F455458

General Info

Members Datasets Scaffolds Average Seq Length
499 177 998 208

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541307|2738885238
Length 235
Sequence RPLASSVPLPDRAADRSPGRSPAASAPFLEVRQLSTRGRPAIDLQAQRGECICILGKSGSGKSVLLRLVADLDPGEGTVLLDGIDRNAGSGPAWRRRVIYQAAEPAWWGLTVAGHFPDDMRDVLAGWLVDVGLPVDILQADIARLSTGERQRLALLRSLARKPAVLLLDEPTASLDQATTLAVEALLGRQLAAGLAVLMVTHSVEQAQRIGHRRFDMVEGRLVQQLQPNPQVNAA

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
168 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
169 2738541307 Variovorax sp. GV008 Isolate Unclassified
170 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
171 2643221556 Massilia sp. Root1485 Isolate Unclassified
172 2643221684 Massilia sp. Root133 Isolate Unclassified
173 2738541277 Variovorax sp. GV051 Isolate Unclassified
174 2738543019 Variovorax sp. GV040 Isolate Unclassified
175 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
176 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
177 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0.2
Rhizoplane 3.81
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10019333 3300003322 Bacteria 17868
2 rootL2_10117034 3300003322 Bacteria 9402
3 Ga0055525_1000069 3300003759 Bacteria 186286
4 Ga0070658_10063134 3300005327 Bacteria 3019
5 Ga0070658_10183230 3300005327 Bacteria 1762
6 Ga0070658_10449966 3300005327 Bacteria 1109
7 Ga0070660_100091058 3300005339 Bacteria 2405
8 Ga0070660_100371138 3300005339 Bacteria 1180
9 Ga0070661_100154384 3300005344 Bacteria 1736
10 Ga0070668_100268955 3300005347 Bacteria 1420
11 Ga0070659_100080828 3300005366 Bacteria 2595
12 Ga0070659_100370804 3300005366 Bacteria 1204
13 Ga0070659_100395010 3300005366 Bacteria 1167
14 Ga0070678_100069721 3300005456 Bacteria 2626
15 Ga0070678_100544880 3300005456 Bacteria 1029
16 Ga0070662_100143061 3300005457 Bacteria 1855
17 Ga0070681_10052026 3300005458 Bacteria 4085
18 Ga0070706_100188478 3300005467 Bacteria 1927
19 Ga0070707_100349677 3300005468 Bacteria 1435
20 Ga0070697_100385791 3300005536 Unclassified 1214
21 Ga0068853_100127889 3300005539 Bacteria 2271
22 Ga0070665_100500150 3300005548 Bacteria 1227
23 Ga0068855_100009975 3300005563 Bacteria 11446
24 Ga0068855_100022482 3300005563 Bacteria 7557
25 Ga0068855_100055648 3300005563 Bacteria 4645
26 Ga0070664_100040443 3300005564 Bacteria 3930
27 Ga0070664_100790603 3300005564 Bacteria 887
28 Ga0068854_100200985 3300005578 Bacteria 1567
29 Ga0075362_10183973 3300006177 Bacteria 1013
30 Ga0075366_10107209 3300006195 Bacteria 1680
31 Ga0068865_100373673 3300006881 Bacteria 1161
32 Ga0105244_10287034 3300009036 Bacteria 763
33 Ga0105240_10084805 3300009093 Bacteria 3883
34 Ga0105245_10346332 3300009098 Bacteria 1471
35 Ga0105243_10831393 3300009148 Bacteria 913
36 Ga0105242_10409642 3300009176 Bacteria 1267
37 Ga0105237_10005196 3300009545 Bacteria 14718
38 Ga0105237_10245480 3300009545 Bacteria 1792
39 Ga0105239_10022023 3300010375 Bacteria 7026
40 Ga0157373_10055700 3300013100 Bacteria 2808
41 Ga0157370_10221290 3300013104 Bacteria 1753
42 Ga0157369_10063655 3300013105 Bacteria 3973
43 Ga0157372_10194833 3300013307 Bacteria 2347
44 Ga0182008_10002400 3300014497 Bacteria 11778
45 Ga0182006_1025637 3300015261 Bacteria 2420
46 Ga0182007_10000225 3300015262 Bacteria 37944
47 Ga0163161_10133700 3300017792 Bacteria 1873
48 Ga0209563_100007 3300025230 Bacteria 1579402
49 Ga0209025_1000049 3300025294 Bacteria 333459
50 Ga0207705_10016895 3300025909 Bacteria 5226
51 Ga0207705_10112634 3300025909 Bacteria 2011
52 Ga0207695_10160820 3300025913 Bacteria 2177
53 Ga0207693_10159597 3300025915 Bacteria 1774
54 Ga0207657_10096432 3300025919 Bacteria 2460
55 Ga0207657_10159268 3300025919 Bacteria 1834
56 Ga0207649_10184860 3300025920 Bacteria 1461
57 Ga0207652_10057075 3300025921 Bacteria 3362
58 Ga0207687_10253208 3300025927 Bacteria 1401
59 Ga0207690_10027253 3300025932 Bacteria 3610
60 Ga0207690_10116386 3300025932 Bacteria 1933
61 Ga0207690_10173369 3300025932 Bacteria 1618
62 Ga0207706_10041235 3300025933 Bacteria 4093
63 Ga0207686_10147334 3300025934 Bacteria 1635
64 Ga0207704_10579799 3300025938 Bacteria 915
65 Ga0207679_10089509 3300025945 Bacteria 2376
66 Ga0207679_10937804 3300025945 Bacteria 792
67 Ga0207667_10017235 3300025949 Bacteria 8137
68 Ga0207667_10018376 3300025949 Bacteria 7842
69 Ga0207667_10157102 3300025949 Bacteria 2340
70 Ga0207667_10393326 3300025949 Bacteria 1411
71 Ga0207639_10092899 3300026041 Bacteria 2419
72 Ga0207678_10763390 3300026067 Bacteria 853
73 Ga0207702_10519379 3300026078 Bacteria 1162
74 Ga0207683_10144073 3300026121 Bacteria 2148
75 Ga0207698_10159086 3300026142 Bacteria 1973
