662_10040127 | Ga0207662_100401272 | 288 |
| 228 | 3300025925 | Ga0207650_10077603 | Ga0207650_100776032 | 288 |
| 229 | 3300025926 | Ga0207659_10331607 | Ga0207659_103316072 | 288 |
| 230 | 3300025940 | Ga0207691_10021840 | Ga0207691_100218403 | 288 |
| 231 | 3300025941 | Ga0207711_10149237 | Ga0207711_101492373 | 288 |
| 232 | 3300025944 | Ga0207661_10032991 | Ga0207661_100329913 | 288 |
| 233 | 3300025945 | Ga0207679_10009365 | Ga0207679_100093652 | 288 |
| 234 | 3300025960 | Ga0207651_10011973 | Ga0207651_100119734 | 288 |
| 235 | 3300025961 | Ga0207712_10036037 | Ga0207712_100360374 | 288 |
| 236 | 3300026075 | Ga0207708_10036402 | Ga0207708_100364021 | 288 |
| 237 | 3300026089 | Ga0207648_10076683 | Ga0207648_100766835 | 288 |
| 238 | 3300026095 | Ga0207676_10053732 | Ga0207676_100537322 | 288 |
| 239 | 3300026116 | Ga0207674_10157618 | Ga0207674_101576183 | 288 |
| 240 | 3300026118 | Ga0207675_100064392 | Ga0207675_1000643924 | 288 |
| 241 | 3300028381 | Ga0268264_10175491 | Ga0268264_101754913 | 288 |
| 242 | 3300028381 | Ga0268264_10583070 | Ga0268264_105830701 | 288 |
| 243 | 3300031548 | Ga0307408_100010751 | Ga0307408_1000107512 | 288 |
| 244 | 3300031824 | Ga0307413_10090714 | Ga0307413_100907143 | 288 |
| 245 | 3300031903 | Ga0307407_10000476 | Ga0307407_100004763 | 288 |
| 246 | 3300031903 | Ga0307407_10027243 | Ga0307407_100272433 | 288 |
| 247 | 3300031995 | Ga0307409_100001723 | Ga0307409_10000172312 | 288 |
| 248 | 3300032005 | Ga0307411_10022809 | Ga0307411_100228092 | 288 |
| 249 | 3300032005 | Ga0307411_10072814 | Ga0307411_100728141 | 288 |
| 250 | 3300032005 | Ga0307411_10332986 | Ga0307411_103329861 | 288 |
| 251 | 3300035725 | Ga0373947_0081098 | Ga0373947_0081098_977_1864 | 288 |
| 252 | 3300046522 | Ga0495643_0020213 | Ga0495643_0020213_1971_2846 | 288 |
| 253 | 3300046537 | Ga0495598_0086134 | Ga0495598_0086134_79_945 | 288 |
| 254 | 3300047318 | Ga0495636_0046643 | Ga0495636_0046643_794_1663 | 288 |
| 255 | 3300048915 | Ga0496112_0240961 | Ga0496112_0240961_266_1156 | 288 |
| 256 | 3300049568 | Ga0501031_0108958 | Ga0501031_0108958_689_1588 | 288 |
| 257 | 3300049572 | Ga0501036_0112401 | Ga0501036_0112401_293_1192 | 288 |
| 258 | 3300049575 | Ga0501039_0047470 | Ga0501039_0047470_1678_2577 | 288 |
| 259 | 3300049588 | Ga0501072_0238147 | Ga0501072_0238147_268_1167 | 288 |
| 260 | 3300049592 | Ga0501076_0091208 | Ga0501076_0091208_346_1245 | 288 |
| 261 | 3300049592 | Ga0501076_0252073 | Ga0501076_0252073_362_1246 | 288 |
| 262 | 3300050491 | nmdc:mga00v17_25707_c1 | nmdc:mga00v17_25707_c1_1630_2514 | 288 |
| 263 | 3300050494 | nmdc:mga06z11_3097_c1 | nmdc:mga06z11_3097_c1_2212_3096 | 288 |
| 264 | 3300050507 | nmdc:mga05p37_4374_c2 | nmdc:mga05p37_4374_c2_11770_12666 | 288 |
