F455486

General Info

Members Datasets Scaffolds Average Seq Length
500 226 1000 464

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100012239|Ga0070675_1000122396
Length 513
Sequence MTVIPQDQLPRVSGSSSNGDGELDNTIERPGQRAPLILGGMGFTEVTETVTRINAVKTPKAWYIAFAISLGLLSLLGLTIGYLVTTGVGVWGNNQPVSWAFDIVNFVFWVGIGHAGTLISAILFLFRQKWRTGINRFAEAMTIFAVMCAGIFPALHVGRPWLAYWLFPLPNQMSMWPQFRSPLLWDVFAVSTYASVSLLFWYIGMIPDLATLRDRATSKAKQLAYGIFALGWTGSSRHWHRFEKAYLLLAALATPLVLSVHSVVSFDFATSQVPGWHTTIFPPYFVAGAVFGGFAMVLTLAIPARQFFGLKDIITRRHIDNMCKVLLGTGLIVAYSYAIEFYIAWYSQSNFEQFVFLNRIRGPYGWAWACMTFCNVVAPQLLWSKRLRSHLGWVMFVAMCVNCGMWFERFVIIVGSLHRDFLPSSWGMYIPTWVDLGMFAGSFGLFFTMFLLFCRYLPMVAMAEVKTVMPQSHPHAGPHVNRHRFDYWPDERDHVPPMKKGEAAQNIRDWTGI

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
199 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
200 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
201 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
223 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
224 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
225 641522639 Methylobacterium sp. 4-46 Isolate Nodule
226 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0.6
Rhizoplane 0.6
Rhizosphere 95.6
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100012239 3300005354 Bacteria 6723
2 Ga0070658_10002014 3300005327 Bacteria 17081
3 Ga0070658_10002305 3300005327 Bacteria 16020
4 Ga0070658_10119861 3300005327 Bacteria 2186
5 Ga0070683_100002947 3300005329 Bacteria 13647
6 Ga0070683_100003032 3300005329 Bacteria 13497
7 Ga0070683_100003034 3300005329 Bacteria 13489
8 Ga0070683_100042245 3300005329 Bacteria 4197
9 Ga0070670_100015322 3300005331 Bacteria 6584
10 Ga0068869_100120830 3300005334 Bacteria 2003
11 Ga0070680_100015737 3300005336 Bacteria 5939
12 Ga0070682_100001159 3300005337 Bacteria 15064
13 Ga0070660_100013821 3300005339 Bacteria 5806
14 Ga0070689_100000018 3300005340 Bacteria 153256
15 Ga0070689_100040501 3300005340 Bacteria 3573
16 Ga0070691_10001614 3300005341 Bacteria 9759
17 Ga0070669_100084911 3300005353 Bacteria 2363
18 Ga0070669_100125656 3300005353 Bacteria 1962
19 Ga0070671_100004452 3300005355 Bacteria 11086
20 Ga0070673_100075499 3300005364 Bacteria 2719
21 Ga0070713_100044427 3300005436 Bacteria 3637
22 Ga0070710_10024136 3300005437 Bacteria 3205
23 Ga0070694_100058153 3300005444 Bacteria 2630
24 Ga0070708_100000199 3300005445 Bacteria 43925
25 Ga0070708_100016212 3300005445 Bacteria 6177
26 Ga0070681_10002113 3300005458 Bacteria 18044
27 Ga0068867_100198382 3300005459 Bacteria 1605
28 Ga0070707_100000623 3300005468 Bacteria 35482
29 Ga0070698_100000234 3300005471 Bacteria 55039
30 Ga0070698_100024919 3300005471 Bacteria 6236
31 Ga0070698_100071512 3300005471 Bacteria 3479
32 Ga0070698_100189843 3300005471 Bacteria 1992
33 Ga0070679_100001654 3300005530 Bacteria 20081
34 Ga0070679_100022776 3300005530 Bacteria 6127
35 Ga0070684_100007455 3300005535 Bacteria 8507
36 Ga0070684_100015277 3300005535 Bacteria 6248
37 Ga0070684_100064791 3300005535 Bacteria 3206
38 Ga0070697_100002532 3300005536 Bacteria 14062
39 Ga0068853_100121079 3300005539 Bacteria 2334
40 Ga0070672_100000117 3300005543 Bacteria 40556
41 Ga0070686_100078835 3300005544 Bacteria 2176
42 Ga0070695_100001962 3300005545 Bacteria 11686
43 Ga0070665_100038327 3300005548 Bacteria 4818
44 Ga0068855_100000016 3300005563 Bacteria 222591
45 Ga0068855_100003698 3300005563 Bacteria 18701
46 Ga0068855_100010965 3300005563 Bacteria 10937
47 Ga0068855_100078647 3300005563 Bacteria 3826
48 Ga0068855_100097264 3300005563 Bacteria 3391
49 Ga0068855_100223816 3300005563 Bacteria 2109
50 Ga0070664_100010911 3300005564 Bacteria 7368
51 Ga0070664_100044724 3300005564 Bacteria 3738
52 Ga0068857_100001982 3300005577 Bacteria 16565
53 Ga0068857_100005964 3300005577 Bacteria 10408
54 Ga0068857_100030545 3300005577 Bacteria 4758
55 Ga0068857_100081292 3300005577 Bacteria 2894
56 Ga0068856_100004582 3300005614 Bacteria 13742
57 Ga0068856_100005355 3300005614 Bacteria 12657
58 Ga0068856_100039681 3300005614 Bacteria 4623
59 Ga0068856_100049947 3300005614 Bacteria 4123
60 Ga0068856_100059429 3300005614 Bacteria 3776
61 Ga0068856_100104713 3300005614 Bacteria 2824
62 Ga0068852_100107645 3300005616 Bacteria 2529
63 Ga0068859_100009083 3300005617 Bacteria 10040
64 Ga0068859_100021654 3300005617 Bacteria 6451
65 Ga0068858_100045857 3300005842 Bacteria 4052
66 Ga0068858_100048214 3300005842 Bacteria 3947
67 Ga0068858_100065463 3300005842 Bacteria 3363
68 Ga0068860_100047678 3300005843 Bacteria 4082
69 Ga0068860_100131942 3300005843 Bacteria 2398
70 Ga0068862_100053974 3300005844 Bacteria 3441
71 Ga0081538_10083673 3300005981 Bacteria 1685
72 Ga0081539_10001217 3300005985 Bacteria 45977
73 Ga0075366_10016109 3300006195 Bacteria 4292