76 Ga0265327_10000572 3300031251 Bacteria 62611
77 Ga0265327_10002259 3300031251 Bacteria 20791
78 Ga0307513_10001360 3300031456 Bacteria 35330
79 Ga0395899_0004106 3300037312 Bacteria 11465
80 Ga0395899_0009258 3300037312 Bacteria 7560
81 Ga0395899_0013890 3300037312 Bacteria 6151
82 Ga0395899_0019067 3300037312 Bacteria 5213
83 Ga0395899_0123666 3300037312 Bacteria 1851
84 Ga0395899_0147328 3300037312 Bacteria 1671
85 Ga0395899_0221767 3300037312 Bacteria 1309
86 Ga0395899_0323364 3300037312 Bacteria 1038
87 Ga0395899_0441070 3300037312 Bacteria 854
88 Ga0395899_0488718 3300037312 Bacteria 800
89 Ga0395900_0000570 3300037418 Bacteria 51062
90 Ga0395900_0001140 3300037418 Bacteria 33492
91 Ga0395900_0013333 3300037418 Bacteria 8403
92 Ga0395900_0022925 3300037418 Bacteria 6388
93 Ga0395900_0060847 3300037418 Bacteria 3884
94 Ga0395900_0073655 3300037418 Bacteria 3511
95 Ga0395900_0091829 3300037418 Bacteria 3119
96 Ga0395900_0137783 3300037418 Bacteria 2500
97 Ga0395900_0381061 3300037418 Bacteria 1378
98 Ga0395900_0399258 3300037418 Bacteria 1339
99 Ga0395900_0423896 3300037418 Bacteria 1291
100 Ga0395898_0013749 3300037466 Bacteria 8324
101 Ga0395898_0172855 3300037466 Bacteria 2065
102 Ga0395898_0224348 3300037466 Bacteria 1792
103 Ga0395898_0252333 3300037466 Bacteria 1682
104 Ga0395898_0388639 3300037466 Bacteria 1330
105 Ga0395905_0002046 3300037471 Bacteria 23048
106 Ga0395905_0051890 3300037471 Bacteria 3841
107 Ga0395905_0062423 3300037471 Bacteria 3485
108 Ga0395905_0082610 3300037471 Bacteria 3010
109 Ga0395905_0084492 3300037471 Bacteria 2974
110 Ga0395905_0339443 3300037471 Bacteria 1393
111 Ga0395905_0424782 3300037471 Bacteria 1225
112 Ga0395901_0000672 3300038443 Bacteria 39335
113 Ga0395901_0038197 3300038443 Bacteria 4966
114 Ga0395901_0431279 3300038443 Bacteria 1350
115 Ga0395901_1188740 3300038443 Bacteria 729
116 Ga0436360_1241722 3300039438 Bacteria 812
117 Ga0451837_1596079 3300041494 Bacteria 691
118 Ga0439448_0000172 3300042005 Bacteria 13059
119 Ga0439455_0055912 3300042012 Bacteria 1039
120 Ga0439458_0009847 3300042157 Bacteria 2128
121 Ga0466969_0002974 3300044656 Bacteria 9044
122 Ga0466969_0022329 3300044656 Bacteria 3267
123 Ga0466969_0083775 3300044656 Bacteria 1518
124 Ga0466969_0091387 3300044656 Bacteria 1442
125 Ga0466969_0251988 3300044656 Bacteria 800
126 Ga0466972_0000132 3300044658 Bacteria 61824
127 Ga0466972_0008736 3300044658 Bacteria 5081
128 Ga0466965_0070720 3300044683 Bacteria 1754
129 Ga0466965_0127691 3300044683 Bacteria 1316
130 Ga0466965_0142395 3300044683 Bacteria 1249
131 Ga0466966_0000985 3300044684 Bacteria 18260
132 Ga0466966_0007015 3300044684 Bacteria 7461
133 Ga0466966_0019425 3300044684 Bacteria 4469
134 Ga0466966_0020318 3300044684 Bacteria 4369
135 Ga0466966_0059954 3300044684 Bacteria 2402
136 Ga0466966_0067431 3300044684 Bacteria 2247
137 Ga0466966_0079056 3300044684 Bacteria 2050
138 Ga0466966_0094772 3300044684 Bacteria 1850
139 Ga0466966_0096625 3300044684 Bacteria 1830
140 Ga0466961_0000623 3300044693 Bacteria 22167
141 Ga0466964_0001007 3300044706 Bacteria 9347
142 Ga0466964_0033056 3300044706 Bacteria 2059
143 Ga0466968_0000314 3300044735 Bacteria 15576
144 Ga0466970_0100732 3300044765 Bacteria 1573
145 Ga0466970_0309028 3300044765 Bacteria 892
146 Ga0466957_0000020 3300044842 Bacteria 60993
147 Ga0466957_0006841 3300044842 Bacteria 6444
148 Ga0466957_0020810 3300044842 Bacteria 3859
149 Ga0466957_0030362 3300044842 Bacteria 3226
150 Ga0466957_0157645 3300044842 Bacteria 1472
151 Ga0466959_0000504 3300045049 Bacteria 22669
152 Ga0466959_0017166 3300045049 Bacteria 5300
153 Ga0466959_0055459 3300045049 Bacteria 2893
154 Ga0466959_0084597 3300045049 Bacteria 2283
155 Ga0466959_0098752 3300045049 Bacteria 2091
156 Ga0466959_0434028 3300045049 Bacteria 891
157 Ga0466958_0073092 3300045836 Bacteria 2100
158 Ga0466958_0156317 3300045836 Bacteria 1439
159 Ga0466967_0026217 3300045976 Bacteria 4823
160 Ga0466967_0066359 3300045976 Bacteria 3215
161 Ga0466967_0084727 3300045976 Bacteria 2868
162 Ga0466967_0718253 3300045976 Bacteria 990
163 Ga0495617_000001 3300046452 Bacteria 877032
164 Ga0495617_021505 3300046452 Bacteria 2178
165 Ga0495627_000053 3300046453 Bacteria 152092
166 Ga0495627_013026 3300046453 Bacteria 2935
167 Ga0495627_020351 3300046453 Bacteria 2212
168 Ga0495592_0047522 3300046454 Bacteria 3196
169 Ga0495590_0000028 3300046457 Bacteria 152333
170 Ga0495590_0003217 3300046457 Bacteria 6676
171 Ga0495591_000038 3300046458 Bacteria 157347
172 Ga0495591_016783 3300046458 Bacteria 2535
173 Ga0495638_0039165 3300046460 Bacteria 3010
174 Ga0495638_0107042 3300046460 Bacteria 1665
175 Ga0495651_0253579 3300046462 Bacteria 1200