| 265 | 3300050509 | nmdc:mga0qj67_38670_c1 | nmdc:mga0qj67_38670_c1_2806_3702 | 288 |
| 266 | 3300050511 | nmdc:mga08y16_3381_c1 | nmdc:mga08y16_3381_c1_13350_14216 | 288 |
| 267 | 3300053116 | Ga0500592_014186 | Ga0500592_014186_209_1093 | 288 |
| 268 | 3300053730 | Ga0500645_000938 | Ga0500645_000938_4553_5437 | 288 |
| 269 | 3300005440 | Ga0070705_100006602 | Ga0070705_1000066024 | 289 |
| 270 | 3300005440 | Ga0070705_100023905 | Ga0070705_1000239052 | 289 |
| 271 | 3300005441 | Ga0070700_100172659 | Ga0070700_1001726592 | 289 |
| 272 | 3300005444 | Ga0070694_100010078 | Ga0070694_1000100784 | 289 |
| 273 | 3300005545 | Ga0070695_100023179 | Ga0070695_1000231792 | 289 |
| 274 | 3300005546 | Ga0070696_100001143 | Ga0070696_1000011434 | 289 |
| 275 | 3300005549 | Ga0070704_100003993 | Ga0070704_1000039934 | 289 |
| 276 | 3300006847 | Ga0075431_100022643 | Ga0075431_1000226432 | 289 |
| 277 | 3300006852 | Ga0075433_10018488 | Ga0075433_100184885 | 289 |
| 278 | 3300006871 | Ga0075434_100011335 | Ga0075434_1000113358 | 289 |
| 279 | 3300006880 | Ga0075429_100124680 | Ga0075429_1001246802 | 289 |
| 280 | 3300009094 | Ga0111539_10471932 | Ga0111539_104719322 | 289 |
| 281 | 3300009147 | Ga0114129_10007052 | Ga0114129_100070528 | 289 |
| 282 | 3300009148 | Ga0105243_10113070 | Ga0105243_101130702 | 289 |
| 283 | 3300025917 | Ga0207660_10254882 | Ga0207660_102548822 | 289 |
| 284 | 3300025933 | Ga0207706_10222844 | Ga0207706_102228443 | 289 |
| 285 | 3300027907 | Ga0207428_10045473 | Ga0207428_100454734 | 289 |
| 286 | 3300031731 | Ga0307405_10011890 | Ga0307405_100118903 | 289 |
| 287 | 3300031824 | Ga0307413_10000281 | Ga0307413_100002817 | 289 |
| 288 | 3300031852 | Ga0307410_10007315 | Ga0307410_100073152 | 289 |
| 289 | 3300031901 | Ga0307406_10038085 | Ga0307406_100380853 | 289 |
| 290 | 3300031995 | Ga0307409_100355819 | Ga0307409_1003558192 | 289 |
| 291 | 3300032002 | Ga0307416_100001676 | Ga0307416_10000167611 | 289 |
| 292 | 3300035692 | Ga0373935_0261142 | Ga0373935_0261142_165_1040 | 289 |
| 293 | 3300037068 | Ga0373925_0237126 | Ga0373925_0237126_161_1036 | 289 |
| 294 | 3300041512 | Ga0451853_3952881 | Ga0451853_3952881_497_1372 | 289 |
| 295 | 3300049779 | Ga0501283_001370 | Ga0501283_001370_1722_2609 | 289 |
| 296 | 3300049824 | Ga0501045_0396793 | Ga0501045_0396793_132_1001 | 289 |
| 297 | 3300050508 | nmdc:mga09592_233185_c1 | nmdc:mga09592_233185_c1_98_985 | 289 |
| 298 | 3300050510 | nmdc:mga06r32_45751_c1 | nmdc:mga06r32_45751_c1_619_1506 | 289 |
| 299 | 3300050511 | nmdc:mga08y16_435515_c1 | nmdc:mga08y16_435515_c1_181_1068 | 289 |
| 300 | 3300050515 | nmdc:mga0a205_9085_c1 | nmdc:mga0a205_9085_c1_4107_5003 | 289 |
| 301 | 3300005459 | Ga0068867_100067384 | Ga0068867_1000673844 | 290 |