74 Ga0097621_100049180 3300006237 Bacteria 3424
75 Ga0097621_100102427 3300006237 Bacteria 2410
76 Ga0068871_100095682 3300006358 Bacteria 2480
77 Ga0075428_100000008 3300006844 Bacteria 271300
78 Ga0075428_100003724 3300006844 Bacteria 16716
79 Ga0075428_100015039 3300006844 Bacteria 8597
80 Ga0075428_100017006 3300006844 Bacteria 8035
81 Ga0075430_100037752 3300006846 Bacteria 4094
82 Ga0075431_100004874 3300006847 Bacteria 13218
83 Ga0075433_10006297 3300006852 Bacteria 9374
84 Ga0075429_100016079 3300006880 Bacteria 6481
85 Ga0075429_100147595 3300006880 Bacteria 2059
86 Ga0097620_100009083 3300006931 Bacteria 10040
87 Ga0097620_100013449 3300006931 Bacteria 8206
88 Ga0097620_100021654 3300006931 Bacteria 6451
89 Ga0105240_10007627 3300009093 Bacteria 15669
90 Ga0105240_10008927 3300009093 Bacteria 14253
91 Ga0105240_10032224 3300009093 Bacteria 6788
92 Ga0105240_10039030 3300009093 Bacteria 6084
93 Ga0105240_10052227 3300009093 Bacteria 5139
94 Ga0105240_10090572 3300009093 Bacteria 3738
95 Ga0105240_10134588 3300009093 Bacteria 2961
96 Ga0111539_10000020 3300009094 Bacteria 265282
97 Ga0111539_10008628 3300009094 Bacteria 12945
98 Ga0111539_10031248 3300009094 Bacteria 6470
99 Ga0111539_10087970 3300009094 Bacteria 3650
100 Ga0111539_10109483 3300009094 Bacteria 3242
101 Ga0111539_10334045 3300009094 Bacteria 1764
102 Ga0105245_10000793 3300009098 Bacteria 28691
103 Ga0105245_10001855 3300009098 Bacteria 19241
104 Ga0105245_10007667 3300009098 Bacteria 9455
105 Ga0105245_10048905 3300009098 Bacteria 3784
106 Ga0105245_10087584 3300009098 Bacteria 2858
107 Ga0105245_10214431 3300009098 Bacteria 1854
108 Ga0114129_10052639 3300009147 Bacteria 5714
109 Ga0105243_10065399 3300009148 Bacteria 2921
110 Ga0105241_10001538 3300009174 Bacteria 17687
111 Ga0105241_10015127 3300009174 Bacteria 5652
112 Ga0105241_10037971 3300009174 Bacteria 3631
113 Ga0105241_10088883 3300009174 Bacteria 2433
114 Ga0105242_10044095 3300009176 Bacteria 3610
115 Ga0105242_10086715 3300009176 Bacteria 2627
116 Ga0105248_10009858 3300009177 Bacteria 10523
117 Ga0105248_10061939 3300009177 Bacteria 4201
118 Ga0105248_10079900 3300009177 Bacteria 3675
119 Ga0105248_10177900 3300009177 Bacteria 2397
120 Ga0105237_10000019 3300009545 Bacteria 234829
121 Ga0105237_10010541 3300009545 Bacteria 9822
122 Ga0105237_10015466 3300009545 Bacteria 7940
123 Ga0105237_10030875 3300009545 Bacteria 5437
124 Ga0105237_10053422 3300009545 Bacteria 4052
125 Ga0105237_10198948 3300009545 Bacteria 2003
126 Ga0105238_10002952 3300009551 Bacteria 16968
127 Ga0105238_10003665 3300009551 Bacteria 15309
128 Ga0105238_10007713 3300009551 Bacteria 10758
129 Ga0105238_10015836 3300009551 Bacteria 7634
130 Ga0105238_10035701 3300009551 Bacteria 5053
131 Ga0105238_10062729 3300009551 Bacteria 3717
132 Ga0105238_10068295 3300009551 Bacteria 3555
133 Ga0105249_10192558 3300009553 Bacteria 1991
134 Ga0105249_10314045 3300009553 Bacteria 1576
135 Ga0105239_10002080 3300010375 Bacteria 25942
136 Ga0105239_10015145 3300010375 Bacteria 8546
137 Ga0105239_10031841 3300010375 Bacteria 5795
138 Ga0105239_10042928 3300010375 Bacteria 4955
139 Ga0105239_10190096 3300010375 Bacteria 2298
140 Ga0157373_10088774 3300013100 Bacteria 2178
141 Ga0157370_10001648 3300013104 Bacteria 27559
142 Ga0157370_10042557 3300013104 Bacteria 4376
143 Ga0157369_10005370 3300013105 Bacteria 14919
144 Ga0157369_10009576 3300013105 Bacteria 11080
145 Ga0157369_10011132 3300013105 Bacteria 10228
146 Ga0157378_10000931 3300013297 Bacteria 26982
147 Ga0157378_10013777 3300013297 Bacteria 7073
148 Ga0157378_10112969 3300013297 Bacteria 2493
149 Ga0163162_10132277 3300013306 Bacteria 2604
150 Ga0157372_10005849 3300013307 Bacteria 13098
151 Ga0157372_10010730 3300013307 Bacteria 9751
152 Ga0157372_10013491 3300013307 Bacteria 8732
153 Ga0157372_10044524 3300013307 Bacteria 4918
154 Ga0157372_10091566 3300013307 Bacteria 3458
155 Ga0157372_10181946 3300013307 Bacteria 2433
156 Ga0157372_10243214 3300013307 Bacteria 2088
157 Ga0157375_10004009 3300013308 Bacteria 12776
158 Ga0157375_10143079 3300013308 Bacteria 2520
159 Ga0163163_10014129 3300014325 Bacteria 7333
160 Ga0163163_10043302 3300014325 Bacteria 4413
161 Ga0163163_10078056 3300014325 Bacteria 3307
162 Ga0163163_10094852 3300014325 Bacteria 3002
163 Ga0163163_10103851 3300014325 Bacteria 2866
164 Ga0163163_10113688 3300014325 Bacteria 2737
165 Ga0163163_10211560 3300014325 Bacteria 1988
166 Ga0157379_10065119 3300014968 Bacteria 3258
167 Ga0157379_10154442 3300014968 Bacteria 2070
168 Ga0157376_10007663 3300014969 Bacteria 7732
169 Ga0157376_10062758 3300014969 Bacteria 3128
170 Ga0213872_10000668 3300021361 Bacteria 25982
171 Ga0207692_10022091 3300025898 Bacteria 2924