176 Ga0495653_0108058 3300046463 Bacteria 2004
177 Ga0495650_0036788 3300046471 Bacteria 2138
178 Ga0495605_0000004 3300046474 Bacteria 395282
179 Ga0495605_0003282 3300046474 Bacteria 9696
180 Ga0495605_0003688 3300046474 Bacteria 9091
181 Ga0495605_0006186 3300046474 Bacteria 6903
182 Ga0495605_0011767 3300046474 Bacteria 4869
183 Ga0495605_0013425 3300046474 Bacteria 4513
184 Ga0495605_0059762 3300046474 Bacteria 1829
185 Ga0495605_0108989 3300046474 Bacteria 1265
186 Ga0495639_0001048 3300046475 Bacteria 12464
187 Ga0495584_0000058 3300046491 Bacteria 81148
188 Ga0495584_0001446 3300046491 Bacteria 14301
189 Ga0495584_0003266 3300046491 Bacteria 8985
190 Ga0495584_0046571 3300046491 Bacteria 2187
191 Ga0495585_0002132 3300046492 Bacteria 14444
192 Ga0495585_0007889 3300046492 Bacteria 6474
193 Ga0495585_0027752 3300046492 Bacteria 3230
194 Ga0495585_0037172 3300046492 Bacteria 2742
195 Ga0495585_0055931 3300046492 Bacteria 2180
196 Ga0495585_0271481 3300046492 Bacteria 840
197 Ga0495594_0015900 3300046499 Bacteria 3958
198 Ga0495596_0000065 3300046500 Bacteria 77306
199 Ga0495596_0001928 3300046500 Bacteria 11494
200 Ga0495596_0002733 3300046500 Bacteria 9269
201 Ga0495596_0003595 3300046500 Bacteria 7802
202 Ga0495596_0004247 3300046500 Bacteria 7025
203 Ga0495596_0008999 3300046500 Bacteria 4413
204 Ga0495596_0021977 3300046500 Bacteria 2599
205 Ga0495596_0031525 3300046500 Bacteria 2117
206 Ga0495596_0037860 3300046500 Bacteria 1907
207 Ga0495596_0147007 3300046500 Bacteria 915
208 Ga0495607_0000485 3300046501 Bacteria 39753
209 Ga0495607_0000690 3300046501 Bacteria 32544
210 Ga0495607_0000985 3300046501 Bacteria 26334
211 Ga0495607_0002526 3300046501 Bacteria 14813
212 Ga0495607_0002725 3300046501 Bacteria 14090
213 Ga0495607_0006700 3300046501 Bacteria 8066
214 Ga0495607_0025990 3300046501 Bacteria 3636
215 Ga0495607_0036243 3300046501 Bacteria 2973
216 Ga0495607_0088091 3300046501 Bacteria 1688
217 Ga0495607_0115273 3300046501 Bacteria 1418
218 Ga0495607_0165830 3300046501 Bacteria 1119
219 Ga0495583_0000289 3300046506 Bacteria 79890
220 Ga0495583_0000325 3300046506 Bacteria 75322
221 Ga0495583_0000491 3300046506 Bacteria 57580
222 Ga0495583_0003926 3300046506 Bacteria 11003
223 Ga0495583_0009018 3300046506 Bacteria 6010
224 Ga0495583_0033362 3300046506 Bacteria 2476
225 Ga0495583_0092670 3300046506 Bacteria 1299
226 Ga0495583_0106642 3300046506 Bacteria 1190
227 Ga0495583_0120597 3300046506 Bacteria 1104
228 Ga0495583_0143828 3300046506 Bacteria 991
229 Ga0495606_0004730 3300046507 Bacteria 13407
230 Ga0495606_0027935 3300046507 Bacteria 3989
231 Ga0495606_0105811 3300046507 Bacteria 1705
232 Ga0495606_0120958 3300046507 Bacteria 1567
233 Ga0495606_0184980 3300046507 Bacteria 1198
234 Ga0495606_0189457 3300046507 Bacteria 1180
235 Ga0495606_0243164 3300046507 Bacteria 1002
236 Ga0495610_0001123 3300046512 Bacteria 24394
237 Ga0495616_0000012 3300046513 Bacteria 211342
238 Ga0495616_0000492 3300046513 Bacteria 30078
239 Ga0495616_0000503 3300046513 Bacteria 29633
240 Ga0495616_0001197 3300046513 Bacteria 18305
241 Ga0495616_0007140 3300046513 Bacteria 6700
242 Ga0495616_0038595 3300046513 Bacteria 2451
243 Ga0495616_0071107 3300046513 Bacteria 1683
244 Ga0495631_0000105 3300046518 Bacteria 55305
245 Ga0495631_0000406 3300046518 Bacteria 29752
246 Ga0495631_0000715 3300046518 Bacteria 21308
247 Ga0495631_0003625 3300046518 Bacteria 8426
248 Ga0495631_0004756 3300046518 Bacteria 7169
249 Ga0495631_0008522 3300046518 Bacteria 5163
250 Ga0495631_0018602 3300046518 Bacteria 3268
251 Ga0495631_0029416 3300046518 Bacteria 2498
252 Ga0495631_0077927 3300046518 Bacteria 1430
253 Ga0495632_0000024 3300046519 Bacteria 179517
254 Ga0495632_0000082 3300046519 Bacteria 97726
255 Ga0495632_0005325 3300046519 Bacteria 8540
256 Ga0495632_0006546 3300046519 Bacteria 7469
257 Ga0495632_0009015 3300046519 Bacteria 6050
258 Ga0495632_0014093 3300046519 Bacteria 4536
259 Ga0495637_0000002 3300046520 Bacteria 629280
260 Ga0495637_0000901 3300046520 Bacteria 19149
261 Ga0495637_0094921 3300046520 Bacteria 1171
262 Ga0495643_0001361 3300046522 Bacteria 22868
263 Ga0495643_0005509 3300046522 Bacteria 8542
264 Ga0495643_0017182 3300046522 Bacteria 4234
265 Ga0495643_0017427 3300046522 Bacteria 4198
266 Ga0495643_0024381 3300046522 Bacteria 3432
267 Ga0495643_0025067 3300046522 Bacteria 3378
268 Ga0495643_0031081 3300046522 Bacteria 2975
269 Ga0495643_0043900 3300046522 Bacteria 2430
270 Ga0495644_0006081 3300046523 Bacteria 4694
271 Ga0495644_0025755 3300046523 Bacteria 2231
272 Ga0495644_0036317 3300046523 Bacteria 1859
273 Ga0495644_0043720 3300046523 Bacteria 1685
274 Ga0495648_0000022 3300046524 Bacteria 242791