| 302 | 3300031548 | Ga0307408_100073015 | Ga0307408_1000730152 | 290 |
| 303 | 3300031911 | Ga0307412_10321698 | Ga0307412_103216982 | 290 |
| 304 | 3300032126 | Ga0307415_100025011 | Ga0307415_1000250114 | 290 |
| 305 | 3300005444 | Ga0070694_100129835 | Ga0070694_1001298351 | 291 |
| 306 | 3300005471 | Ga0070698_100000806 | Ga0070698_10000080626 | 291 |
| 307 | 3300005518 | Ga0070699_100000386 | Ga0070699_1000003867 | 291 |
| 308 | 3300005543 | Ga0070672_100255593 | Ga0070672_1002555932 | 291 |
| 309 | 3300005546 | Ga0070696_100028407 | Ga0070696_1000284072 | 291 |
| 310 | 3300006042 | Ga0075368_10009717 | Ga0075368_100097173 | 291 |
| 311 | 3300006051 | Ga0075364_10008612 | Ga0075364_100086123 | 291 |
| 312 | 3300006178 | Ga0075367_10013077 | Ga0075367_100130773 | 291 |
| 313 | 3300009147 | Ga0114129_10324495 | Ga0114129_103244952 | 291 |
| 314 | 3300013308 | Ga0157375_10078844 | Ga0157375_100788443 | 291 |
| 315 | 3300014326 | Ga0157380_10073950 | Ga0157380_100739504 | 291 |
| 316 | 3300050507 | nmdc:mga05p37_133454_c1 | nmdc:mga05p37_133454_c1_1228_2115 | 291 |
| 317 | 3300053139 | Ga0500568_0009522 | Ga0500568_0009522_800_1693 | 291 |
| 318 | 3300014326 | Ga0157380_10037466 | Ga0157380_100374662 | 292 |
| 319 | 3300049743 | Ga0501081_0138184 | Ga0501081_0138184_581_1486 | 293 |
| 320 | 3300005331 | Ga0070670_100021290 | Ga0070670_1000212906 | 294 |
| 321 | 3300005333 | Ga0070677_10009832 | Ga0070677_100098322 | 294 |
| 322 | 3300005334 | Ga0068869_100001451 | Ga0068869_10000145112 | 294 |
| 323 | 3300005353 | Ga0070669_100011311 | Ga0070669_1000113113 | 294 |
| 324 | 3300005354 | Ga0070675_100014095 | Ga0070675_1000140955 | 294 |
| 325 | 3300005441 | Ga0070700_100041666 | Ga0070700_1000416662 | 294 |
| 326 | 3300005459 | Ga0068867_100005657 | Ga0068867_1000056573 | 294 |
| 327 | 3300005543 | Ga0070672_100061936 | Ga0070672_1000619362 | 294 |
| 328 | 3300005543 | Ga0070672_100106192 | Ga0070672_1001061923 | 294 |
| 329 | 3300005544 | Ga0070686_100060861 | Ga0070686_1000608612 | 294 |
| 330 | 3300005564 | Ga0070664_100087213 | Ga0070664_1000872132 | 294 |
| 331 | 3300005615 | Ga0070702_100054594 | Ga0070702_1000545943 | 294 |
| 332 | 3300005841 | Ga0068863_100425109 | Ga0068863_1004251091 | 294 |
| 333 | 3300009148 | Ga0105243_10049270 | Ga0105243_100492704 | 294 |
| 334 | 3300009176 | Ga0105242_10058736 | Ga0105242_100587362 | 294 |
| 335 | 3300009177 | Ga0105248_10127391 | Ga0105248_101273912 | 294 |
| 336 | 3300009177 | Ga0105248_10243533 | Ga0105248_102435333 | 294 |
| 337 | 3300009551 | Ga0105238_10018652 | Ga0105238_100186525 | 294 |
| 338 | 3300013307 | Ga0157372_10825026 | Ga0157372_108250261 | 294 |
| 339 | 3300014326 | Ga0157380_10007696 | Ga0157380_100076963 | 294 |