172 Ga0207642_10038388 3300025899 Bacteria 2072
173 Ga0207710_10000626 3300025900 Bacteria 20406
174 Ga0207680_10042615 3300025903 Bacteria 2656
175 Ga0207705_10002305 3300025909 Bacteria 14772
176 Ga0207705_10014924 3300025909 Bacteria 5586
177 Ga0207705_10075525 3300025909 Bacteria 2448
178 Ga0207705_10103736 3300025909 Bacteria 2094
179 Ga0207684_10000055 3300025910 Bacteria 216970
180 Ga0207654_10016069 3300025911 Bacteria 3893
181 Ga0207654_10055264 3300025911 Bacteria 2298
182 Ga0207707_10004185 3300025912 Bacteria 12781
183 Ga0207707_10043182 3300025912 Bacteria 3933
184 Ga0207707_10097889 3300025912 Bacteria 2564
185 Ga0207695_10000211 3300025913 Bacteria 156467
186 Ga0207695_10000753 3300025913 Bacteria 62265
187 Ga0207695_10002330 3300025913 Bacteria 28280
188 Ga0207695_10003821 3300025913 Bacteria 20873
189 Ga0207695_10004312 3300025913 Bacteria 19494
190 Ga0207695_10010450 3300025913 Bacteria 11352
191 Ga0207695_10023310 3300025913 Bacteria 6999
192 Ga0207695_10143166 3300025913 Bacteria 2337
193 Ga0207671_10025599 3300025914 Bacteria 4431
194 Ga0207671_10059664 3300025914 Bacteria 2829
195 Ga0207671_10070649 3300025914 Bacteria 2603
196 Ga0207660_10036092 3300025917 Bacteria 3436
197 Ga0207657_10042165 3300025919 Bacteria 4028
198 Ga0207657_10058398 3300025919 Bacteria 3320
199 Ga0207652_10007101 3300025921 Bacteria 9025
200 Ga0207652_10117073 3300025921 Bacteria 2367
201 Ga0207694_10001895 3300025924 Bacteria 17341
202 Ga0207694_10004266 3300025924 Bacteria 11191
203 Ga0207694_10006387 3300025924 Bacteria 8984
204 Ga0207694_10008862 3300025924 Bacteria 7590
205 Ga0207694_10010449 3300025924 Bacteria 7000
206 Ga0207694_10011341 3300025924 Bacteria 6727
207 Ga0207694_10091762 3300025924 Bacteria 2397
208 Ga0207650_10039036 3300025925 Bacteria 3470
209 Ga0207659_10038125 3300025926 Bacteria 3340
210 Ga0207687_10001249 3300025927 Bacteria 17403
211 Ga0207687_10001930 3300025927 Bacteria 14260
212 Ga0207687_10003611 3300025927 Bacteria 10420
213 Ga0207687_10024265 3300025927 Bacteria 4049
214 Ga0207687_10123174 3300025927 Bacteria 1942
215 Ga0207664_10245117 3300025929 Bacteria 1562
216 Ga0207686_10095660 3300025934 Bacteria 1971
217 Ga0207709_10020932 3300025935 Bacteria 3696
218 Ga0207670_10000001 3300025936 Bacteria 949312
219 Ga0207670_10003265 3300025936 Bacteria 8596
220 Ga0207704_10196089 3300025938 Bacteria 1473
221 Ga0207691_10020054 3300025940 Bacteria 6325
222 Ga0207711_10006182 3300025941 Bacteria 10119
223 Ga0207711_10041475 3300025941 Bacteria 3920
224 Ga0207711_10301125 3300025941 Bacteria 1479
225 Ga0207689_10038369 3300025942 Bacteria 3968
226 Ga0207661_10002594 3300025944 Bacteria 12426
227 Ga0207661_10012917 3300025944 Bacteria 6090
228 Ga0207661_10020363 3300025944 Bacteria 4958
229 Ga0207661_10036362 3300025944 Bacteria 3843
230 Ga0207661_10103374 3300025944 Bacteria 2397
231 Ga0207667_10000099 3300025949 Bacteria 139071
232 Ga0207667_10000522 3300025949 Bacteria 50706
233 Ga0207667_10001917 3300025949 Bacteria 26122
234 Ga0207667_10010114 3300025949 Bacteria 11053
235 Ga0207667_10011911 3300025949 Bacteria 10072
236 Ga0207667_10064804 3300025949 Bacteria 3813
237 Ga0207667_10141089 3300025949 Bacteria 2481
238 Ga0207712_10173260 3300025961 Bacteria 1688
239 Ga0207668_10055664 3300025972 Bacteria 2751
240 Ga0207703_10017568 3300026035 Bacteria 5585
241 Ga0207703_10038358 3300026035 Bacteria 3823
242 Ga0207703_10062192 3300026035 Bacteria 3058
243 Ga0207703_10158477 3300026035 Bacteria 1980
244 Ga0207639_10149572 3300026041 Bacteria 1954
245 Ga0207639_10154142 3300026041 Bacteria 1928
246 Ga0207702_10007686 3300026078 Bacteria 9165
247 Ga0207702_10026486 3300026078 Bacteria 4813
248 Ga0207648_10077774 3300026089 Bacteria 2893
249 Ga0207648_10237076 3300026089 Bacteria 1624
250 Ga0207676_10094888 3300026095 Unclassified 2459
251 Ga0207674_10000475 3300026116 Bacteria 52737
252 Ga0207674_10001061 3300026116 Bacteria 35743
253 Ga0207674_10002732 3300026116 Bacteria 22004
254 Ga0207674_10003663 3300026116 Bacteria 18742
255 Ga0207674_10025924 3300026116 Bacteria 6239
256 Ga0207675_100020536 3300026118 Bacteria 6156
257 Ga0207675_100048421 3300026118 Bacteria 3968
258 Ga0207675_100239158 3300026118 Bacteria 1754
259 Ga0207698_10032620 3300026142 Bacteria 3776
260 Ga0209971_1011044 3300027682 Bacteria 2138
261 Ga0207428_10000021 3300027907 Bacteria 276436
262 Ga0207428_10019294 3300027907 Bacteria 5814
263 Ga0207428_10097631 3300027907 Bacteria 2273
264 Ga0268266_10049493 3300028379 Bacteria 3604
265 Ga0268265_10027164 3300028380 Bacteria 4081
266 Ga0268265_10185700 3300028380 Bacteria 1790
267 Ga0268264_10010942 3300028381 Bacteria 7494
268 Ga0268264_10165218 3300028381 Bacteria 1997
269 Ga0265337_1000093 3300028556 Bacteria 43981
270 Ga0265337_1005870 3300028556 Bacteria 4808