275 Ga0495648_0001118 3300046524 Bacteria 27187
276 Ga0495648_0002597 3300046524 Bacteria 16531
277 Ga0495648_0009867 3300046524 Bacteria 7337
278 Ga0495648_0067294 3300046524 Bacteria 2095
279 Ga0495648_0164485 3300046524 Bacteria 1143
280 Ga0495648_0183038 3300046524 Bacteria 1063
281 Ga0495663_0006105 3300046525 Bacteria 3332
282 Ga0495663_0044443 3300046525 Bacteria 1360
283 Ga0495663_0075434 3300046525 Bacteria 1079
284 Ga0495663_0156573 3300046525 Bacteria 780
285 Ga0495666_0001725 3300046526 Bacteria 10781
286 Ga0495642_0000001 3300046528 Bacteria 389656
287 Ga0495642_0000091 3300046528 Bacteria 53133
288 Ga0495642_0000288 3300046528 Bacteria 28396
289 Ga0495642_0004370 3300046528 Bacteria 5488
290 Ga0495642_0005035 3300046528 Bacteria 5091
291 Ga0495642_0016203 3300046528 Bacteria 2903
292 Ga0495642_0019067 3300046528 Bacteria 2687
293 Ga0495642_0095054 3300046528 Bacteria 1264
294 Ga0495642_0221008 3300046528 Bacteria 827
295 Ga0495654_0003142 3300046530 Bacteria 10242
296 Ga0495654_0003884 3300046530 Bacteria 9033
297 Ga0495587_0211399 3300046536 Bacteria 1095
298 Ga0495609_0000019 3300046538 Bacteria 297777
299 Ga0495609_0000821 3300046538 Bacteria 23089
300 Ga0495609_0002631 3300046538 Bacteria 10901
301 Ga0495609_0002663 3300046538 Bacteria 10820
302 Ga0495609_0024700 3300046538 Bacteria 2755
303 Ga0495609_0024747 3300046538 Bacteria 2752
304 Ga0495609_0031381 3300046538 Bacteria 2415
305 Ga0495609_0054106 3300046538 Bacteria 1783
306 Ga0495609_0071161 3300046538 Bacteria 1528
307 Ga0495621_0010092 3300046539 Bacteria 2882
308 Ga0495597_0000178 3300046542 Bacteria 56443
309 Ga0495597_0000353 3300046542 Bacteria 41029
310 Ga0495597_0002987 3300046542 Bacteria 10222
311 Ga0495597_0068044 3300046542 Bacteria 1539
312 Ga0495597_0140322 3300046542 Bacteria 997
313 Ga0495597_0152792 3300046542 Bacteria 946
314 Ga0495633_0000657 3300046558 Bacteria 31904
315 Ga0495633_0006815 3300046558 Bacteria 6693
316 Ga0495633_0020061 3300046558 Bacteria 3368
317 Ga0495633_0020559 3300046558 Bacteria 3318
318 Ga0495656_0003765 3300046615 Bacteria 5151
319 Ga0495656_0024522 3300046615 Bacteria 2383
320 Ga0495656_0104175 3300046615 Bacteria 1317
321 Ga0495668_0000036 3300046616 Bacteria 235057
322 Ga0495668_0000125 3300046616 Bacteria 114514
323 Ga0495668_0000733 3300046616 Bacteria 39289
324 Ga0495668_0021326 3300046616 Bacteria 3717
325 Ga0495668_0041244 3300046616 Bacteria 2572
326 Ga0495668_0263039 3300046616 Bacteria 944
327 Ga0495668_0294413 3300046616 Bacteria 889
328 Ga0495611_0000298 3300046648 Bacteria 33610
329 Ga0495611_0001222 3300046648 Bacteria 13276
330 Ga0495611_0001952 3300046648 Bacteria 9797
331 Ga0495611_0007479 3300046648 Bacteria 4635
332 Ga0495611_0059386 3300046648 Bacteria 1736
333 Ga0495625_0004974 3300046660 Bacteria 12348
334 Ga0495625_0042550 3300046660 Bacteria 3300
335 Ga0495625_0071471 3300046660 Bacteria 2435
336 Ga0495661_0000012 3300046665 Bacteria 276804
337 Ga0495661_0000084 3300046665 Bacteria 114797
338 Ga0495661_0006327 3300046665 Bacteria 8327
339 Ga0495661_0026855 3300046665 Bacteria 3703
340 Ga0495661_0029151 3300046665 Bacteria 3525
341 Ga0495661_0048696 3300046665 Bacteria 2574
342 Ga0495661_0060597 3300046665 Bacteria 2247
343 Ga0495661_0151043 3300046665 Bacteria 1254
344 Ga0495661_0178167 3300046665 Bacteria 1128
345 Ga0495661_0235340 3300046665 Bacteria 942
346 Ga0495588_0000050 3300046674 Bacteria 335314
347 Ga0495588_0022256 3300046674 Bacteria 3132
348 Ga0495588_0057365 3300046674 Bacteria 2011
349 Ga0495588_0064993 3300046674 Bacteria 1893
350 Ga0495588_0081702 3300046674 Bacteria 1687
351 Ga0495646_0082330 3300046680 Bacteria 1873
352 Ga0495646_0342473 3300046680 Bacteria 784
353 Ga0495669_0002922 3300046684 Bacteria 7024
354 Ga0495669_0006588 3300046684 Bacteria 4856
355 Ga0495669_0014900 3300046684 Bacteria 3325
356 Ga0495669_0106314 3300046684 Bacteria 1307
357 Ga0495669_0170010 3300046684 Bacteria 1036
358 Ga0495624_0388907 3300046690 Bacteria 838
359 Ga0495670_0151077 3300046691 Bacteria 1218
360 Ga0495671_0000362 3300046692 Bacteria 37700
361 Ga0495671_0000505 3300046692 Bacteria 29965
362 Ga0495671_0002186 3300046692 Bacteria 12455
363 Ga0495671_0020655 3300046692 Bacteria 3468
364 Ga0495671_0159317 3300046692 Bacteria 1098
365 Ga0495649_0000653 3300046694 Bacteria 28254
366 Ga0495649_0002084 3300046694 Bacteria 14361
367 Ga0495649_0058749 3300046694 Bacteria 2072
368 Ga0495649_0094697 3300046694 Bacteria 1589
369 Ga0495589_0000007 3300046794 Bacteria 276444
370 Ga0495589_0000145 3300046794 Bacteria 65639
371 Ga0495589_0000503 3300046794 Bacteria 27673
372 Ga0495589_0001004 3300046794 Bacteria 17121