| 340 | 3300014326 | Ga0157380_10055066 | Ga0157380_100550662 | 294 |
| 341 | 3300014969 | Ga0157376_10319767 | Ga0157376_103197672 | 294 |
| 342 | 3300025893 | Ga0207682_10133363 | Ga0207682_101333631 | 294 |
| 343 | 3300025924 | Ga0207694_10128725 | Ga0207694_101287253 | 294 |
| 344 | 3300025925 | Ga0207650_10112395 | Ga0207650_101123952 | 294 |
| 345 | 3300025940 | Ga0207691_10120000 | Ga0207691_101200003 | 294 |
| 346 | 3300025941 | Ga0207711_10076965 | Ga0207711_100769652 | 294 |
| 347 | 3300025945 | Ga0207679_10044628 | Ga0207679_100446283 | 294 |
| 348 | 3300025960 | Ga0207651_10280912 | Ga0207651_102809121 | 294 |
| 349 | 3300026121 | Ga0207683_10040293 | Ga0207683_100402932 | 294 |
| 350 | 3300005355 | Ga0070671_100027688 | Ga0070671_1000276886 | 295 |
| 351 | 3300005364 | Ga0070673_100005331 | Ga0070673_1000053314 | 295 |
| 352 | 3300009094 | Ga0111539_10029612 | Ga0111539_100296125 | 295 |
| 353 | 3300042436 | Ga0439435_0028853 | Ga0439435_0028853_247_1149 | 295 |
| 354 | 3300045051 | Ga0451576_0402194 | Ga0451576_0402194_509_1405 | 295 |
| 355 | 3300050507 | nmdc:mga05p37_238863_c1 | nmdc:mga05p37_238863_c1_194_1117 | 295 |
| 356 | 3300050511 | nmdc:mga08y16_14912_c1 | nmdc:mga08y16_14912_c1_2286_3209 | 295 |
| 357 | 3300050512 | nmdc:mga0n895_19699_c1 | nmdc:mga0n895_19699_c1_4693_5616 | 295 |
| 358 | 3300050515 | nmdc:mga0a205_577_c1 | nmdc:mga0a205_577_c1_8285_9208 | 295 |
| 359 | 3300005336 | Ga0070680_100220353 | Ga0070680_1002203531 | 296 |
| 360 | 3300005354 | Ga0070675_100111428 | Ga0070675_1001114281 | 296 |
| 361 | 3300006844 | Ga0075428_100215185 | Ga0075428_1002151852 | 296 |
| 362 | 3300009094 | Ga0111539_10000065 | Ga0111539_1000006573 | 296 |
| 363 | 3300009094 | Ga0111539_10104734 | Ga0111539_101047344 | 296 |
| 364 | 3300027907 | Ga0207428_10000936 | Ga0207428_1000093620 | 296 |
| 365 | 3300032002 | Ga0307416_100326872 | Ga0307416_1003268721 | 296 |
| 366 | 3300049568 | Ga0501031_0333986 | Ga0501031_0333986_64_957 | 296 |
| 367 | 3300049575 | Ga0501039_0282917 | Ga0501039_0282917_226_1119 | 296 |
| 368 | 3300049576 | Ga0501040_0275441 | Ga0501040_0275441_147_1037 | 296 |
| 369 | 3300049578 | Ga0501042_0003074 | Ga0501042_0003074_557_1450 | 296 |
| 370 | 3300049590 | Ga0501074_0193737 | Ga0501074_0193737_226_1119 | 296 |
| 371 | 3300049742 | Ga0501080_0228804 | Ga0501080_0228804_647_1540 | 296 |
| 372 | 3300049743 | Ga0501081_0001556 | Ga0501081_0001556_5917_6810 | 296 |
| 373 | 3300050511 | nmdc:mga08y16_655_c1 | nmdc:mga08y16_655_c1_29707_30621 | 296 |
| 374 | 3300054114 | Ga0501084_0046832 | Ga0501084_0046832_392_1285 | 296 |
| 375 | 3300060353 | Ga0501082_0277536 | Ga0501082_0277536_185_1225 | 296 |
| 376 | 3300006844 | Ga0075428_100039996 | Ga0075428_1000399963 | 297 |