271 Ga0265337_1022063 3300028556 Bacteria 1977
272 Ga0265319_1000019 3300028563 Bacteria 154537
273 Ga0265334_10019406 3300028573 Bacteria 2797
274 Ga0265334_10028254 3300028573 Bacteria 2255
275 Ga0265334_10049389 3300028573 Bacteria 1618
276 Ga0265318_10000030 3300028577 Bacteria 146681
277 Ga0265318_10001726 3300028577 Bacteria 12512
278 Ga0265318_10002304 3300028577 Bacteria 10249
279 Ga0265336_10009335 3300028666 Bacteria 3399
280 Ga0265338_10007694 3300028800 Bacteria 13274
281 Ga0265338_10009419 3300028800 Bacteria 11647
282 Ga0265338_10011550 3300028800 Bacteria 10183
283 Ga0265338_10023709 3300028800 Bacteria 6295
284 Ga0265338_10024511 3300028800 Bacteria 6160
285 Ga0265338_10035478 3300028800 Bacteria 4793
286 Ga0265338_10118138 3300028800 Bacteria 2120
287 Ga0265330_10000115 3300031235 Bacteria 64724
288 Ga0265330_10002258 3300031235 Bacteria 10608
289 Ga0265330_10007791 3300031235 Bacteria 5200
290 Ga0265332_10000454 3300031238 Bacteria 28817
291 Ga0265332_10002129 3300031238 Bacteria 10228
292 Ga0265332_10003266 3300031238 Bacteria 7878
293 Ga0265332_10008082 3300031238 Bacteria 4729
294 Ga0265328_10004244 3300031239 Bacteria 6234
295 Ga0265328_10028328 3300031239 Bacteria 2095
296 Ga0265320_10000017 3300031240 Bacteria 196688
297 Ga0265320_10000195 3300031240 Bacteria 50041
298 Ga0265320_10004518 3300031240 Bacteria 9108
299 Ga0265320_10010668 3300031240 Bacteria 5452
300 Ga0265325_10082874 3300031241 Bacteria 1591
301 Ga0265329_10001789 3300031242 Bacteria 10216
302 Ga0265329_10011298 3300031242 Bacteria 3248
303 Ga0265339_10000416 3300031249 Bacteria 33650
304 Ga0265339_10001031 3300031249 Bacteria 21244
305 Ga0265339_10005790 3300031249 Bacteria 8206
306 Ga0265331_10000027 3300031250 Bacteria 220058
307 Ga0265331_10003556 3300031250 Bacteria 9995
308 Ga0265331_10003854 3300031250 Bacteria 9493
309 Ga0265331_10005800 3300031250 Bacteria 7400
310 Ga0265327_10016853 3300031251 Bacteria 4617
311 Ga0265316_10001437 3300031344 Bacteria 25625
312 Ga0265316_10002671 3300031344 Bacteria 18367
313 Ga0265316_10010666 3300031344 Bacteria 8351
314 Ga0265316_10014098 3300031344 Bacteria 7053
315 Ga0265316_10042222 3300031344 Bacteria 3646
316 Ga0265313_10000744 3300031595 Bacteria 33392
317 Ga0265313_10005276 3300031595 Bacteria 9566
318 Ga0307508_10011073 3300031616 Bacteria 8247
319 Ga0307508_10093796 3300031616 Bacteria 2592
320 Ga0265314_10000001 3300031711 Bacteria 3792860
321 Ga0265314_10000069 3300031711 Bacteria 153728
322 Ga0265314_10000316 3300031711 Bacteria 67925
323 Ga0265314_10002587 3300031711 Bacteria 18310
324 Ga0265314_10002631 3300031711 Bacteria 18101
325 Ga0265314_10002830 3300031711 Bacteria 17283
326 Ga0265314_10023229 3300031711 Bacteria 4733
327 Ga0265314_10050070 3300031711 Bacteria 2920
328 Ga0265314_10083977 3300031711 Bacteria 2092
329 Ga0265342_10005369 3300031712 Bacteria 9787
330 Ga0265342_10020893 3300031712 Bacteria 4188
331 Ga0307516_10008408 3300031730 Bacteria 11697
332 Ga0307405_10017107 3300031731 Bacteria 3971
333 Ga0307405_10171227 3300031731 Bacteria 1549
334 Ga0373950_0000006 3300034818 Bacteria 395608
335 Ga0373934_0006682 3300035086 Bacteria 4286
336 Ga0373932_0000589 3300035112 Bacteria 11082
337 Ga0373954_0005738 3300035118 Bacteria 5388
338 Ga0373954_0011669 3300035118 Bacteria 3898
339 Ga0373954_0023935 3300035118 Bacteria 2782
340 Ga0373927_0011353 3300035695 Bacteria 5930
341 Ga0373933_0000341 3300035724 Bacteria 29999
342 Ga0373933_0055438 3300035724 Bacteria 2378
343 Ga0373947_0002461 3300035725 Bacteria 11145
344 Ga0373937_0002952 3300036401 Bacteria 14226
345 Ga0373937_0014323 3300036401 Bacteria 7000
346 Ga0373937_0020455 3300036401 Bacteria 5933
347 Ga0373937_0180487 3300036401 Bacteria 1982
348 Ga0316582_0044657 3300036647 Unclassified 2787
349 Ga0316584_0143030 3300036712 Bacteria 1783
350 Ga0395899_0131218 3300037312 Bacteria 1789
351 Ga0395905_0024421 3300037471 Bacteria 5705
352 Ga0395901_0034260 3300038443 Bacteria 5243
353 Ga0395901_0034385 3300038443 Bacteria 5234
354 Ga0395901_0069435 3300038443 Bacteria 3669
355 Ga0436365_0937010 3300039437 Bacteria 1837
356 Ga0436365_1617505 3300039437 Bacteria 3015
357 Ga0436361_0474393 3300039447 Bacteria 166415
358 Ga0451797_0070233 3300041453 Bacteria 4040
359 Ga0451577_0000109 3300042876 Bacteria 183296
360 Ga0451577_0000221 3300042876 Bacteria 117688
361 Ga0451577_0008000 3300042876 Bacteria 10321
362 Ga0451577_0008134 3300042876 Bacteria 10231
363 Ga0451577_0019928 3300042876 Bacteria 6160
364 Ga0451577_0145806 3300042876 Bacteria 2129
365 Ga0466969_0008379 3300044656 Bacteria 5481
366 Ga0453683_0000786 3300044673 Bacteria 31394
367 Ga0466965_0032694 3300044683 Bacteria 2541
368 Ga0466965_0042482 3300044683 Bacteria 2243