373 Ga0495589_0005215 3300046794 Bacteria 6874
374 Ga0495589_0028410 3300046794 Bacteria 2823
375 Ga0495589_0098792 3300046794 Bacteria 1413
376 Ga0495589_0196483 3300046794 Bacteria 953
377 Ga0495660_0000100 3300046810 Bacteria 92354
378 Ga0495660_0003639 3300046810 Bacteria 9485
379 Ga0495660_0003736 3300046810 Bacteria 9345
380 Ga0495660_0008808 3300046810 Bacteria 5891
381 Ga0495660_0021767 3300046810 Bacteria 3667
382 Ga0495660_0075037 3300046810 Bacteria 1785
383 Ga0495660_0089785 3300046810 Bacteria 1599
384 Ga0495604_0087276 3300047317 Bacteria 2324
385 Ga0495604_0166813 3300047317 Bacteria 1552
386 Ga0495672_0000233 3300047320 Bacteria 79344
387 Ga0495672_0157856 3300047320 Bacteria 1169
388 Ga0495683_0000394 3300047323 Bacteria 35373
389 Ga0495683_0018750 3300047323 Bacteria 3575
390 Ga0495683_0028002 3300047323 Bacteria 2880
391 Ga0495683_0060860 3300047323 Bacteria 1870
392 Ga0495687_000002 3300047443 Bacteria 1085770
393 Ga0495687_000003 3300047443 Bacteria 859509
394 Ga0495687_000007 3300047443 Bacteria 552679
395 Ga0495687_000016 3300047443 Bacteria 359237
396 Ga0495687_000028 3300047443 Bacteria 293356
397 Ga0495677_0000005 3300047445 Bacteria 243336
398 Ga0495677_0000049 3300047445 Bacteria 68714
399 Ga0495677_0000089 3300047445 Bacteria 46781
400 Ga0495677_0000233 3300047445 Bacteria 25165
401 Ga0495677_0003855 3300047445 Bacteria 5798
402 Ga0495677_0005048 3300047445 Bacteria 5030
403 Ga0495677_0008456 3300047445 Bacteria 3822
404 Ga0495677_0029639 3300047445 Bacteria 1990
405 Ga0495679_009941 3300047446 Bacteria 3769
406 Ga0495679_024022 3300047446 Bacteria 2059
407 Ga0495679_026346 3300047446 Bacteria 1931
408 Ga0495679_032292 3300047446 Bacteria 1680
409 Ga0495685_006123 3300047447 Bacteria 3936
410 Ga0495685_013425 3300047447 Bacteria 2780
411 Ga0495673_0040402 3300047469 Bacteria 2107
412 Ga0495681_0000005 3300047470 Bacteria 225279
413 Ga0495681_0000028 3300047470 Bacteria 139008
414 Ga0495681_0014231 3300047470 Bacteria 4575
415 Ga0495681_0017164 3300047470 Bacteria 4030
416 Ga0495686_0000015 3300047472 Bacteria 471703
417 Ga0495686_0013214 3300047472 Bacteria 5740
418 Ga0495593_0125427 3300047673 Bacteria 1305
419 Ga0495602_0030795 3300048088 Bacteria 5084
420 Ga0495615_0035178 3300048090 Bacteria 1223
421 Ga0495626_0000322 3300048091 Bacteria 50407
422 Ga0495626_0000428 3300048091 Bacteria 43156
423 Ga0495626_0000555 3300048091 Bacteria 37043
424 Ga0495626_0000883 3300048091 Bacteria 26531
425 Ga0495626_0009327 3300048091 Bacteria 5308
426 Ga0495626_0011410 3300048091 Bacteria 4700
427 Ga0495626_0014196 3300048091 Bacteria 4116
428 Ga0495626_0014440 3300048091 Bacteria 4072
429 Ga0495626_0016169 3300048091 Bacteria 3798
430 Ga0495626_0016852 3300048091 Bacteria 3702
431 Ga0495626_0019796 3300048091 Bacteria 3360
432 Ga0495626_0072613 3300048091 Bacteria 1543
433 Ga0495626_0127991 3300048091 Bacteria 1086
434 Ga0496101_0112439 3300048904 Bacteria 2051
435 Ga0496101_0304511 3300048904 Bacteria 1249
436 Ga0496102_0000078 3300048905 Bacteria 141629
437 Ga0496102_0000318 3300048905 Bacteria 60368
438 Ga0496102_0173240 3300048905 Bacteria 2031
439 Ga0496102_0223401 3300048905 Bacteria 1776
440 Ga0496103_0362260 3300048906 Bacteria 932
441 Ga0496104_0062886 3300048907 Bacteria 3520
442 Ga0496106_0012657 3300048909 Bacteria 6233
443 Ga0496106_0021909 3300048909 Bacteria 4747
444 Ga0496106_0649619 3300048909 Bacteria 843
445 Ga0496109_0038649 3300048912 Bacteria 4315
446 Ga0496109_0622017 3300048912 Bacteria 1016
447 Ga0496110_0444364 3300048913 Bacteria 1182
448 Ga0496112_0151492 3300048915 Bacteria 2286
449 Ga0496113_0009095 3300048916 Bacteria 6509
450 Ga0496113_0009903 3300048916 Bacteria 6280
451 Ga0496114_0280642 3300048917 Bacteria 1469
452 Ga0496115_0060509 3300048918 Bacteria 3052
453 Ga0496117_0080227 3300048920 Bacteria 2147
454 Ga0496121_0360115 3300048924 Bacteria 966
455 Ga0496122_0000279 3300048925 Bacteria 114185
456 Ga0496122_0005967 3300048925 Bacteria 14256
457 Ga0496122_0019319 3300048925 Bacteria 6230
458 Ga0496122_0199394 3300048925 Bacteria 1172
459 Ga0496123_0000146 3300048926 Bacteria 143990
460 Ga0496123_0002661 3300048926 Bacteria 21578
461 Ga0496123_0006459 3300048926 Bacteria 11346
462 Ga0496123_0038633 3300048926 Bacteria 3352
463 Ga0496124_0011236 3300048927 Bacteria 8972
464 Ga0496124_0103413 3300048927 Bacteria 2304
465 Ga0496124_0119391 3300048927 Bacteria 2109
466 Ga0496124_0133051 3300048927 Bacteria 1973
467 Ga0496124_0178791 3300048927 Bacteria 1635
468 Ga0496124_0259212 3300048927 Bacteria 1281
469 Ga0496124_0354410 3300048927 Bacteria 1037
470 Ga0496125_0000849 3300048928 Bacteria 49007
471 Ga0496125_0066816 3300048928 Bacteria 2838