| 377 | 3300003203 | JGI25406J46586_10005196 | JGI25406J46586_100051967 | 298 |
| 378 | 3300003203 | JGI25406J46586_10034937 | JGI25406J46586_100349371 | 298 |
| 379 | 3300005518 | Ga0070699_100003990 | Ga0070699_1000039903 | 298 |
| 380 | 3300005985 | Ga0081539_10000034 | Ga0081539_1000003431 | 298 |
| 381 | 3300005985 | Ga0081539_10000190 | Ga0081539_10000190115 | 298 |
| 382 | 3300005985 | Ga0081539_10013318 | Ga0081539_100133187 | 298 |
| 383 | 3300006852 | Ga0075433_10187539 | Ga0075433_101875392 | 298 |
| 384 | 3300009094 | Ga0111539_10006236 | Ga0111539_1000623612 | 298 |
| 385 | 3300026121 | Ga0207683_10456042 | Ga0207683_104560421 | 298 |
| 386 | 3300032005 | Ga0307411_10037274 | Ga0307411_100372742 | 298 |
| 387 | 3300050511 | nmdc:mga08y16_99899_c1 | nmdc:mga08y16_99899_c1_1535_2446 | 298 |
| 388 | 3300001977 | JGI24746J21847_1002469 | JGI24746J21847_10024692 | 299 |
| 389 | 3300005290 | Ga0065712_10017582 | Ga0065712_100175823 | 299 |
| 390 | 3300005290 | Ga0065712_10136853 | Ga0065712_101368531 | 299 |
| 391 | 3300005293 | Ga0065715_10108241 | Ga0065715_101082412 | 299 |
| 392 | 3300005328 | Ga0070676_10049700 | Ga0070676_100497002 | 299 |
| 393 | 3300005328 | Ga0070676_10154193 | Ga0070676_101541932 | 299 |
| 394 | 3300005330 | Ga0070690_100052224 | Ga0070690_1000522243 | 299 |
| 395 | 3300005331 | Ga0070670_100092042 | Ga0070670_1000920422 | 299 |
| 396 | 3300005333 | Ga0070677_10004874 | Ga0070677_100048745 | 299 |
| 397 | 3300005335 | Ga0070666_10028101 | Ga0070666_100281013 | 299 |
| 398 | 3300005336 | Ga0070680_100110881 | Ga0070680_1001108812 | 299 |
| 399 | 3300005338 | Ga0068868_100017242 | Ga0068868_1000172423 | 299 |
| 400 | 3300005344 | Ga0070661_100020971 | Ga0070661_1000209712 | 299 |
| 401 | 3300005347 | Ga0070668_100007025 | Ga0070668_1000070256 | 299 |
| 402 | 3300005347 | Ga0070668_100071459 | Ga0070668_1000714593 | 299 |
| 403 | 3300005354 | Ga0070675_100025498 | Ga0070675_1000254983 | 299 |
| 404 | 3300005354 | Ga0070675_100069088 | Ga0070675_1000690883 | 299 |
| 405 | 3300005355 | Ga0070671_100014421 | Ga0070671_1000144212 | 299 |
| 406 | 3300005356 | Ga0070674_100001218 | Ga0070674_10000121813 | 299 |
| 407 | 3300005356 | Ga0070674_100226985 | Ga0070674_1002269852 | 299 |
| 408 | 3300005367 | Ga0070667_100008511 | Ga0070667_1000085114 | 299 |
| 409 | 3300005367 | Ga0070667_100327767 | Ga0070667_1003277672 | 299 |
| 410 | 3300005441 | Ga0070700_100006546 | Ga0070700_1000065462 | 299 |
| 411 | 3300005444 | Ga0070694_100023863 | Ga0070694_1000238634 | 299 |
| 412 | 3300005456 | Ga0070678_100002418 | Ga0070678_1000024185 | 299 |
| 413 | 3300005456 | Ga0070678_100059144 | Ga0070678_1000591441 | 299 |
| 414 | 3300005457 | Ga0070662_100006797 | Ga0070662_1000067975 | 299 |