369 Ga0466961_0000451 3300044693 Bacteria 26138
370 Ga0453684_0000004 3300044712 Bacteria 1469893
371 Ga0453684_0000391 3300044712 Bacteria 180292
372 Ga0453684_0005636 3300044712 Bacteria 24617
373 Ga0453684_0018601 3300044712 Bacteria 10651
374 Ga0453684_0043661 3300044712 Bacteria 6021
375 Ga0453684_0046295 3300044712 Bacteria 5786
376 Ga0453684_0091747 3300044712 Bacteria 3748
377 Ga0453684_0111955 3300044712 Bacteria 3314
378 Ga0453684_0367492 3300044712 Bacteria 1618
379 Ga0453684_0406674 3300044712 Bacteria 1523
380 Ga0453684_0413889 3300044712 Bacteria 1507
381 Ga0466959_0009252 3300045049 Bacteria 7001
382 Ga0451576_0000092 3300045051 Bacteria 227293
383 Ga0451576_0007790 3300045051 Bacteria 12704
384 Ga0495651_0024987 3300046462 Bacteria 4648
385 Ga0495651_0029650 3300046462 Bacteria 4266
386 Ga0495580_0038647 3300046472 Bacteria 3417
387 Ga0495580_0074515 3300046472 Bacteria 2369
388 Ga0495582_0020833 3300046473 Bacteria 3590
389 Ga0495618_0004573 3300046514 Bacteria 8489
390 Ga0495618_0021434 3300046514 Bacteria 3984
391 Ga0495630_0002413 3300046517 Bacteria 12975
392 Ga0495630_0014524 3300046517 Bacteria 5739
393 Ga0495666_0059621 3300046526 Bacteria 1825
394 Ga0495652_0047945 3300046529 Bacteria 3663
395 Ga0495652_0080454 3300046529 Bacteria 2691
396 Ga0495640_0053931 3300046533 Bacteria 2756
397 Ga0495640_0059595 3300046533 Bacteria 2599
398 Ga0495586_0003936 3300046535 Bacteria 7970
399 Ga0495586_0085793 3300046535 Bacteria 1735
400 Ga0495587_0001593 3300046536 Bacteria 15113
401 Ga0495667_0007699 3300046559 Bacteria 7301
402 Ga0495634_0012088 3300046642 Bacteria 6258
403 Ga0495634_0042720 3300046642 Bacteria 3074
404 Ga0495635_0105814 3300046663 Bacteria 1922
405 Ga0495623_0015651 3300046679 Bacteria 4904
406 Ga0495623_0046286 3300046679 Bacteria 2762
407 Ga0495658_0109100 3300046683 Bacteria 1662
408 Ga0495613_0006847 3300046689 Bacteria 8512
409 Ga0495613_0007561 3300046689 Bacteria 8086
410 Ga0495624_0014363 3300046690 Bacteria 5376
411 Ga0495604_0021464 3300047317 Bacteria 5155
412 Ga0495674_0008123 3300047319 Bacteria 10018
413 Ga0495674_0029650 3300047319 Bacteria 4980
414 Ga0495680_0027123 3300047322 Bacteria 4710
415 Ga0495680_0034699 3300047322 Bacteria 4070
416 Ga0495675_0001106 3300047444 Bacteria 16360
417 Ga0495684_0006556 3300047471 Bacteria 9029
418 Ga0495684_0065324 3300047471 Bacteria 2766
419 Ga0495602_0000325 3300048088 Bacteria 43966
420 Ga0495602_0004215 3300048088 Bacteria 14958
421 Ga0495626_0017273 3300048091 Bacteria 3649
422 Ga0496108_0054713 3300048911 Bacteria 3349
423 Ga0496110_0040825 3300048913 Bacteria 4045
424 Ga0496125_0000123 3300048928 Bacteria 170244
425 Ga0501034_0000184 3300049571 Bacteria 117409
426 Ga0501034_0002681 3300049571 Bacteria 20988
427 Ga0501034_0014362 3300049571 Bacteria 8160
428 Ga0501034_0020847 3300049571 Bacteria 6689
429 Ga0501034_0244095 3300049571 Bacteria 1741
430 Ga0501036_0114840 3300049572 Bacteria 2275
431 Ga0501037_0005778 3300049573 Bacteria 9034
432 Ga0501037_0008821 3300049573 Bacteria 7388
433 Ga0501037_0014756 3300049573 Bacteria 5747
434 Ga0501037_0073256 3300049573 Bacteria 2490
435 Ga0501038_0001006 3300049574 Bacteria 25406
436 Ga0501038_0023431 3300049574 Bacteria 5519
437 Ga0501047_0000045 3300049581 Bacteria 174068
438 Ga0501047_0009600 3300049581 Bacteria 9147
439 Ga0501047_0011476 3300049581 Bacteria 8384
440 Ga0501047_0070721 3300049581 Bacteria 3360
441 Ga0501047_0097112 3300049581 Bacteria 2824
442 Ga0501047_0155309 3300049581 Bacteria 2162
443 Ga0501067_0000029 3300049583 Bacteria 88705
444 Ga0501070_0071545 3300049586 Unclassified 2871
445 Ga0501070_0085409 3300049586 Bacteria 2613
446 Ga0501070_0090531 3300049586 Bacteria 2532
447 Ga0501070_0093102 3300049586 Bacteria 2493
448 Ga0501072_0038686 3300049588 Bacteria 3744
449 Ga0501073_0104784 3300049589 Bacteria 1963
450 Ga0501074_0004851 3300049590 Bacteria 9645
451 Ga0501209_001942 3300049656 Bacteria 3061
452 Ga0501227_000403 3300049665 Bacteria 9157
453 Ga0501227_002952 3300049665 Bacteria 3720
454 Ga0501230_000364 3300049667 Bacteria 4338
455 Ga0501249_005728 3300049679 Bacteria 2539
456 Ga0501225_0020095 3300049705 Bacteria 1846
457 Ga0501080_0019166 3300049742 Bacteria 6335
458 Ga0501080_0029833 3300049742 Bacteria 5076
459 Ga0501080_0101447 3300049742 Bacteria 2670
460 Ga0501080_0117587 3300049742 Bacteria 2464
461 Ga0501083_0008678 3300049744 Bacteria 7168
462 Ga0501083_0028926 3300049744 Bacteria 3816
463 Ga0501035_0001322 3300049822 Bacteria 25575
464 Ga0501044_0000531 3300049823 Bacteria 46328
465 Ga0501044_0001133 3300049823 Bacteria 31671
466 Ga0501044_0008786 3300049823 Bacteria 11052
467 Ga0501044_0009076 3300049823 Bacteria 10868
468 nmdc:mga0k408_26410_c1 3300050493 Bacteria 3292