472 Ga0496125_0306204 3300048928 Bacteria 971
473 Ga0496126_0179591 3300048929 Bacteria 1799
474 Ga0495678_000015 3300049459 Bacteria 309544
475 Ga0495678_000022 3300049459 Bacteria 237031
476 Ga0495678_000102 3300049459 Bacteria 104107
477 Ga0495678_000166 3300049459 Bacteria 77064
478 Ga0495678_006246 3300049459 Bacteria 6367
479 Ga0495678_023999 3300049459 Bacteria 2641
480 Ga0495678_069341 3300049459 Bacteria 1297
481 Ga0495682_0000038 3300049460 Bacteria 120212
482 Ga0495682_0003633 3300049460 Bacteria 6802
483 Ga0495682_0014838 3300049460 Bacteria 2952
484 Ga0495682_0096791 3300049460 Bacteria 1059
485 Ga0501034_0113537 3300049571 Bacteria 2699
486 nmdc:mga03683_52733_c1 3300050489 Bacteria 1186
487 Ga0500610_0000499 3300053079 Bacteria 12075
488 Ga0500607_001510 3300053121 Bacteria 20789
489 Ga0500607_021870 3300053121 Bacteria 3599
490 Ga0500596_020768 3300053735 Bacteria 988
491 2738885238 2738541307 Bacteria 8606193
492 2550695831 2548876994 Bacteria 4904866
493 2643799572 2643221556 Bacteria 7251154
494 2644470712 2643221684 Bacteria 7145183
495 2738723884 2738541277 Bacteria 7458140
496 2739284615 2738543019 Bacteria 7459457
497 2809147586 2808606418 Bacteria 6724496
498 2932422818 2932422444 Bacteria 4678430
499 8047677591 8047673197 Bacteria 7395230
500 rootL2_10019333
501 rootL2_10117034
502 Ga0055525_1000069
503 Ga0070658_10063134
504 Ga0070658_10183230
505 Ga0070658_10449966
506 Ga0070660_100091058
507 Ga0070660_100371138
508 Ga0070661_100154384
509 Ga0070668_100268955
510 Ga0070659_100080828
511 Ga0070659_100370804
512 Ga0070659_100395010
513 Ga0070678_100069721
514 Ga0070678_100544880
515 Ga0070662_100143061
516 Ga0070681_10052026
517 Ga0070706_100188478
518 Ga0070707_100349677
519 Ga0070697_100385791
520 Ga0068853_100127889
521 Ga0070665_100500150
522 Ga0068855_100009975
523 Ga0068855_100022482
524 Ga0068855_100055648
525 Ga0070664_100040443
526 Ga0070664_100790603
527 Ga0068854_100200985
528 Ga0075362_10183973
529 Ga0075366_10107209
530 Ga0068865_100373673
531 Ga0105244_10287034
532 Ga0105240_10084805
533 Ga0105245_10346332
534 Ga0105243_10831393
535 Ga0105242_10409642
536 Ga0105237_10005196
537 Ga0105237_10245480
538 Ga0105239_10022023
539 Ga0157373_10055700
540 Ga0157370_10221290
541 Ga0157369_10063655
542 Ga0157372_10194833
543 Ga0182008_10002400
544 Ga0182006_1025637
545 Ga0182007_10000225
546 Ga0163161_10133700
547 Ga0209563_100007
548 Ga0209025_1000049
549 Ga0207705_10016895
550 Ga0207705_10112634
551 Ga0207695_10160820
552 Ga0207693_10159597
553 Ga0207657_10096432
554 Ga0207657_10159268
555 Ga0207649_10184860
556 Ga0207652_10057075
557 Ga0207687_10253208
558 Ga0207690_10027253
559 Ga0207690_10116386
560 Ga0207690_10173369
561 Ga0207706_10041235
562 Ga0207686_10147334
563 Ga0207704_10579799
564 Ga0207679_10089509
565 Ga0207679_10937804
566 Ga0207667_10017235
567 Ga0207667_10018376
568 Ga0207667_10157102
569 Ga0207667_10393326
570 Ga0207639_10092899
571 Ga0207678_10763390
572 Ga0207702_10519379
573 Ga0207683_10144073
574 Ga0207698_10159086
575 Ga0265327_10000572
576 Ga0265327_10002259
577 Ga0307513_10001360
578 Ga0395899_0004106
579 Ga0395899_0009258
580 Ga0395899_0013890
581 Ga0395899_0019067
582 Ga0395899_0123666
583 Ga0395899_0147328
584 Ga0395899_0221767
585 Ga0395899_0323364
586 Ga0395899_0441070
587 Ga0395899_0488718
588 Ga0395900_0000570
589 Ga0395900_0001140
590 Ga0395900_0013333
591 Ga0395900_0022925
592 Ga0395900_0060847
593 Ga0395900_0073655
594 Ga0395900_0091829
595 Ga0395900_0137783
596 Ga0395900_0381061
597 Ga0395900_0399258
598 Ga0395900_0423896
599 Ga0395898_0013749
600 Ga0395898_0172855
601 Ga0395898_0224348
602 Ga0395898_0252333
603 Ga0395898_0388639
604 Ga0395905_0002046
605 Ga0395905_0051890
606 Ga0395905_0062423
607 Ga0395905_0082610
608 Ga0395905_0084492
609 Ga0395905_0339443
610 Ga0395905_0424782
611 Ga0395901_0000672
612 Ga0395901_0038197
613 Ga0395901_0431279
614 Ga0395901_1188740
615 Ga0436360_1241722
616 Ga0451837_1596079
617 Ga0439448_0000172
618 Ga0439455_0055912
619 Ga0439458_0009847
620 Ga0466969_0002974
621 Ga0466969_0022329
622 Ga0466969_0083775
623 Ga0466969_0091387
624 Ga0466969_0251988
625 Ga0466972_0000132
626 Ga0466972_0008736
627 Ga0466965_0070720
628 Ga0466965_0127691
629 Ga0466965_0142395
630 Ga0466966_0000985
631 Ga0466966_0007015
632 Ga0466966_0019425
633 Ga0466966_0020318
634 Ga0466966_0059954
635 Ga0466966_0067431
636 Ga0466966_0079056
637 Ga0466966_0094772
638 Ga0466966_0096625
639 Ga0466961_0000623
640 Ga0466964_0001007
641 Ga0466964_0033056
642 Ga0466968_0000314
643 Ga0466970_0100732
644 Ga0466970_0309028
645 Ga0466957_0000020
646 Ga0466957_0006841
647 Ga0466957_0020810
648 Ga0466957_0030362
649 Ga0466957_0157645