| 415 | 3300005457 | Ga0070662_100281725 | Ga0070662_1002817252 | 299 |
| 416 | 3300005543 | Ga0070672_100243087 | Ga0070672_1002430871 | 299 |
| 417 | 3300005544 | Ga0070686_100002140 | Ga0070686_10000214010 | 299 |
| 418 | 3300005544 | Ga0070686_100078451 | Ga0070686_1000784512 | 299 |
| 419 | 3300005564 | Ga0070664_100031216 | Ga0070664_1000312163 | 299 |
| 420 | 3300005577 | Ga0068857_100103886 | Ga0068857_1001038862 | 299 |
| 421 | 3300005615 | Ga0070702_100038082 | Ga0070702_1000380823 | 299 |
| 422 | 3300005617 | Ga0068859_100026056 | Ga0068859_1000260563 | 299 |
| 423 | 3300005617 | Ga0068859_100077691 | Ga0068859_1000776912 | 299 |
| 424 | 3300005718 | Ga0068866_10135934 | Ga0068866_101359341 | 299 |
| 425 | 3300005719 | Ga0068861_100001769 | Ga0068861_1000017693 | 299 |
| 426 | 3300005840 | Ga0068870_10025353 | Ga0068870_100253532 | 299 |
| 427 | 3300005841 | Ga0068863_100012272 | Ga0068863_1000122726 | 299 |
| 428 | 3300005844 | Ga0068862_100004508 | Ga0068862_1000045087 | 299 |
| 429 | 3300005844 | Ga0068862_100306821 | Ga0068862_1003068212 | 299 |
| 430 | 3300006237 | Ga0097621_100020236 | Ga0097621_1000202365 | 299 |
| 431 | 3300006844 | Ga0075428_100003245 | Ga0075428_1000032459 | 299 |
| 432 | 3300006846 | Ga0075430_100008767 | Ga0075430_1000087674 | 299 |
| 433 | 3300006847 | Ga0075431_100000506 | Ga0075431_10000050633 | 299 |
| 434 | 3300006847 | Ga0075431_100020297 | Ga0075431_1000202971 | 299 |
| 435 | 3300006847 | Ga0075431_100054247 | Ga0075431_1000542474 | 299 |
| 436 | 3300006847 | Ga0075431_100123405 | Ga0075431_1001234052 | 299 |
| 437 | 3300006852 | Ga0075433_10003776 | Ga0075433_100037766 | 299 |
| 438 | 3300006880 | Ga0075429_100004353 | Ga0075429_10000435312 | 299 |
| 439 | 3300006880 | Ga0075429_100014564 | Ga0075429_1000145644 | 299 |
| 440 | 3300006880 | Ga0075429_100026929 | Ga0075429_1000269291 | 299 |
| 441 | 3300006881 | Ga0068865_100005969 | Ga0068865_1000059693 | 299 |
| 442 | 3300006881 | Ga0068865_100260830 | Ga0068865_1002608302 | 299 |
| 443 | 3300006931 | Ga0097620_100026053 | Ga0097620_1000260533 | 299 |
| 444 | 3300006931 | Ga0097620_100077696 | Ga0097620_1000776963 | 299 |
| 445 | 3300007076 | Ga0075435_100040943 | Ga0075435_1000409433 | 299 |
| 446 | 3300009094 | Ga0111539_10003505 | Ga0111539_1000350524 | 299 |
| 447 | 3300009101 | Ga0105247_10096603 | Ga0105247_100966032 | 299 |
| 448 | 3300009553 | Ga0105249_10001042 | Ga0105249_1000104212 | 299 |
| 449 | 3300011119 | Ga0105246_10124941 | Ga0105246_101249413 | 299 |
| 450 | 3300013306 | Ga0163162_10003027 | Ga0163162_100030275 | 299 |
| 451 | 3300013308 | Ga0157375_10067283 | Ga0157375_100672833 | 299 |
| 452 | 3300014326 | Ga0157380_10004723 | Ga0157380_100047232 | 299 |