469 nmdc:mga0k408_26477_c1 3300050493 Bacteria 3288
470 nmdc:mga0k408_9428_c1 3300050493 Bacteria 5259
471 nmdc:mga07m45_104263_c1 3300050496 Bacteria 1630
472 nmdc:mga05p37_201539_c1 3300050507 Bacteria 2410
473 nmdc:mga05p37_23963_c1 3300050507 Bacteria 7412
474 nmdc:mga05p37_39311_c1 3300050507 Bacteria 5808
475 nmdc:mga09592_15303_c1 3300050508 Bacteria 6266
476 nmdc:mga09592_18639_c1 3300050508 Bacteria 5692
477 nmdc:mga09592_21674_c1 3300050508 Bacteria 5297
478 nmdc:mga09592_39229_c2 3300050508 Bacteria 3379
479 nmdc:mga0qj67_30964_c1 3300050509 Bacteria 4166
480 nmdc:mga0qj67_91812_c1 3300050509 Bacteria 2440
481 nmdc:mga06r32_16183_c1 3300050510 Bacteria 6794
482 nmdc:mga06r32_6677_c1 3300050510 Bacteria 10370
483 nmdc:mga08y16_15399_c1 3300050511 Bacteria 8043
484 nmdc:mga08y16_19574_c1 3300050511 Bacteria 7136
485 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
486 nmdc:mga0a205_1705_c1 3300050515 Bacteria 18968
487 nmdc:mga0a205_185651_c1 3300050515 Unclassified 1972
488 Ga0500555_000003 3300053103 Bacteria 392994
489 Ga0500555_018827 3300053103 Bacteria 1991
490 Ga0500645_004742 3300053730 Bacteria 5148
491 Ga0590071_007552 3300059421 Bacteria 2573
492 Ga0590074_003635 3300059423 Bacteria 2551
493 Ga0590075_001301 3300059424 Bacteria 6273
494 Ga0590077_002172 3300059426 Bacteria 4282
495 Ga0530510_0060392 3300061734 Bacteria 2743
496 2545673046 2545555834 Bacteria 8130841
497 2687235255 2684623219 Bacteria 8442773
498 2787508123 2786546548 Bacteria 4745694
499 641645930 641522639 Bacteria 7737025
500 643604447 643348564 Bacteria 8839022
501 Ga0070675_100012239
502 Ga0070658_10002014
503 Ga0070658_10002305
504 Ga0070658_10119861
505 Ga0070683_100002947
506 Ga0070683_100003032
507 Ga0070683_100003034
508 Ga0070683_100042245
509 Ga0070670_100015322
510 Ga0068869_100120830
511 Ga0070680_100015737
512 Ga0070682_100001159
513 Ga0070660_100013821
514 Ga0070689_100000018
515 Ga0070689_100040501
516 Ga0070691_10001614
517 Ga0070669_100084911
518 Ga0070669_100125656
519 Ga0070671_100004452
520 Ga0070673_100075499
521 Ga0070713_100044427
522 Ga0070710_10024136
523 Ga0070694_100058153
524 Ga0070708_100000199
525 Ga0070708_100016212
526 Ga0070681_10002113
527 Ga0068867_100198382
528 Ga0070707_100000623
529 Ga0070698_100000234
530 Ga0070698_100024919
531 Ga0070698_100071512
532 Ga0070698_100189843
533 Ga0070679_100001654
534 Ga0070679_100022776
535 Ga0070684_100007455
536 Ga0070684_100015277
537 Ga0070684_100064791
538 Ga0070697_100002532
539 Ga0068853_100121079
540 Ga0070672_100000117
541 Ga0070686_100078835
542 Ga0070695_100001962
543 Ga0070665_100038327
544 Ga0068855_100000016
545 Ga0068855_100003698
546 Ga0068855_100010965
547 Ga0068855_100078647
548 Ga0068855_100097264
549 Ga0068855_100223816
550 Ga0070664_100010911
551 Ga0070664_100044724
552 Ga0068857_100001982
553 Ga0068857_100005964
554 Ga0068857_100030545
555 Ga0068857_100081292
556 Ga0068856_100004582
557 Ga0068856_100005355
558 Ga0068856_100039681
559 Ga0068856_100049947
560 Ga0068856_100059429
561 Ga0068856_100104713
562 Ga0068852_100107645
563 Ga0068859_100009083
564 Ga0068859_100021654
565 Ga0068858_100045857
566 Ga0068858_100048214
567 Ga0068858_100065463
568 Ga0068860_100047678
569 Ga0068860_100131942
570 Ga0068862_100053974
571 Ga0081538_10083673
572 Ga0081539_10001217
573 Ga0075366_10016109
574 Ga0097621_100049180
575 Ga0097621_100102427
576 Ga0068871_100095682
577 Ga0075428_100000008
578 Ga0075428_100003724
579 Ga0075428_100015039
580 Ga0075428_100017006
581 Ga0075430_100037752
582 Ga0075431_100004874
583 Ga0075433_10006297
584 Ga0075429_100016079
585 Ga0075429_100147595
586 Ga0097620_100009083
587 Ga0097620_100013449
588 Ga0097620_100021654
589 Ga0105240_10007627
590 Ga0105240_10008927
591 Ga0105240_10032224
592 Ga0105240_10039030
593 Ga0105240_10052227
594 Ga0105240_10090572
595 Ga0105240_10134588
596 Ga0111539_10000020
597 Ga0111539_10008628
598 Ga0111539_10031248
599 Ga0111539_10087970
600 Ga0111539_10109483
601 Ga0111539_10334045
602 Ga0105245_10000793
603 Ga0105245_10001855
604 Ga0105245_10007667
605 Ga0105245_10048905
606 Ga0105245_10087584
607 Ga0105245_10214431
608 Ga0114129_10052639
609 Ga0105243_10065399
610 Ga0105241_10001538
611 Ga0105241_10015127
612 Ga0105241_10037971
613 Ga0105241_10088883
614 Ga0105242_10044095
615 Ga0105242_10086715
616 Ga0105248_10009858
617 Ga0105248_10061939
618 Ga0105248_10079900
619 Ga0105248_10177900
620 Ga0105237_10000019
621 Ga0105237_10010541
622 Ga0105237_10015466
623 Ga0105237_10030875
624 Ga0105237_10053422
625 Ga0105237_10198948
626 Ga0105238_10002952
627 Ga0105238_10003665
628 Ga0105238_10007713
629 Ga0105238_10015836
630 Ga0105238_10035701
631 Ga0105238_10062729
632 Ga0105238_10068295
633 Ga0105249_10192558
634 Ga0105249_10314045
635 Ga0105239_10002080
636 Ga0105239_10015145
637 Ga0105239_10031841
638 Ga0105239_10042928
639 Ga0105239_10190096
640 Ga0157373_10088774
641 Ga0157370_10001648
642 Ga0157370_10042557
643 Ga0157369_10005370
644 Ga0157369_10009576
645 Ga0157369_10011132
646 Ga0157378_10000931
647 Ga0157378_10013777
648 Ga0157378_10112969
649 Ga0163162_10132277
650 Ga0157372_10005849
651 Ga0157372_10010730
652 Ga0157372_10013491
653 Ga0157372_10044524
654 Ga0157372_10091566
655 Ga0157372_10181946
656 Ga0157372_10243214
657 Ga0157375_10004009
658 Ga0157375_10143079
659 Ga0163163_10014129
660 Ga0163163_10043302
661 Ga0163163_10078056
662 Ga0163163_10094852
663 Ga0163163_10103851
664 Ga0163163_10113688
665 Ga0163163_10211560
666 Ga0157379_10065119
667 Ga0157379_10154442
668 Ga0157376_10007663
669 Ga0157376_10062758
670 Ga0213872_10000668
671 Ga0207692_10022091
672 Ga0207642_10038388
673 Ga0207710_10000626
674 Ga0207680_10042615
675 Ga0207705_10002305
676 Ga0207705_10014924
677 Ga0207705_10075525
678 Ga0207705_10103736
679 Ga0207684_10000055
680 Ga0207654_10016069
681 Ga0207654_10055264
682 Ga0207707_10004185
683 Ga0207707_10043182
684 Ga0207707_10097889
685 Ga0207695_10000211
686 Ga0207695_10000753
687 Ga0207695_10002330
688 Ga0207695_10003821
689 Ga0207695_10004312
690 Ga0207695_10010450
691 Ga0207695_10023310
692 Ga0207695_10143166
693 Ga0207671_10025599
694 Ga0207671_10059664
695 Ga0207671_10070649
696 Ga0207660_10036092
697 Ga0207657_10042165
698 Ga0207657_10058398
699 Ga0207652_10007101
700 Ga0207652_10117073
701 Ga0207694_10001895
702 Ga0207694_10004266
703 Ga0207694_10006387
704 Ga0207694_10008862
705 Ga0207694_10010449
706 Ga0207694_10011341
707 Ga0207694_10091762
708 Ga0207650_10039036
709 Ga0207659_10038125
710 Ga0207687_10001249
711 Ga0207687_10001930
712 Ga0207687_10003611
713 Ga0207687_10024265
714 Ga0207687_10123174
715 Ga0207664_10245117
716 Ga0207686_10095660
717 Ga0207709_10020932
718 Ga0207670_10000001
719 Ga0207670_10003265
720 Ga0207704_10196089
721 Ga0207691_10020054
722 Ga0207711_10006182
723 Ga0207711_10041475
724 Ga0207711_10301125
725 Ga0207689_10038369
726 Ga0207661_10002594
727 Ga0207661_10012917
728 Ga0207661_10020363
729 Ga0207661_10036362
730 Ga0207661_10103374
731 Ga0207667_10000099
732 Ga0207667_10000522
733 Ga0207667_10001917
734 Ga0207667_10010114
735 Ga0207667_10011911
736 Ga0207667_10064804
737 Ga0207667_10141089
738 Ga0207712_10173260
739 Ga0207668_10055664
740 Ga0207703_10017568
741 Ga0207703_10038358
742 Ga0207703_10062192
743 Ga0207703_10158477
744 Ga0207639_10149572
745 Ga0207639_10154142
746 Ga0207702_10007686
747 Ga0207702_10026486
748 Ga0207648_10077774
749 Ga0207648_10237076
750 Ga0207676_10094888
751 Ga0207674_10000475
752 Ga0207674_10001061
753 Ga0207674_10002732
754 Ga0207674_10003663
755 Ga0207674_10025924
756 Ga0207675_100020536
757 Ga0207675_100048421
758 Ga0207675_100239158
759 Ga0207698_10032620
760 Ga0209971_1011044
761 Ga0207428_10000021
762 Ga0207428_10019294
763 Ga0207428_10097631
764 Ga0268266_10049493
765 Ga0268265_10027164
766 Ga0268265_10185700
767 Ga0268264_10010942
768 Ga0268264_10165218
769 Ga0265337_1000093
770 Ga0265337_1005870
771 Ga0265337_1022063
772 Ga0265319_1000019
773 Ga0265334_10019406
774 Ga0265334_10028254
775 Ga0265334_10049389
776 Ga0265318_10000030
777 Ga0265318_10001726
778 Ga0265318_10002304
779 Ga0265336_10009335
780 Ga0265338_10007694
781 Ga0265338_10009419
782 Ga0265338_10011550
783 Ga0265338_10023709
784 Ga0265338_10024511
785 Ga0265338_10035478
786 Ga0265338_10118138
787 Ga0265330_10000115
788 Ga0265330_10002258
789 Ga0265330_10007791
790 Ga0265332_10000454
791 Ga0265332_10002129
792 Ga0265332_10003266
793 Ga0265332_10008082
794 Ga0265328_10004244
795 Ga0265328_10028328
796 Ga0265320_10000017
797 Ga0265320_10000195
798 Ga0265320_10004518
799 Ga0265320_10010668
800 Ga0265325_10082874
801 Ga0265329_10001789
802 Ga0265329_10011298
803 Ga0265339_10000416
804 Ga0265339_10001031
805 Ga0265339_10005790
806 Ga0265331_10000027
807 Ga0265331_10003556
808 Ga0265331_10003854
809 Ga0265331_10005800
810 Ga0265327_10016853
811 Ga0265316_10001437
812 Ga0265316_10002671
813 Ga0265316_10010666
814 Ga0265316_10014098
815 Ga0265316_10042222
816 Ga0265313_10000744
817 Ga0265313_10005276
818 Ga0307508_10011073
819 Ga0307508_10093796
820 Ga0265314_10000001
821 Ga0265314_10000069
822 Ga0265314_10000316
823 Ga0265314_10002587
824 Ga0265314_10002631
825 Ga0265314_10002830
826 Ga0265314_10023229
827 Ga0265314_10050070
828 Ga0265314_10083977
829 Ga0265342_10005369
830 Ga0265342_10020893
831 Ga0307516_10008408
832 Ga0307405_10017107
833 Ga0307405_10171227
834 Ga0373950_0000006
835 Ga0373934_0006682
836 Ga0373932_0000589
837 Ga0373954_0005738
838 Ga0373954_0011669
839 Ga0373954_0023935
840 Ga0373927_0011353
841 Ga0373933_0000341
842 Ga0373933_0055438
843 Ga0373947_0002461
844 Ga0373937_0002952
845 Ga0373937_0014323
846 Ga0373937_0020455
847 Ga0373937_0180487
848 Ga0316582_0044657
849 Ga0316584_0143030
850 Ga0395899_0131218
851 Ga0395905_0024421
852 Ga0395901_0034260
853 Ga0395901_0034385
854 Ga0395901_0069435
855 Ga0436365_0937010
856 Ga0436365_1617505
857 Ga0436361_0474393
858 Ga0451797_0070233
859 Ga0451577_0000109
860 Ga0451577_0000221
861 Ga0451577_0008000
862 Ga0451577_0008134
863 Ga0451577_0019928
864 Ga0451577_0145806
865 Ga0466969_0008379
866 Ga0453683_0000786
867 Ga0466965_0032694
868 Ga0466965_0042482
869 Ga0466961_0000451
870 Ga0453684_0000004
871 Ga0453684_0000391
872 Ga0453684_0005636
873 Ga0453684_0018601
874 Ga0453684_0043661
875 Ga0453684_0046295
876 Ga0453684_0091747
877 Ga0453684_0111955
878 Ga0453684_0367492
879 Ga0453684_0406674
880 Ga0453684_0413889
881 Ga0466959_0009252
882 Ga0451576_0000092
883 Ga0451576_0007790
884 Ga0495651_0024987
885 Ga0495651_0029650
886 Ga0495580_0038647
887 Ga0495580_0074515
888 Ga0495582_0020833
889 Ga0495618_0004573
890 Ga0495618_0021434
891 Ga0495630_0002413
892 Ga0495630_0014524
893 Ga0495666_0059621
894 Ga0495652_0047945
895 Ga0495652_0080454
896 Ga0495640_0053931
897 Ga0495640_0059595
898 Ga0495586_0003936
899 Ga0495586_0085793
900 Ga0495587_0001593
901 Ga0495667_0007699
902 Ga0495634_0012088
903 Ga0495634_0042720
904 Ga0495635_0105814
905 Ga0495623_0015651
906 Ga0495623_0046286
907 Ga0495658_0109100
908 Ga0495613_0006847
909 Ga0495613_0007561
910 Ga0495624_0014363
911 Ga0495604_0021464
912 Ga0495674_0008123
913 Ga0495674_0029650
914 Ga0495680_0027123
915 Ga0495680_0034699
916 Ga0495675_0001106
917 Ga0495684_0006556
918 Ga0495684_0065324
919 Ga0495602_0000325
920 Ga0495602_0004215
921 Ga0495626_0017273
922 Ga0496108_0054713
923 Ga0496110_0040825
924 Ga0496125_0000123
925 Ga0501034_0000184
926 Ga0501034_0002681
927 Ga0501034_0014362
928 Ga0501034_0020847
929 Ga0501034_0244095
930 Ga0501036_0114840
931 Ga0501037_0005778
932 Ga0501037_0008821
933 Ga0501037_0014756
934 Ga0501037_0073256
935 Ga0501038_0001006
936 Ga0501038_0023431
937 Ga0501047_0000045
938 Ga0501047_0009600
939 Ga0501047_0011476
940 Ga0501047_0070721
941 Ga0501047_0097112
942 Ga0501047_0155309
943 Ga0501067_0000029
944 Ga0501070_0071545
945 Ga0501070_0085409
946 Ga0501070_0090531
947 Ga0501070_0093102
948 Ga0501072_0038686
949 Ga0501073_0104784
950 Ga0501074_0004851
951 Ga0501209_001942
952 Ga0501227_000403
953 Ga0501227_002952
954 Ga0501230_000364
955 Ga0501249_005728
956 Ga0501225_0020095
957 Ga0501080_0019166
958 Ga0501080_0029833
959 Ga0501080_0101447
960 Ga0501080_0117587
961 Ga0501083_0008678
962 Ga0501083_0028926
963 Ga0501035_0001322
964 Ga0501044_0000531
965 Ga0501044_0001133
966 Ga0501044_0008786
967 Ga0501044_0009076
968 nmdc:mga0k408_26410_c1
969 nmdc:mga0k408_26477_c1
970 nmdc:mga0k408_9428_c1
971 nmdc:mga07m45_104263_c1
972 nmdc:mga05p37_201539_c1
973 nmdc:mga05p37_23963_c1
974 nmdc:mga05p37_39311_c1
975 nmdc:mga09592_15303_c1
976 nmdc:mga09592_18639_c1
977 nmdc:mga09592_21674_c1
978 nmdc:mga09592_39229_c2
979 nmdc:mga0qj67_30964_c1
980 nmdc:mga0qj67_91812_c1
981 nmdc:mga06r32_16183_c1
982 nmdc:mga06r32_6677_c1
983 nmdc:mga08y16_15399_c1
984 nmdc:mga08y16_19574_c1
985 nmdc:mga08y16_8_c1
986 nmdc:mga0a205_1705_c1
987 nmdc:mga0a205_185651_c1
988 Ga0500555_000003
989 Ga0500555_018827
990 Ga0500645_004742
991 Ga0590071_007552
992 Ga0590074_003635
993 Ga0590075_001301
994 Ga0590077_002172
995 Ga0530510_0060392
996 2545673046
997 2687235255
998 2787508123
999 641645930
1000 643604447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03916

NrfD

Polysulphide reductase, NrfD

89

419

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.9504 25 467
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.9497 32 467
6f0k-assembly1.cif.gz_C alternative complex iii 0.9366 32 474
6f0k-assembly1.cif.gz_C alternative complex iii 0.9305 32 474
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.9221 25 467
ID Description Score Start End Superfamily
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7963 93 408 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7843 93 408 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7779 92 415 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7638 92 415 1.20.1630.10
2vpwG00 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.681 92 416 1.20.1630.10
ID Description Score Start End GO Terms
AF-A0A358EE22-F1-model_v4 Hydrogenase 0.9799 183 469 GO:0005886
AF-A0A534SNZ5-F1-model_v4 Hydrogenase 0.9798 188 471 GO:0005886
AF-A0A849D9D8-F1-model_v4 Polysulfide reductase NrfD 0.9785 190 471 GO:0005886
AF-A0A2E9LRX3-F1-model_v4 Hydrogenase 0.9785 235 469 GO:0005886
AF-A0A7Y2P9F1-F1-model_v4 Polysulfide reductase NrfD 0.9781 183 468 GO:0005886

Map