650 Ga0466959_0000504
651 Ga0466959_0017166
652 Ga0466959_0055459
653 Ga0466959_0084597
654 Ga0466959_0098752
655 Ga0466959_0434028
656 Ga0466958_0073092
657 Ga0466958_0156317
658 Ga0466967_0026217
659 Ga0466967_0066359
660 Ga0466967_0084727
661 Ga0466967_0718253
662 Ga0495617_000001
663 Ga0495617_021505
664 Ga0495627_000053
665 Ga0495627_013026
666 Ga0495627_020351
667 Ga0495592_0047522
668 Ga0495590_0000028
669 Ga0495590_0003217
670 Ga0495591_000038
671 Ga0495591_016783
672 Ga0495638_0039165
673 Ga0495638_0107042
674 Ga0495651_0253579
675 Ga0495653_0108058
676 Ga0495650_0036788
677 Ga0495605_0000004
678 Ga0495605_0003282
679 Ga0495605_0003688
680 Ga0495605_0006186
681 Ga0495605_0011767
682 Ga0495605_0013425
683 Ga0495605_0059762
684 Ga0495605_0108989
685 Ga0495639_0001048
686 Ga0495584_0000058
687 Ga0495584_0001446
688 Ga0495584_0003266
689 Ga0495584_0046571
690 Ga0495585_0002132
691 Ga0495585_0007889
692 Ga0495585_0027752
693 Ga0495585_0037172
694 Ga0495585_0055931
695 Ga0495585_0271481
696 Ga0495594_0015900
697 Ga0495596_0000065
698 Ga0495596_0001928
699 Ga0495596_0002733
700 Ga0495596_0003595
701 Ga0495596_0004247
702 Ga0495596_0008999
703 Ga0495596_0021977
704 Ga0495596_0031525
705 Ga0495596_0037860
706 Ga0495596_0147007
707 Ga0495607_0000485
708 Ga0495607_0000690
709 Ga0495607_0000985
710 Ga0495607_0002526
711 Ga0495607_0002725
712 Ga0495607_0006700
713 Ga0495607_0025990
714 Ga0495607_0036243
715 Ga0495607_0088091
716 Ga0495607_0115273
717 Ga0495607_0165830
718 Ga0495583_0000289
719 Ga0495583_0000325
720 Ga0495583_0000491
721 Ga0495583_0003926
722 Ga0495583_0009018
723 Ga0495583_0033362
724 Ga0495583_0092670
725 Ga0495583_0106642
726 Ga0495583_0120597
727 Ga0495583_0143828
728 Ga0495606_0004730
729 Ga0495606_0027935
730 Ga0495606_0105811
731 Ga0495606_0120958
732 Ga0495606_0184980
733 Ga0495606_0189457
734 Ga0495606_0243164
735 Ga0495610_0001123
736 Ga0495616_0000012
737 Ga0495616_0000492
738 Ga0495616_0000503
739 Ga0495616_0001197
740 Ga0495616_0007140
741 Ga0495616_0038595
742 Ga0495616_0071107
743 Ga0495631_0000105
744 Ga0495631_0000406
745 Ga0495631_0000715
746 Ga0495631_0003625
747 Ga0495631_0004756
748 Ga0495631_0008522
749 Ga0495631_0018602
750 Ga0495631_0029416
751 Ga0495631_0077927
752 Ga0495632_0000024
753 Ga0495632_0000082
754 Ga0495632_0005325
755 Ga0495632_0006546
756 Ga0495632_0009015
757 Ga0495632_0014093
758 Ga0495637_0000002
759 Ga0495637_0000901
760 Ga0495637_0094921
761 Ga0495643_0001361
762 Ga0495643_0005509
763 Ga0495643_0017182
764 Ga0495643_0017427
765 Ga0495643_0024381
766 Ga0495643_0025067
767 Ga0495643_0031081
768 Ga0495643_0043900
769 Ga0495644_0006081
770 Ga0495644_0025755
771 Ga0495644_0036317
772 Ga0495644_0043720
773 Ga0495648_0000022
774 Ga0495648_0001118
775 Ga0495648_0002597
776 Ga0495648_0009867
777 Ga0495648_0067294
778 Ga0495648_0164485
779 Ga0495648_0183038
780 Ga0495663_0006105
781 Ga0495663_0044443
782 Ga0495663_0075434
783 Ga0495663_0156573
784 Ga0495666_0001725
785 Ga0495642_0000001
786 Ga0495642_0000091
787 Ga0495642_0000288
788 Ga0495642_0004370
789 Ga0495642_0005035
790 Ga0495642_0016203
791 Ga0495642_0019067
792 Ga0495642_0095054
793 Ga0495642_0221008
794 Ga0495654_0003142
795 Ga0495654_0003884
796 Ga0495587_0211399
797 Ga0495609_0000019
798 Ga0495609_0000821
799 Ga0495609_0002631
800 Ga0495609_0002663
801 Ga0495609_0024700
802 Ga0495609_0024747
803 Ga0495609_0031381
804 Ga0495609_0054106
805 Ga0495609_0071161
806 Ga0495621_0010092
807 Ga0495597_0000178
808 Ga0495597_0000353
809 Ga0495597_0002987
810 Ga0495597_0068044
811 Ga0495597_0140322
812 Ga0495597_0152792
813 Ga0495633_0000657
814 Ga0495633_0006815
815 Ga0495633_0020061
816 Ga0495633_0020559
817 Ga0495656_0003765
818 Ga0495656_0024522
819 Ga0495656_0104175
820 Ga0495668_0000036
821 Ga0495668_0000125
822 Ga0495668_0000733
823 Ga0495668_0021326
824 Ga0495668_0041244
825 Ga0495668_0263039
826 Ga0495668_0294413
827 Ga0495611_0000298
828 Ga0495611_0001222
829 Ga0495611_0001952
830 Ga0495611_0007479
831 Ga0495611_0059386
832 Ga0495625_0004974
833 Ga0495625_0042550
834 Ga0495625_0071471
835 Ga0495661_0000012
836 Ga0495661_0000084
837 Ga0495661_0006327
838 Ga0495661_0026855
839 Ga0495661_0029151
840 Ga0495661_0048696
841 Ga0495661_0060597
842 Ga0495661_0151043
843 Ga0495661_0178167
844 Ga0495661_0235340
845 Ga0495588_0000050
846 Ga0495588_0022256
847 Ga0495588_0057365
848 Ga0495588_0064993
849 Ga0495588_0081702
850 Ga0495646_0082330
851 Ga0495646_0342473
852 Ga0495669_0002922
853 Ga0495669_0006588
854 Ga0495669_0014900
855 Ga0495669_0106314
856 Ga0495669_0170010
857 Ga0495624_0388907
858 Ga0495670_0151077
859 Ga0495671_0000362
860 Ga0495671_0000505
861 Ga0495671_0002186
862 Ga0495671_0020655
863 Ga0495671_0159317
864 Ga0495649_0000653
865 Ga0495649_0002084
866 Ga0495649_0058749
867 Ga0495649_0094697
868 Ga0495589_0000007
869 Ga0495589_0000145
870 Ga0495589_0000503
871 Ga0495589_0001004
872 Ga0495589_0005215
873 Ga0495589_0028410
874 Ga0495589_0098792
875 Ga0495589_0196483
876 Ga0495660_0000100
877 Ga0495660_0003639
878 Ga0495660_0003736
879 Ga0495660_0008808
880 Ga0495660_0021767
881 Ga0495660_0075037
882 Ga0495660_0089785
883 Ga0495604_0087276
884 Ga0495604_0166813
885 Ga0495672_0000233
886 Ga0495672_0157856
887 Ga0495683_0000394
888 Ga0495683_0018750
889 Ga0495683_0028002
890 Ga0495683_0060860
891 Ga0495687_000002
892 Ga0495687_000003
893 Ga0495687_000007
894 Ga0495687_000016
895 Ga0495687_000028
896 Ga0495677_0000005
897 Ga0495677_0000049
898 Ga0495677_0000089
899 Ga0495677_0000233
900 Ga0495677_0003855
901 Ga0495677_0005048
902 Ga0495677_0008456
903 Ga0495677_0029639
904 Ga0495679_009941
905 Ga0495679_024022
906 Ga0495679_026346
907 Ga0495679_032292
908 Ga0495685_006123
909 Ga0495685_013425
910 Ga0495673_0040402
911 Ga0495681_0000005
912 Ga0495681_0000028
913 Ga0495681_0014231
914 Ga0495681_0017164
915 Ga0495686_0000015
916 Ga0495686_0013214
917 Ga0495593_0125427
918 Ga0495602_0030795
919 Ga0495615_0035178
920 Ga0495626_0000322
921 Ga0495626_0000428
922 Ga0495626_0000555
923 Ga0495626_0000883
924 Ga0495626_0009327
925 Ga0495626_0011410
926 Ga0495626_0014196
927 Ga0495626_0014440
928 Ga0495626_0016169
929 Ga0495626_0016852
930 Ga0495626_0019796
931 Ga0495626_0072613
932 Ga0495626_0127991
933 Ga0496101_0112439
934 Ga0496101_0304511
935 Ga0496102_0000078
936 Ga0496102_0000318
937 Ga0496102_0173240
938 Ga0496102_0223401
939 Ga0496103_0362260
940 Ga0496104_0062886
941 Ga0496106_0012657
942 Ga0496106_0021909
943 Ga0496106_0649619
944 Ga0496109_0038649
945 Ga0496109_0622017
946 Ga0496110_0444364
947 Ga0496112_0151492
948 Ga0496113_0009095
949 Ga0496113_0009903
950 Ga0496114_0280642
951 Ga0496115_0060509
952 Ga0496117_0080227
953 Ga0496121_0360115
954 Ga0496122_0000279
955 Ga0496122_0005967
956 Ga0496122_0019319
957 Ga0496122_0199394
958 Ga0496123_0000146
959 Ga0496123_0002661
960 Ga0496123_0006459
961 Ga0496123_0038633
962 Ga0496124_0011236
963 Ga0496124_0103413
964 Ga0496124_0119391
965 Ga0496124_0133051
966 Ga0496124_0178791
967 Ga0496124_0259212
968 Ga0496124_0354410
969 Ga0496125_0000849
970 Ga0496125_0066816
971 Ga0496125_0306204
972 Ga0496126_0179591
973 Ga0495678_000015
974 Ga0495678_000022
975 Ga0495678_000102
976 Ga0495678_000166
977 Ga0495678_006246
978 Ga0495678_023999
979 Ga0495678_069341
980 Ga0495682_0000038
981 Ga0495682_0003633
982 Ga0495682_0014838
983 Ga0495682_0096791
984 Ga0501034_0113537
985 nmdc:mga03683_52733_c1
986 Ga0500610_0000499
987 Ga0500607_001510
988 Ga0500607_021870
989 Ga0500596_020768
990 2738885238
991 2550695831
992 2643799572
993 2644470712
994 2738723884
995 2739284615
996 2809147586
997 2932422818
998 8047677591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

173

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_C crystal structure of e159q mutant of btucdf 0.9178 7 204
2qi9-assembly1.cif.gz_D abc-transporter btucd in complex with its periplasmic binding protein btuf 0.9146 7 204
2r6g-assembly1.cif.gz_A the crystal structure of the e. coli maltose transporter 0.9108 9 202
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9101 23 204
1l7v-assembly1.cif.gz_D bacterial abc transporter involved in b12 uptake 0.9073 7 204
ID Description Score Start End Superfamily
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9223 9 202 3.40.50.300
af_P13458_780_1036_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9201 123 189 3.40.50.300
af_Q2FVG0_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9106 8 204 3.40.50.300
af_Q9C9W0_25_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9106 5 205 3.40.50.300
af_A0A1D6H744_679_834_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9087 107 202 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G6ZH94-F1-model_v4 Phosphonate transport system ATP-binding protein/sn-glycerol 3-phosphate transport system ATP-binding protein/ATP-binding cassette, subfamily C, CydD 0.9938 7 205 GO:0005524
GO:0005886
GO:0016887
AF-A0A7H1NP17-F1-model_v4 Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-) 0.9903 9 205 GO:0005524
GO:0016887
AF-A0A1M7JDX1-F1-model_v4 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component 0.9872 7 205 GO:0005524
GO:0005886
GO:0016887
AF-A0A1K1QWI4-F1-model_v4 Phosphate-transporting ATPase 0.986 3 205 GO:0005524
GO:0016887
AF-A0A7C2AY35-F1-model_v4 ATP-binding cassette domain-containing protein 0.9857 1 205 GO:0005524
GO:0016887

Map