| 453 | 3300014326 | Ga0157380_10049787 | Ga0157380_100497873 | 299 |
| 454 | 3300014968 | Ga0157379_10003743 | Ga0157379_100037437 | 299 |
| 455 | 3300017792 | Ga0163161_10040797 | Ga0163161_100407973 | 299 |
| 456 | 3300025315 | Ga0207697_10000085 | Ga0207697_1000008520 | 299 |
| 457 | 3300025893 | Ga0207682_10004340 | Ga0207682_100043401 | 299 |
| 458 | 3300025893 | Ga0207682_10098339 | Ga0207682_100983392 | 299 |
| 459 | 3300025901 | Ga0207688_10000477 | Ga0207688_1000047716 | 299 |
| 460 | 3300025908 | Ga0207643_10000621 | Ga0207643_1000062116 | 299 |
| 461 | 3300025923 | Ga0207681_10028097 | Ga0207681_100280973 | 299 |
| 462 | 3300025923 | Ga0207681_10077536 | Ga0207681_100775362 | 299 |
| 463 | 3300025926 | Ga0207659_10189335 | Ga0207659_101893351 | 299 |
| 464 | 3300025933 | Ga0207706_10020983 | Ga0207706_100209833 | 299 |
| 465 | 3300025933 | Ga0207706_10192384 | Ga0207706_101923842 | 299 |
| 466 | 3300025938 | Ga0207704_10032951 | Ga0207704_100329512 | 299 |
| 467 | 3300025940 | Ga0207691_10003154 | Ga0207691_1000315417 | 299 |
| 468 | 3300025940 | Ga0207691_10024570 | Ga0207691_100245705 | 299 |
| 469 | 3300025942 | Ga0207689_10000730 | Ga0207689_100007308 | 299 |
| 470 | 3300025942 | Ga0207689_10026601 | Ga0207689_100266015 | 299 |
| 471 | 3300025942 | Ga0207689_10297269 | Ga0207689_102972691 | 299 |
| 472 | 3300025945 | Ga0207679_10005523 | Ga0207679_100055233 | 299 |
| 473 | 3300025972 | Ga0207668_10229840 | Ga0207668_102298401 | 299 |
| 474 | 3300025986 | Ga0207658_10474987 | Ga0207658_104749872 | 299 |
| 475 | 3300026075 | Ga0207708_10004080 | Ga0207708_100040807 | 299 |
| 476 | 3300026089 | Ga0207648_10176409 | Ga0207648_101764091 | 299 |
| 477 | 3300026095 | Ga0207676_10157447 | Ga0207676_101574471 | 299 |
| 478 | 3300026116 | Ga0207674_10123552 | Ga0207674_101235522 | 299 |
| 479 | 3300026121 | Ga0207683_10001698 | Ga0207683_1000169813 | 299 |
| 480 | 3300026121 | Ga0207683_10006182 | Ga0207683_100061822 | 299 |
| 481 | 3300026121 | Ga0207683_10059793 | Ga0207683_100597932 | 299 |
| 482 | 3300027462 | Ga0210000_1019767 | Ga0210000_10197672 | 299 |
| 483 | 3300027617 | Ga0210002_1019359 | Ga0210002_10193592 | 299 |
| 484 | 3300027907 | Ga0207428_10000345 | Ga0207428_1000034516 | 299 |
| 485 | 3300027907 | Ga0207428_10001419 | Ga0207428_1000141912 | 299 |
| 486 | 3300028380 | Ga0268265_10069547 | Ga0268265_100695473 | 299 |
| 487 | 3300028381 | Ga0268264_10093247 | Ga0268264_100932472 | 299 |
| 488 | 3300042008 | Ga0439450_001785 | Ga0439450_001785_950_1852 | 299 |
| 489 | 3300042008 | Ga0439450_050327 | Ga0439450_050327_74_973 | 299 |
| 490 | 3300050508 | nmdc:mga09592_3519_c1 | nmdc:mga09592_3519_c1_2552_3451 | 299 |
| 491 | 3300050508 | nmdc:mga09592_3756_c1 | nmdc:mga09592_3756_c1_9708_10643 | 299 |
| 492 | 3300050509 | nmdc:mga0qj67_3596_c1 | nmdc:mga0qj67_3596_c1_3035_3970 | 299 |
| 493 | 3300050510 | nmdc:mga06r32_546362_c1 | nmdc:mga06r32_546362_c1_20_991 | 299 |
| 494 | 3300050510 | nmdc:mga06r32_57304_c1 | nmdc:mga06r32_57304_c1_2372_3271 | 299 |
| 495 | 3300050510 | nmdc:mga06r32_7864_c1 | nmdc:mga06r32_7864_c1_6078_7013 | 299 |
| 496 | 3300050511 | nmdc:mga08y16_22565_c1 | nmdc:mga08y16_22565_c1_3922_4821 | 299 |
| 497 | 3300050512 | nmdc:mga0n895_48405_c1 | nmdc:mga0n895_48405_c1_1775_2674 | 299 |
| 498 | 3300050513 | nmdc:mga0rr50_129949_c1 | nmdc:mga0rr50_129949_c1_661_1560 | 299 |
| 499 | 3300050515 | nmdc:mga0a205_1056_c1 | nmdc:mga0a205_1056_c1_15859_16758 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4e2z-assembly1.cif.gz_A | x-ray structure of the h225n mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and sugar product | 0.8348 | 226 | 281 |
| 8s9n-assembly1.cif.gz_A-2 | dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - c2 crystal form | 0.8309 | 21 | 283 |
| 8s9o-assembly1.cif.gz_B | dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form | 0.8247 | 21 | 283 |
| 8s9o-assembly1.cif.gz_A | dna cytosine-n4 methyltransferase (residues 61-324) from the bdelloid rotifer adineta vaga - p1 crystal form | 0.8127 | 21 | 283 |
| 3egi-assembly1.cif.gz_D | methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form) | 0.8046 | 225 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJZ3_50_210_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8497 | 226 | 284 | 3.40.50.150 |
| af_Q58893_2_289_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8134 | 20 | 286 | 3.40.50.150 |
| 3tmaA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.801 | 20 | 166 | 3.40.50.150 |
| af_K7LNZ3_16_140_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7762 | 33 | 88 | 3.40.50.150 |
| 1g60B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7702 | 21 | 278 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382HT07-F1-model_v4 | site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) | 0.9203 | 3 | 115 |
GO:0003677
GO:0008170 GO:0009307 GO:0015667 GO:0032259 |
| AF-A0A7K3Y2D8-F1-model_v4 | site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) | 0.9086 | 24 | 115 |
GO:0003677
GO:0008170 GO:0009307 GO:0015667 GO:0032259 |
| AF-A0A7W1TUS8-F1-model_v4 | Site-specific DNA-methyltransferase | 0.8739 | 211 | 286 |
GO:0003677
GO:0008170 GO:0032259 |
| AF-A0A382HT07-F1-model_v4 | site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) | 0.8627 | 3 | 115 |
GO:0003677
GO:0008170 GO:0009307 GO:0015667 GO:0032259 |
| AF-A0A2V8AWG8-F1-model_v4 | Methyltransferase (EC 2.1.1.-) | 0.8481 | 7 | 286 |
GO:0003677
GO:0008170 GO:0009307 GO:0015667 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar