F455496

General Info

Members Datasets Scaffolds Average Seq Length
500 313 478 140

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100263941|Ga0068853_1002639412
Length 170
Sequence MVESAPQLTASESSILSSSNLPPIHSEFTMNDRNLLRGLFLLAISLAFGLTSLRYPIGQFSRAGPGLFPLMVSCLLLLIAVITILRSRFVEHLPLGFNIKNISIILASLCGFALISEFVNMIAGIVFMVFCASFAGTASYSVVRNLKIAAGLVAVALAFQKLLGFNLPLY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221609 Acidovorax sp. Root217 Isolate Unclassified
8 2643221611 Acidovorax sp. Root219 Isolate Unclassified
9 2818991446 Variovorax sp. 1180 Isolate Unclassified
10 2842677519 Variovorax sp. R-72495 Isolate Unclassified
11 2842733646 Variovorax sp. R-72446 Isolate Unclassified
12 2842747753 Variovorax sp. R-72060 Isolate Unclassified
13 2899924645 Variovorax sp. 369 Isolate Unclassified
14 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
15 2904456579 Variovorax sp. 2002 Isolate Unclassified
16 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
17 2928051484 Variovorax sp. 1133 Isolate Unclassified
18 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
19 2928070936 Variovorax gossypii 1167 Isolate Unclassified
20 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
21 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
216 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
217 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
218 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
219 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
222 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
223 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
224 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
225 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
226 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
227 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
228 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
237 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
289 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
312 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.2
Metatranscriptomes 0.4
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 0
Rhizoplane 9
Rhizosphere 70.6
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1133905 2162886007 Bacteria 1705
2 SwRhRL2b_contig_805671 2162886007 Bacteria 1200
3 JGI25152J39213_1003768 3300002773 Bacteria 5047
4 JGI25151J46595_10024381 3300003187 Bacteria 2475
5 rootH1_10009465 3300003316 Bacteria 1518
6 rootH1_10042863 3300003323 Bacteria 1528
7 Ga0006562J51391_1151502 3300003578 Bacteria 2510
8 Ga0055525_1000021 3300003759 Bacteria 370802
9 Ga0055535_1000075 3300003761 Bacteria 111667
10 Ga0055542_1000059 3300003762 Bacteria 162670
11 Ga0055530_10000110 3300003791 Bacteria 71015
12 Ga0055540_1001401 3300003792 Bacteria 14381
13 Ga0055540_1002424 3300003792 Bacteria 9858
14 Ga0055531_10001413 3300003794 Bacteria 17732
15 Ga0055543_1000644 3300004625 Bacteria 18672
16 Ga0058862_11893894 3300004803 Bacteria 629
17 Ga0065714_10003364 3300005288 Bacteria 12768
18 Ga0065704_10008021 3300005289 Bacteria 2814
19 Ga0070658_10018794 3300005327 Bacteria 5536
20 Ga0070676_10547651 3300005328 Bacteria 828
21 Ga0070683_100037905 3300005329 Bacteria 4415
22 Ga0070683_100197063 3300005329 Bacteria 1913
23 Ga0070680_100050642 3300005336 Bacteria 3388
24 Ga0068868_100980961 3300005338 Bacteria 772
25 Ga0068868_101055707 3300005338 Bacteria 746
26 Ga0070660_100011925 3300005339 Bacteria 6200
27 Ga0070660_100239910 3300005339 Bacteria 1476
28 Ga0070661_100026217 3300005344 Bacteria 4190
29 Ga0070669_100043497 3300005353 Bacteria 3271
30 Ga0070675_101848967 3300005354 Bacteria 557
31 Ga0070671_100006289 3300005355 Bacteria 9466
32 Ga0070659_100012771 3300005366 Bacteria 6236
33 Ga0070667_100850646 3300005367 Bacteria 848
34 Ga0070714_100281266 3300005435 Bacteria 1546
35 Ga0070713_100002534 3300005436 Bacteria 11950
36 Ga0070694_100779511 3300005444 Unclassified 783
37 Ga0070708_100189520 3300005445 Bacteria 1923
38 Ga0070678_100648075 3300005456 Bacteria 947
39 Ga0070678_101539945 3300005456 Bacteria 623
40 Ga0070662_100095764 3300005457 Bacteria 2238
41 Ga0070681_10210008 3300005458 Bacteria 1863
42 Ga0070681_10269862 3300005458 Bacteria 1613
43 Ga0068867_100169390 3300005459 Bacteria 1729
44 Ga0070706_100002053 3300005467 Bacteria 20636
45 Ga0070706_100106729 3300005467 Bacteria 2605
46 Ga0070706_100167442 3300005467 Bacteria 2052
47 Ga0070707_100073705 3300005468 Bacteria 3292
48 Ga0070707_100086667 3300005468 Bacteria 3028
49 Ga0070707_100209098 3300005468 Bacteria 1902
50 Ga0070698_100144502 3300005471 Bacteria 2329
51 Ga0070698_100568509 3300005471 Bacteria 1073
52 Ga0070699_100070610 3300005518 Bacteria 3036
53 Ga0070699_100346288 3300005518 Bacteria 1338
54 Ga0070679_100154427 3300005530 Bacteria 2271
55 Ga0070684_100040104 3300005535 Bacteria 4030
56 Ga0070697_100038643 3300005536 Bacteria 3857
57 Ga0070697_100183223 3300005536 Bacteria 1775
58 Ga0070697_100879216 3300005536 Bacteria 794
59 Ga0068853_100263941 3300005539 Bacteria 1584
60 Ga0068853_100731835 3300005539 Bacteria 945
61 Ga0070672_100405838 3300005543 Bacteria 1168
62 Ga0070695_100209656 3300005545 Bacteria 1398
63 Ga0070693_100058782 3300005547 Bacteria 2227
64 Ga0070704_100042061 3300005549 Bacteria 3158
65 Ga0068855_100020731 3300005563 Bacteria 7883
66 Ga0068855_100075156 3300005563 Bacteria 3924
67 Ga0070664_100197120 3300005564 Bacteria 1795
68 Ga0070664_100306808 3300005564 Bacteria 1435
69 Ga0068857_100039274 3300005577 Bacteria 4192
70 Ga0068854_100023726 3300005578 Bacteria 4192
71 Ga0068856_100045151 3300005614 Bacteria 4337
72 Ga0068856_100146124 3300005614 Bacteria 2372
73 Ga0068856_101587004 3300005614 Bacteria 668
74 Ga0068852_100193466 3300005616 Bacteria 1921
75 Ga0068852_100869859 3300005616 Bacteria 917
76 Ga0068852_102149999 3300005616 Bacteria 580
77 Ga0068851_10021016 3300005834 Bacteria 3166
78 Ga0068851_10022285 3300005834 Bacteria 3083
79 Ga0068863_100055539 3300005841 Bacteria 3750
80 Ga0068863_100140314 3300005841 Bacteria 2309
81 Ga0068863_100731174 3300005841 Bacteria 985
82 Ga0068863_101631500 3300005841 Bacteria 654
83 Ga0068858_100185412 3300005842 Bacteria 1965
84 Ga0068858_101040500 3300005842 Bacteria 803
85 Ga0068858_101533645 3300005842 Unclassified 657
86 Ga0068860_100177803 3300005843 Bacteria 2057
87 Ga0081455_10000529 3300005937 Bacteria 49513
88 Ga0075365_10368868 3300006038 Bacteria 1012
89 Ga0075365_10955186 3300006038 Bacteria 604
90 Ga0075368_10186748 3300006042 Bacteria 875
91 Ga0075363_100288999 3300006048 Bacteria 950
92 Ga0075363_100421555 3300006048 Bacteria 786
93 Ga0075364_10054702 3300006051 Bacteria 2610
94 Ga0075362_10309204 3300006177 Bacteria 785
95 Ga0075367_10024820 3300006178 Bacteria 3382
96 Ga0075367_10686544 3300006178 Unclassified 651
97 Ga0075366_10161603 3300006195 Bacteria 1357
98 Ga0097621_101351016 3300006237 Bacteria 674
99 Ga0097621_101527055 3300006237 Bacteria 634
100 Ga0075370_10004816 3300006353 Bacteria 6609
101 Ga0075370_10048797 3300006353 Bacteria 2399
102 Ga0075370_10050853 3300006353 Bacteria 2351
103 Ga0068871_100064781 3300006358 Bacteria 2992
104 Ga0068871_100728579 3300006358 Bacteria 910
105 Ga0075434_100311127 3300006871 Bacteria 1595
106 Ga0075434_100504952 3300006871 Bacteria 1230
107 Ga0075436_100390698 3300006914 Bacteria 1007
108 Ga0075435_100242382 3300007076 Bacteria 1533
109 Ga0075435_100378493 3300007076 Bacteria 1216
110 Ga0099795_10395329 3300007788 Bacteria 627
111 Ga0099795_10409304 3300007788 Unclassified 618
112 Ga0105244_10001741 3300009036 Bacteria 17118
113 Ga0105250_10164128 3300009092 Bacteria 928
114 Ga0105240_10002500 3300009093 Bacteria 29543
115 Ga0105240_10013969 3300009093 Bacteria 10992
116 Ga0105240_10158852 3300009093 Bacteria 2687
117 Ga0105240_10163703 3300009093 Bacteria 2640
118 Ga0105240_10394371 3300009093 Bacteria 1560
119 Ga0105245_11216601 3300009098 Bacteria 801
120 Ga0114129_11415327 3300009147 Bacteria 857
121 Ga0105243_10006549 3300009148 Bacteria 8996
122 Ga0105243_10050457 3300009148 Bacteria 3287
123 Ga0105243_10320348 3300009148 Bacteria 1412
124 Ga0105241_10396362 3300009174 Bacteria 1210
125 Ga0105242_10324007 3300009176 Bacteria 1414
126 Ga0105248_10029905 3300009177 Bacteria 6078
127 Ga0105237_10015430 3300009545 Bacteria 7951
128 Ga0105237_10196836 3300009545 Bacteria 2015
129 Ga0105238_10046432 3300009551 Bacteria 4384
130 Ga0105238_10053582 3300009551 Bacteria 4053
131 Ga0105238_10059178 3300009551 Bacteria 3839
132 Ga0105238_10181069 3300009551 Bacteria 2084
133 Ga0105238_10190543 3300009551 Bacteria 2027
134 Ga0105238_11034431 3300009551 Bacteria 843
135 Ga0105238_11203509 3300009551 Bacteria 782
136 Ga0105239_10264706 3300010375 Bacteria 1933
137 Ga0105239_10484359 3300010375 Bacteria 1405
138 Ga0105246_10086083 3300011119 Bacteria 2252
139 Ga0157373_10006142 3300013100 Bacteria 8982
140 Ga0157373_10027357 3300013100 Bacteria 4114
141 Ga0157373_10035735 3300013100 Bacteria 3565
142 Ga0157371_10013731 3300013102 Bacteria 6141
143 Ga0157371_10228626 3300013102 Bacteria 1337
144 Ga0157371_10268154 3300013102 Bacteria 1232
145 Ga0157370_10219255 3300013104 Bacteria 1762
146 Ga0157370_10624902 3300013104 Bacteria 985
147 Ga0157370_10719497 3300013104 Bacteria 911
148 Ga0157369_10000843 3300013105 Bacteria 39252
149 Ga0157369_10060646 3300013105 Bacteria 4079
150 Ga0157374_10031324 3300013296 Bacteria 4833
151 Ga0157374_10240703 3300013296 Bacteria 1779
152 Ga0157378_10020288 3300013297 Bacteria 5845
153 Ga0157378_10688837 3300013297 Bacteria 1040
154 Ga0157378_11287358 3300013297 Bacteria 772
155 Ga0157372_10014374 3300013307 Bacteria 8465
156 Ga0157372_10030694 3300013307 Bacteria 5881
157 Ga0157372_10041765 3300013307 Bacteria 5070
158 Ga0157372_12643798 3300013307 Bacteria 576
159 Ga0157375_10762661 3300013308 Bacteria 1118
160 Ga0182008_10001695 3300014497 Bacteria 14479
161 Ga0182008_10018301 3300014497 Bacteria 3627
162 Ga0182008_10169992 3300014497 Bacteria 1100
163 Ga0157376_10293249 3300014969 Bacteria 1537
164 Ga0157376_10790852 3300014969 Bacteria 961
165 Ga0182006_1001421 3300015261 Bacteria 14485
166 Ga0182006_1054110 3300015261 Bacteria 1537
167 Ga0182007_10000269 3300015262 Bacteria 34602
168 Ga0182007_10060516 3300015262 Bacteria 1241
169 Ga0182005_1055896 3300015265 Bacteria 1076
170 Ga0163161_10079679 3300017792 Bacteria 2409
171 Ga0163161_10338879 3300017792 Bacteria 1192
172 Ga0163161_10986849 3300017792 Bacteria 718
173 Ga0209563_100005 3300025230 Bacteria 1774893
174 Ga0209051_1000979 3300025303 Bacteria 27790
175 Ga0207656_10022314 3300025321 Bacteria 2538
176 Ga0207656_10023216 3300025321 Bacteria 2495
177 Ga0207656_10035942 3300025321 Bacteria 2077
178 Ga0207653_10205235 3300025885 Bacteria 744
179 Ga0207680_11004681 3300025903 Bacteria 597
180 Ga0207645_10208452 3300025907 Bacteria 1287
181 Ga0207643_10335998 3300025908 Bacteria 946
182 Ga0207705_10082515 3300025909 Bacteria 2344
183 Ga0207684_10054550 3300025910 Bacteria 3391
184 Ga0207684_10576008 3300025910 Bacteria 962
185 Ga0207684_10883649 3300025910 Bacteria 752
186 Ga0207654_10223827 3300025911 Bacteria 1249
187 Ga0207707_10122830 3300025912 Bacteria 2271
188 Ga0207695_10040490 3300025913 Bacteria 4994
189 Ga0207695_10062860 3300025913 Bacteria 3830
190 Ga0207695_10171178 3300025913 Bacteria 2097
191 Ga0207695_10304354 3300025913 Bacteria 1485
192 Ga0207671_10008619 3300025914 Bacteria 8617
193 Ga0207671_10039086 3300025914 Bacteria 3515
194 Ga0207671_10039920 3300025914 Bacteria 3475
195 Ga0207660_10148383 3300025917 Bacteria 1800
196 Ga0207657_10016574 3300025919 Bacteria 7099
197 Ga0207657_10093005 3300025919 Bacteria 2512
198 Ga0207657_10353789 3300025919 Bacteria 1158
199 Ga0207657_10455933 3300025919 Bacteria 1003
200 Ga0207649_10043086 3300025920 Bacteria 2757
201 Ga0207652_10128265 3300025921 Bacteria 2261
202 Ga0207652_10447531 3300025921 Bacteria 1164
203 Ga0207646_10001985 3300025922 Bacteria 24574
204 Ga0207646_10640695 3300025922 Bacteria 952
205 Ga0207646_10648246 3300025922 Bacteria 946
206 Ga0207681_11168299 3300025923 Bacteria 646
207 Ga0207694_10011581 3300025924 Bacteria 6654
208 Ga0207694_10031848 3300025924 Bacteria 4031
209 Ga0207694_10106212 3300025924 Bacteria 2230
210 Ga0207694_10243677 3300025924 Bacteria 1469
211 Ga0207694_10507830 3300025924 Bacteria 1010
212 Ga0207694_10828918 3300025924 Bacteria 782
213 Ga0207650_10354946 3300025925 Bacteria 1207
214 Ga0207659_10570225 3300025926 Bacteria 963
215 Ga0207687_10009492 3300025927 Bacteria 6363
216 Ga0207687_10586269 3300025927 Bacteria 938
217 Ga0207700_10000023 3300025928 Bacteria 152285
218 Ga0207664_10252464 3300025929 Bacteria 1540
219 Ga0207644_10005689 3300025931 Bacteria 8115
220 Ga0207690_10041570 3300025932 Bacteria 3013
221 Ga0207690_10209176 3300025932 Bacteria 1486
222 Ga0207706_10038066 3300025933 Bacteria 4267
223 Ga0207706_10130152 3300025933 Bacteria 2213
224 Ga0207686_10345486 3300025934 Bacteria 1119
225 Ga0207709_10858962 3300025935 Bacteria 735
226 Ga0207709_11245038 3300025935 Bacteria 614
227 Ga0207670_10446444 3300025936 Unclassified 1042
228 Ga0207704_10312584 3300025938 Bacteria 1209
229 Ga0207665_10027809 3300025939 Bacteria 3736
230 Ga0207665_10877827 3300025939 Bacteria 711
231 Ga0207691_10222421 3300025940 Bacteria 1637
232 Ga0207711_10013786 3300025941 Bacteria 6711
233 Ga0207689_10000485 3300025942 Bacteria 37567
234 Ga0207689_10497350 3300025942 Bacteria 1021
235 Ga0207661_10152085 3300025944 Bacteria 2001
236 Ga0207679_10399865 3300025945 Bacteria 1208
237 Ga0207667_10070033 3300025949 Bacteria 3651
238 Ga0207640_10404827 3300025981 Bacteria 1112
239 Ga0207640_10579721 3300025981 Bacteria 947
240 Ga0207658_10406238 3300025986 Bacteria 1198
241 Ga0207658_10628519 3300025986 Bacteria 966
242 Ga0207677_10385619 3300026023 Bacteria 1184
243 Ga0207677_10397262 3300026023 Bacteria 1168
244 Ga0207677_10942626 3300026023 Unclassified 780
245 Ga0207703_10063010 3300026035 Bacteria 3038
246 Ga0207703_10122628 3300026035 Bacteria 2233
247 Ga0207639_10005201 3300026041 Bacteria 8778
248 Ga0207639_10056507 3300026041 Bacteria 3008
249 Ga0207639_10555439 3300026041 Bacteria 1054
250 Ga0207639_10674729 3300026041 Bacteria 957
251 Ga0207678_10019010 3300026067 Bacteria 6036
252 Ga0207678_10336875 3300026067 Bacteria 1299
253 Ga0207702_10078095 3300026078 Bacteria 2865
254 Ga0207702_11003410 3300026078 Archaea 828
255 Ga0207702_11918650 3300026078 Bacteria 583
256 Ga0207641_10019011 3300026088 Bacteria 5636
257 Ga0207641_10121814 3300026088 Bacteria 2329
258 Ga0207641_10176970 3300026088 Bacteria 1951
259 Ga0207641_12055682 3300026088 Bacteria 572
260 Ga0207648_10049361 3300026089 Bacteria 3682
261 Ga0207676_10197367 3300026095 Bacteria 1775
262 Ga0207674_10053011 3300026116 Bacteria 4135
263 Ga0207674_10314725 3300026116 Bacteria 1514
264 Ga0207675_100000216 3300026118 Bacteria 54012
265 Ga0207683_10777511 3300026121 Unclassified 888
266 Ga0207698_10100776 3300026142 Bacteria 2393
267 Ga0207698_10576920 3300026142 Bacteria 1106
268 Ga0207698_10982606 3300026142 Bacteria 854
269 Ga0209813_10188488 3300027866 Bacteria 758
270 Ga0268264_10120988 3300028381 Bacteria 2307
271 Ga0268264_11190180 3300028381 Bacteria 771
272 Ga0307517_10226113 3300028786 Unclassified 1130
273 Ga0307515_10000588 3300028794 Bacteria 85228
274 Ga0307515_10350882 3300028794 Bacteria 1122
275 Ga0316183_1205824 3300030742 Bacteria 1798
276 Ga0316181_1077792 3300030744 Bacteria 786
277 Ga0316181_1222123 3300030744 Bacteria 2027
278 Ga0316182_1158317 3300030745 Bacteria 3990
279 Ga0265330_10063991 3300031235 Bacteria 1598
280 Ga0265332_10000401 3300031238 Bacteria 31298
281 Ga0265331_10000262 3300031250 Bacteria 60603
282 Ga0265327_10009701 3300031251 Bacteria 6900
283 Ga0307513_10228514 3300031456 Bacteria 1675
284 Ga0307513_10271620 3300031456 Bacteria 1478
285 Ga0307509_10401709 3300031507 Bacteria 1077
286 Ga0307408_100166395 3300031548 Bacteria 1756
287 Ga0307508_10000030 3300031616 Bacteria 165616
288 Ga0307514_10002589 3300031649 Bacteria 18532
289 Ga0307514_10022816 3300031649 Bacteria 5083
290 Ga0265314_10063499 3300031711 Bacteria 2505
291 Ga0265342_10034460 3300031712 Bacteria 3106
292 Ga0265342_10143406 3300031712 Bacteria 1331
293 Ga0307516_10002018 3300031730 Bacteria 27692
294 Ga0307516_10074468 3300031730 Bacteria 3251
295 Ga0307405_10073519 3300031731 Bacteria 2207
296 Ga0307406_10585168 3300031901 Bacteria 918
297 Ga0307412_10139289 3300031911 Bacteria 1774
298 Ga0307412_10179871 3300031911 Bacteria 1589
299 Ga0307412_10268140 3300031911 Bacteria 1335
300 Ga0307414_11304740 3300032004 Bacteria 673
301 Ga0307507_10155844 3300033179 Bacteria 1702
302 Ga0373950_0074729 3300034818 Bacteria 699
303 Ga0373958_0043707 3300034819 Bacteria 925
304 Ga0373928_0014799 3300035084 Bacteria 1582
305 Ga0373932_0137755 3300035112 Bacteria 828
306 Ga0373943_0305856 3300035170 Unclassified 904
307 Ga0373943_0945225 3300035170 Bacteria 516
308 Ga0373935_0257976 3300035692 Bacteria 1222
309 Ga0373927_0765745 3300035695 Bacteria 638
310 Ga0373947_0574243 3300035725 Bacteria 768
311 Ga0373947_0669185 3300035725 Bacteria 708
312 Ga0373937_0738037 3300036401 Bacteria 932
313 Ga0373925_0633744 3300037068 Bacteria 881
314 Ga0395899_0008027 3300037312 Bacteria 8127
315 Ga0395900_0112102 3300037418 Bacteria 2801
316 Ga0395900_0122997 3300037418 Bacteria 2661
317 Ga0395900_0163570 3300037418 Bacteria 2269
318 Ga0395898_0023928 3300037466 Bacteria 6164
319 Ga0395898_0064104 3300037466 Bacteria 3565
320 Ga0395898_1144034 3300037466 Bacteria 711
321 Ga0395905_0129996 3300037471 Bacteria 2368
322 Ga0395905_0712504 3300037471 Bacteria 906
323 Ga0395905_0750804 3300037471 Bacteria 878
324 Ga0395901_0293102 3300038443 Bacteria 1688
325 Ga0436365_0120135 3300039437 Bacteria 692
326 Ga0436361_0091030 3300039447 Bacteria 2094
327 Ga0451787_732463 3300041441 Bacteria 934
328 Ga0451789_0208144 3300041443 Bacteria 1487
329 Ga0451797_1207466 3300041453 Bacteria 1033
330 Ga0451800_1261555 3300041459 Bacteria 1038
331 Ga0451802_1175484 3300041460 Bacteria 958
332 Ga0451807_0433055 3300041486 Bacteria 527
333 Ga0451807_1653191 3300041486 Bacteria 948
334 Ga0451833_0702241 3300041491 Bacteria 1080
335 Ga0451835_0121393 3300041492 Bacteria 976
336 Ga0451839_1208443 3300041496 Bacteria 914
337 Ga0451841_0118537 3300041498 Bacteria 577
338 Ga0451845_0541005 3300041501 Bacteria 1955
339 Ga0451851_1291770 3300041507 Bacteria 777
340 Ga0451843_0852173 3300041509 Bacteria 2370
341 Ga0451855_2054749 3300041511 Bacteria 748
342 Ga0451853_3754481 3300041512 Bacteria 1256
343 Ga0439449_0037794 3300042007 Bacteria 1796
344 Ga0439455_0011263 3300042012 Bacteria 1983
345 Ga0439434_0320390 3300042435 Bacteria 538
346 Ga0439464_0090092 3300042439 Bacteria 924
347 Ga0451577_0240257 3300042876 Bacteria 1639
348 Ga0451577_0263266 3300042876 Bacteria 1561
349 Ga0451577_1692403 3300042876 Bacteria 557
350 Ga0466969_0194863 3300044656 Bacteria 925
351 Ga0466969_0336965 3300044656 Bacteria 683
352 Ga0453683_0021324 3300044673 Bacteria 4137
353 Ga0453683_0260770 3300044673 Bacteria 1106
354 Ga0466965_0135852 3300044683 Bacteria 1277
355 Ga0466961_0189447 3300044693 Bacteria 1275
356 Ga0453684_0465695 3300044712 Bacteria 1404
357 Ga0466971_0094165 3300044719 Bacteria 1373
358 Ga0466970_0367875 3300044765 Bacteria 817
359 Ga0466957_0264821 3300044842 Bacteria 1146
360 Ga0466960_0021035 3300044901 Bacteria 2899
361 Ga0466960_0159829 3300044901 Bacteria 1209
362 Ga0466959_0466161 3300045049 Bacteria 856
363 Ga0451576_0215421 3300045051 Bacteria 2005
364 Ga0451576_0647610 3300045051 Bacteria 1110
365 Ga0466967_0892961 3300045976 Bacteria 884
366 Ga0495592_0000328 3300046454 Bacteria 39423
367 Ga0495580_0024117 3300046472 Bacteria 4459
368 Ga0495580_0064769 3300046472 Bacteria 2561
369 Ga0495582_0147315 3300046473 Bacteria 1336
370 Ga0495639_0002544 3300046475 Bacteria 7956
371 Ga0495639_0323352 3300046475 Bacteria 772
372 Ga0495664_0508658 3300046477 Bacteria 719
373 Ga0495610_0016380 3300046512 Bacteria 4269
374 Ga0495632_0179430 3300046519 Bacteria 970
375 Ga0495632_0198534 3300046519 Bacteria 914
376 Ga0495643_0085589 3300046522 Bacteria 1634
377 Ga0495643_0156440 3300046522 Bacteria 1125
378 Ga0495643_0187262 3300046522 Bacteria 1001
379 Ga0495586_0068923 3300046535 Bacteria 1930
380 Ga0495586_0125125 3300046535 Bacteria 1438
381 Ga0495645_0006456 3300046543 Bacteria 8136
382 Ga0495625_0003304 3300046660 Bacteria 16271
383 Ga0495588_0077058 3300046674 Bacteria 1738
384 Ga0495658_0023210 3300046683 Bacteria 3291
385 Ga0495671_0580736 3300046692 Bacteria 533
386 Ga0495604_0254759 3300047317 Bacteria 1195
387 Ga0495676_0153249 3300047321 Bacteria 1638
388 Ga0495676_0336519 3300047321 Bacteria 1011
389 Ga0495687_216436 3300047443 Bacteria 596
390 Ga0495686_0144795 3300047472 Bacteria 1400
391 Ga0495593_0210271 3300047673 Bacteria 977
392 Ga0495593_0481720 3300047673 Bacteria 622
393 Ga0496100_0109914 3300048903 Bacteria 1913
394 Ga0496100_0114481 3300048903 Bacteria 1879
395 Ga0496100_0368195 3300048903 Bacteria 1089
396 Ga0496101_0005715 3300048904 Bacteria 7942
397 Ga0496101_0053030 3300048904 Bacteria 2925
398 Ga0496102_0005508 3300048905 Bacteria 10749
399 Ga0496102_0035422 3300048905 Bacteria 4493
400 Ga0496102_0243665 3300048905 Bacteria 1695
401 Ga0496102_0639269 3300048905 Bacteria 987
402 Ga0496103_0265559 3300048906 Bacteria 1104
403 Ga0496103_0600020 3300048906 Bacteria 701
404 Ga0496104_0332872 3300048907 Bacteria 1431
405 Ga0496104_0396805 3300048907 Bacteria 1292
406 Ga0496104_0498979 3300048907 Bacteria 1128
407 Ga0496104_0559621 3300048907 Bacteria 1054
408 Ga0496105_0005462 3300048908 Bacteria 9647
409 Ga0496105_0220561 3300048908 Bacteria 1544
410 Ga0496106_0053197 3300048909 Bacteria 3057
411 Ga0496107_0038399 3300048910 Bacteria 3435
412 Ga0496108_0068417 3300048911 Bacteria 2996
413 Ga0496108_0267992 3300048911 Bacteria 1486
414 Ga0496108_0331442 3300048911 Bacteria 1327
415 Ga0496109_0446621 3300048912 Bacteria 1221
416 Ga0496110_0026020 3300048913 Bacteria 5003
417 Ga0496110_0044555 3300048913 Bacteria 3874
418 Ga0496111_0114695 3300048914 Bacteria 1986
419 Ga0496111_0131026 3300048914 Bacteria 1855
420 Ga0496111_0200368 3300048914 Bacteria 1484
421 Ga0496111_0705975 3300048914 Bacteria 733
422 Ga0496112_0043599 3300048915 Bacteria 4392
423 Ga0496112_0904911 3300048915 Bacteria 804
424 Ga0496113_0099411 3300048916 Bacteria 2253
425 Ga0496113_0132626 3300048916 Bacteria 1956
426 Ga0496114_0123916 3300048917 Bacteria 2225
427 Ga0496115_0114743 3300048918 Bacteria 2214
428 Ga0496117_0090613 3300048920 Bacteria 1969
429 Ga0496118_0019314 3300048921 Bacteria 6095
430 Ga0496122_0000688 3300048925 Bacteria 67392
431 Ga0496122_0064646 3300048925 Bacteria 2660
432 Ga0496122_0173095 3300048925 Bacteria 1298
433 Ga0496123_0000314 3300048926 Bacteria 92927
434 Ga0496123_0077880 3300048926 Bacteria 2034
435 Ga0496123_0214684 3300048926 Bacteria 975
436 Ga0496124_0039875 3300048927 Bacteria 4066
437 Ga0496124_0119653 3300048927 Bacteria 2106
438 Ga0496125_0081972 3300048928 Bacteria 2461
439 Ga0496125_0206662 3300048928 Bacteria 1280
440 Ga0496125_0750761 3300048928 Bacteria 511
441 Ga0501206_016097 3300049653 Bacteria 1039
442 Ga0501225_0010347 3300049705 Bacteria 2642
443 nmdc:mga03683_1992_c1 3300050489 Bacteria 1612
444 nmdc:mga03n38_204035_c1 3300050490 Bacteria 1024
445 nmdc:mga03n38_439699_c1 3300050490 Unclassified 724
446 nmdc:mga00v17_1014678_c1 3300050491 Bacteria 522
447 nmdc:mga00v17_363630_c1 3300050491 Bacteria 941
448 nmdc:mga0yw44_375176_c1 3300050492 Bacteria 960
449 nmdc:mga0k408_101826_c1 3300050493 Bacteria 1694
450 nmdc:mga0k408_333326_c1 3300050493 Bacteria 905
451 nmdc:mga0k408_377245_c1 3300050493 Bacteria 845
452 nmdc:mga0k408_940415_c1 3300050493 Bacteria 501
453 nmdc:mga06z11_114389_c1 3300050494 Bacteria 1498
454 nmdc:mga06z11_557972_c1 3300050494 Bacteria 696
455 nmdc:mga04h51_150219_c1 3300050495 Bacteria 890
456 nmdc:mga07m45_110796_c1 3300050496 Bacteria 1581
457 nmdc:mga07m45_135754_c1 3300050496 Bacteria 1424
458 nmdc:mga07m45_45882_c1 3300050496 Bacteria 2454
459 nmdc:mga05p37_2127583_c1 3300050507 Bacteria 524
460 nmdc:mga0n895_1532692_c1 3300050512 Unclassified 632
461 nmdc:mga0n895_214406_c1 3300050512 Bacteria 1955
462 nmdc:mga0n895_470091_c1 3300050512 Bacteria 1268
463 nmdc:mga0rr50_337035_c1 3300050513 Bacteria 1267
464 nmdc:mga0rr50_595903_c1 3300050513 Bacteria 942
465 nmdc:mga0rr50_601009_c1 3300050513 Bacteria 938
466 nmdc:mga08x19_350734_c1 3300050514 Bacteria 1030
467 nmdc:mga0a205_675157_c1 3300050515 Bacteria 884
468 Ga0495601_0099995 3300053077 Bacteria 1872
469 Ga0500646_0029362 3300053090 Bacteria 1505
470 Ga0500608_054840 3300053122 Bacteria 1912
471 Ga0500618_043307 3300053125 Bacteria 1029
472 Ga0500658_0044912 3300053134 Bacteria 1784
473 Ga0500559_0013547 3300053136 Bacteria 3451
474 Ga0500564_035821 3300053138 Bacteria 2291
475 Ga0500622_0271440 3300053156 Bacteria 735
476 Ga0500567_081028 3300053723 Bacteria 1401
477 Ga0500587_007339 3300053739 Bacteria 1437
478 Ga0466962_0335901 3300061719 Bacteria 751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100183223 Ga0070697_1001832232 115
2 3300005444 Ga0070694_100779511 Ga0070694_1007795112 117
3 3300005545 Ga0070695_100209656 Ga0070695_1002096562 117
4 3300005549 Ga0070704_100042061 Ga0070704_1000420612 117
5 3300025939 Ga0207665_10027809 Ga0207665_100278093 117
6 3300042435 Ga0439434_0320390 Ga0439434_0320390_12_365 117
7 3300046477 Ga0495664_0508658 Ga0495664_0508658_133_558 117
8 iso_pu_bacteria 2599185214 2599622999 124
9 iso_pu_bacteria 2599185226 2599674646 124
10 iso_pu_bacteria 2599185227 2599680603 124
11 iso_pu_bacteria 2599185229 2599692618 124
12 iso_pu_bacteria 2904449895 2904455281 124
13 iso_pu_bacteria 2904456579 2904461314 124
14 iso_pu_bacteria 2928070936 2928075825 124
15 iso_pu_bacteria 2945972063 2945972417 124
16 3300006048 Ga0075363_100421555 Ga0075363_1004215552 127
17 3300025925 Ga0207650_10354946 Ga0207650_103549461 127
18 3300050490 nmdc:mga03n38_439699_c1 nmdc:mga03n38_439699_c1_179_661 127
19 2162886007 SwRhRL2b_contig_1133905 SwRhRL2b_0207.00002880 128
20 2162886007 SwRhRL2b_contig_805671 SwRhRL2b_0928.00004210 128
21 3300002773 JGI25152J39213_1003768 JGI25152J39213_10037684 128
22 3300003187 JGI25151J46595_10024381 JGI25151J46595_100243811 128
23 3300003316 rootH1_10009465 rootH1_100094652 128
24 3300003323 rootH1_10042863 rootH1_100428633 128
25 3300003578 Ga0006562J51391_1151502 Ga0006562J51391_11515021 128
26 3300003759 Ga0055525_1000021 Ga0055525_1000021152 128
27 3300003761 Ga0055535_1000075 Ga0055535_100007578 128
28 3300003762 Ga0055542_1000059 Ga0055542_1000059125 128
29 3300003791 Ga0055530_10000110 Ga0055530_1000011037 128
30 3300003792 Ga0055540_1001401 Ga0055540_10014012 128
31 3300003792 Ga0055540_1002424 Ga0055540_10024242 128
32 3300003794 Ga0055531_10001413 Ga0055531_1000141310 128
33 3300004625 Ga0055543_1000644 Ga0055543_10006448 128
34 3300004803 Ga0058862_11893894 Ga0058862_118938942 128
35 3300005288 Ga0065714_10003364 Ga0065714_100033644 128
36 3300005289 Ga0065704_10008021 Ga0065704_100080213 128
37 3300005327 Ga0070658_10018794 Ga0070658_100187947 128
38 3300005328 Ga0070676_10547651 Ga0070676_105476511 128
39 3300005329 Ga0070683_100037905 Ga0070683_1000379052 128
40 3300005329 Ga0070683_100197063 Ga0070683_1001970631 128
41 3300005336 Ga0070680_100050642 Ga0070680_1000506426 128
42 3300005338 Ga0068868_100980961 Ga0068868_1009809611 128
43 3300005338 Ga0068868_101055707 Ga0068868_1010557071 128
44 3300005339 Ga0070660_100011925 Ga0070660_1000119252 128
45 3300005339 Ga0070660_100239910 Ga0070660_1002399102 128
46 3300005344 Ga0070661_100026217 Ga0070661_1000262172 128
47 3300005353 Ga0070669_100043497 Ga0070669_1000434971 128
48 3300005354 Ga0070675_101848967 Ga0070675_1018489671 128
49 3300005355 Ga0070671_100006289 Ga0070671_1000062896 128
50 3300005366 Ga0070659_100012771 Ga0070659_1000127717 128
51 3300005367 Ga0070667_100850646 Ga0070667_1008506461 128
52 3300005435 Ga0070714_100281266 Ga0070714_1002812661 128
53 3300005436 Ga0070713_100002534 Ga0070713_10000253410 128
54 3300005445 Ga0070708_100189520 Ga0070708_1001895202 128
55 3300005456 Ga0070678_100648075 Ga0070678_1006480752 128
56 3300005456 Ga0070678_101539945 Ga0070678_1015399451 128
57 3300005457 Ga0070662_100095764 Ga0070662_1000957641 128
58 3300005458 Ga0070681_10210008 Ga0070681_102100082 128
59 3300005458 Ga0070681_10269862 Ga0070681_102698622 128
60 3300005459 Ga0068867_100169390 Ga0068867_1001693903 128
61 3300005467 Ga0070706_100002053 Ga0070706_1000020537 128
62 3300005467 Ga0070706_100106729 Ga0070706_1001067292 128
63 3300005467 Ga0070706_100167442 Ga0070706_1001674422 128
64 3300005468 Ga0070707_100073705 Ga0070707_1000737052 128
65 3300005468 Ga0070707_100086667 Ga0070707_1000866672 128
66 3300005468 Ga0070707_100209098 Ga0070707_1002090982 128
67 3300005471 Ga0070698_100144502 Ga0070698_1001445022 128
68 3300005471 Ga0070698_100568509 Ga0070698_1005685091 128
69 3300005518 Ga0070699_100070610 Ga0070699_1000706102 128
70 3300005518 Ga0070699_100346288 Ga0070699_1003462882 128
71 3300005530 Ga0070679_100154427 Ga0070679_1001544272 128
72 3300005535 Ga0070684_100040104 Ga0070684_1000401043 128
73 3300005536 Ga0070697_100038643 Ga0070697_1000386432 128
74 3300005536 Ga0070697_100879216 Ga0070697_1008792162 128
75 3300005539 Ga0068853_100263941 Ga0068853_1002639412 128
76 3300005539 Ga0068853_100731835 Ga0068853_1007318352 128
77 3300005543 Ga0070672_100405838 Ga0070672_1004058381 128
78 3300005547 Ga0070693_100058782 Ga0070693_1000587823 128
79 3300005563 Ga0068855_100020731 Ga0068855_1000207317 128
80 3300005563 Ga0068855_100075156 Ga0068855_1000751562 128
81 3300005564 Ga0070664_100197120 Ga0070664_1001971201 128
82 3300005564 Ga0070664_100306808 Ga0070664_1003068082 128
83 3300005577 Ga0068857_100039274 Ga0068857_1000392744 128
84 3300005578 Ga0068854_100023726 Ga0068854_1000237262 128
85 3300005614 Ga0068856_100045151 Ga0068856_1000451512 128
86 3300005614 Ga0068856_100146124 Ga0068856_1001461242 128
87 3300005614 Ga0068856_101587004 Ga0068856_1015870042 128
88 3300005616 Ga0068852_100193466 Ga0068852_1001934662 128
89 3300005616 Ga0068852_100869859 Ga0068852_1008698592 128
90 3300005616 Ga0068852_102149999 Ga0068852_1021499992 128
91 3300005834 Ga0068851_10021016 Ga0068851_100210163 128
92 3300005834 Ga0068851_10022285 Ga0068851_100222852 128
93 3300005841 Ga0068863_100055539 Ga0068863_1000555392 128
94 3300005841 Ga0068863_100140314 Ga0068863_1001403143 128
95 3300005841 Ga0068863_100731174 Ga0068863_1007311742 128
96 3300005841 Ga0068863_101631500 Ga0068863_1016315002 128
97 3300005842 Ga0068858_100185412 Ga0068858_1001854122 128
98 3300005842 Ga0068858_101040500 Ga0068858_1010405001 128
99 3300005842 Ga0068858_101533645 Ga0068858_1015336452 128
100 3300005843 Ga0068860_100177803 Ga0068860_1001778032 128
101 3300005937 Ga0081455_10000529 Ga0081455_1000052928 128
102 3300006038 Ga0075365_10368868 Ga0075365_103688682 128
103 3300006038 Ga0075365_10955186 Ga0075365_109551861 128
104 3300006042 Ga0075368_10186748 Ga0075368_101867482 128
105 3300006048 Ga0075363_100288999 Ga0075363_1002889992 128
106 3300006051 Ga0075364_10054702 Ga0075364_100547022 128
107 3300006177 Ga0075362_10309204 Ga0075362_103092042 128
108 3300006178 Ga0075367_10024820 Ga0075367_100248204 128
109 3300006178 Ga0075367_10686544 Ga0075367_106865441 128
110 3300006195 Ga0075366_10161603 Ga0075366_101616032 128
111 3300006237 Ga0097621_101351016 Ga0097621_1013510162 128
112 3300006237 Ga0097621_101527055 Ga0097621_1015270552 128
113 3300006353 Ga0075370_10004816 Ga0075370_100048169 128
114 3300006353 Ga0075370_10048797 Ga0075370_100487972 128
115 3300006353 Ga0075370_10050853 Ga0075370_100508534 128
116 3300006358 Ga0068871_100064781 Ga0068871_1000647813 128
117 3300006358 Ga0068871_100728579 Ga0068871_1007285792 128
118 3300006871 Ga0075434_100311127 Ga0075434_1003111272 128
119 3300006871 Ga0075434_100504952 Ga0075434_1005049522 128
120 3300006914 Ga0075436_100390698 Ga0075436_1003906982 128
121 3300007076 Ga0075435_100242382 Ga0075435_1002423822 128
122 3300007076 Ga0075435_100378493 Ga0075435_1003784932 128
123 3300007788 Ga0099795_10395329 Ga0099795_103953292 128
124 3300007788 Ga0099795_10409304 Ga0099795_104093041 128
125 3300009036 Ga0105244_10001741 Ga0105244_1000174114 128
126 3300009092 Ga0105250_10164128 Ga0105250_101641282 128
127 3300009093 Ga0105240_10002500 Ga0105240_1000250026 128
128 3300009093 Ga0105240_10013969 Ga0105240_100139695 128
129 3300009093 Ga0105240_10158852 Ga0105240_101588523 128
130 3300009093 Ga0105240_10163703 Ga0105240_101637032 128
131 3300009093 Ga0105240_10394371 Ga0105240_103943712 128
132 3300009098 Ga0105245_11216601 Ga0105245_112166012 128
133 3300009147 Ga0114129_11415327 Ga0114129_114153271 128
134 3300009148 Ga0105243_10006549 Ga0105243_1000654910 128
135 3300009148 Ga0105243_10050457 Ga0105243_100504573 128
136 3300009148 Ga0105243_10320348 Ga0105243_103203482 128
137 3300009174 Ga0105241_10396362 Ga0105241_103963622 128
138 3300009176 Ga0105242_10324007 Ga0105242_103240072 128
139 3300009177 Ga0105248_10029905 Ga0105248_100299056 128
140 3300009545 Ga0105237_10015430 Ga0105237_100154306 128
141 3300009545 Ga0105237_10196836 Ga0105237_101968362 128
142 3300009551 Ga0105238_10046432 Ga0105238_100464326 128
143 3300009551 Ga0105238_10053582 Ga0105238_100535822 128
144 3300009551 Ga0105238_10059178 Ga0105238_100591783 128
145 3300009551 Ga0105238_10181069 Ga0105238_101810693 128
146 3300009551 Ga0105238_10190543 Ga0105238_101905432 128
147 3300009551 Ga0105238_11034431 Ga0105238_110344312 128
148 3300009551 Ga0105238_11203509 Ga0105238_112035091 128
149 3300010375 Ga0105239_10264706 Ga0105239_102647062 128
150 3300010375 Ga0105239_10484359 Ga0105239_104843593 128
151 3300011119 Ga0105246_10086083 Ga0105246_100860832 128
152 3300013100 Ga0157373_10006142 Ga0157373_100061427 128
153 3300013100 Ga0157373_10027357 Ga0157373_100273575 128
154 3300013100 Ga0157373_10035735 Ga0157373_100357352 128
155 3300013102 Ga0157371_10013731 Ga0157371_100137316 128
156 3300013102 Ga0157371_10228626 Ga0157371_102286262 128
157 3300013102 Ga0157371_10268154 Ga0157371_102681541 128
158 3300013104 Ga0157370_10219255 Ga0157370_102192552 128
159 3300013104 Ga0157370_10624902 Ga0157370_106249021 128
160 3300013104 Ga0157370_10719497 Ga0157370_107194972 128
161 3300013105 Ga0157369_10000843 Ga0157369_1000084321 128
162 3300013105 Ga0157369_10060646 Ga0157369_100606462 128
163 3300013296 Ga0157374_10031324 Ga0157374_100313242 128
164 3300013296 Ga0157374_10240703 Ga0157374_102407032 128
165 3300013297 Ga0157378_10020288 Ga0157378_100202884 128
166 3300013297 Ga0157378_10688837 Ga0157378_106888372 128
167 3300013297 Ga0157378_11287358 Ga0157378_112873582 128
168 3300013307 Ga0157372_10014374 Ga0157372_100143742 128
169 3300013307 Ga0157372_10030694 Ga0157372_100306947 128
170 3300013307 Ga0157372_10041765 Ga0157372_100417656 128
171 3300013307 Ga0157372_12643798 Ga0157372_126437982 128
172 3300013308 Ga0157375_10762661 Ga0157375_107626611 128
173 3300014497 Ga0182008_10001695 Ga0182008_100016959 128
174 3300014497 Ga0182008_10018301 Ga0182008_100183013 128
175 3300014497 Ga0182008_10169992 Ga0182008_101699921 128
176 3300014969 Ga0157376_10293249 Ga0157376_102932492 128
177 3300014969 Ga0157376_10790852 Ga0157376_107908522 128
178 3300015261 Ga0182006_1001421 Ga0182006_10014214 128
179 3300015261 Ga0182006_1054110 Ga0182006_10541102 128
180 3300015262 Ga0182007_10000269 Ga0182007_100002692 128
181 3300015262 Ga0182007_10060516 Ga0182007_100605162 128
182 3300015265 Ga0182005_1055896 Ga0182005_10558962 128
183 3300017792 Ga0163161_10079679 Ga0163161_100796792 128
184 3300017792 Ga0163161_10338879 Ga0163161_103388792 128
185 3300017792 Ga0163161_10986849 Ga0163161_109868492 128
186 3300025230 Ga0209563_100005 Ga0209563_100005175 128
187 3300025303 Ga0209051_1000979 Ga0209051_100097930 128
188 3300025321 Ga0207656_10022314 Ga0207656_100223142 128
189 3300025321 Ga0207656_10023216 Ga0207656_100232162 128
190 3300025321 Ga0207656_10035942 Ga0207656_100359423 128
191 3300025885 Ga0207653_10205235 Ga0207653_102052351 128
192 3300025903 Ga0207680_11004681 Ga0207680_110046812 128
193 3300025907 Ga0207645_10208452 Ga0207645_102084523 128
194 3300025908 Ga0207643_10335998 Ga0207643_103359982 128
195 3300025909 Ga0207705_10082515 Ga0207705_100825151 128
196 3300025910 Ga0207684_10054550 Ga0207684_100545503 128
197 3300025910 Ga0207684_10576008 Ga0207684_105760082 128
198 3300025910 Ga0207684_10883649 Ga0207684_108836492 128
199 3300025911 Ga0207654_10223827 Ga0207654_102238272 128
200 3300025912 Ga0207707_10122830 Ga0207707_101228302 128
201 3300025913 Ga0207695_10040490 Ga0207695_100404904 128
202 3300025913 Ga0207695_10062860 Ga0207695_100628603 128
203 3300025913 Ga0207695_10171178 Ga0207695_101711781 128
204 3300025913 Ga0207695_10304354 Ga0207695_103043542 128
205 3300025914 Ga0207671_10008619 Ga0207671_100086196 128
206 3300025914 Ga0207671_10039086 Ga0207671_100390862 128
207 3300025914 Ga0207671_10039920 Ga0207671_100399202 128
208 3300025917 Ga0207660_10148383 Ga0207660_101483832 128
209 3300025919 Ga0207657_10016574 Ga0207657_100165742 128
210 3300025919 Ga0207657_10093005 Ga0207657_100930054 128
211 3300025919 Ga0207657_10353789 Ga0207657_103537892 128
212 3300025919 Ga0207657_10455933 Ga0207657_104559332 128
213 3300025920 Ga0207649_10043086 Ga0207649_100430863 128
214 3300025921 Ga0207652_10128265 Ga0207652_101282652 128
215 3300025921 Ga0207652_10447531 Ga0207652_104475312 128
216 3300025922 Ga0207646_10001985 Ga0207646_1000198521 128
217 3300025922 Ga0207646_10640695 Ga0207646_106406952 128
218 3300025922 Ga0207646_10648246 Ga0207646_106482461 128
219 3300025923 Ga0207681_11168299 Ga0207681_111682992 128
220 3300025924 Ga0207694_10011581 Ga0207694_100115818 128
221 3300025924 Ga0207694_10031848 Ga0207694_100318482 128
222 3300025924 Ga0207694_10106212 Ga0207694_101062123 128
223 3300025924 Ga0207694_10243677 Ga0207694_102436772 128
224 3300025924 Ga0207694_10507830 Ga0207694_105078302 128
225 3300025924 Ga0207694_10828918 Ga0207694_108289182 128
226 3300025926 Ga0207659_10570225 Ga0207659_105702252 128
227 3300025927 Ga0207687_10009492 Ga0207687_100094927 128
228 3300025927 Ga0207687_10586269 Ga0207687_105862692 128
229 3300025928 Ga0207700_10000023 Ga0207700_1000002358 128
230 3300025929 Ga0207664_10252464 Ga0207664_102524641 128
231 3300025931 Ga0207644_10005689 Ga0207644_100056898 128
232 3300025932 Ga0207690_10041570 Ga0207690_100415704 128
233 3300025932 Ga0207690_10209176 Ga0207690_102091762 128
234 3300025933 Ga0207706_10038066 Ga0207706_100380662 128
235 3300025933 Ga0207706_10130152 Ga0207706_101301523 128
236 3300025934 Ga0207686_10345486 Ga0207686_103454862 128
237 3300025935 Ga0207709_10858962 Ga0207709_108589621 128
238 3300025935 Ga0207709_11245038 Ga0207709_112450381 128
239 3300025936 Ga0207670_10446444 Ga0207670_104464441 128
240 3300025938 Ga0207704_10312584 Ga0207704_103125842 128
241 3300025939 Ga0207665_10877827 Ga0207665_108778272 128
242 3300025940 Ga0207691_10222421 Ga0207691_102224212 128
243 3300025941 Ga0207711_10013786 Ga0207711_100137863 128
244 3300025942 Ga0207689_10000485 Ga0207689_100004858 128
245 3300025942 Ga0207689_10497350 Ga0207689_104973502 128
246 3300025944 Ga0207661_10152085 Ga0207661_101520852 128
247 3300025945 Ga0207679_10399865 Ga0207679_103998652 128
248 3300025949 Ga0207667_10070033 Ga0207667_100700332 128
249 3300025981 Ga0207640_10404827 Ga0207640_104048272 128
250 3300025981 Ga0207640_10579721 Ga0207640_105797212 128
251 3300025986 Ga0207658_10406238 Ga0207658_104062382 128
252 3300025986 Ga0207658_10628519 Ga0207658_106285192 128
253 3300026023 Ga0207677_10385619 Ga0207677_103856191 128
254 3300026023 Ga0207677_10397262 Ga0207677_103972622 128
255 3300026023 Ga0207677_10942626 Ga0207677_109426261 128
256 3300026035 Ga0207703_10063010 Ga0207703_100630102 128
257 3300026035 Ga0207703_10122628 Ga0207703_101226282 128
258 3300026041 Ga0207639_10005201 Ga0207639_100052017 128
259 3300026041 Ga0207639_10056507 Ga0207639_100565073 128
260 3300026041 Ga0207639_10555439 Ga0207639_105554392 128
261 3300026041 Ga0207639_10674729 Ga0207639_106747292 128
262 3300026067 Ga0207678_10019010 Ga0207678_100190107 128
263 3300026067 Ga0207678_10336875 Ga0207678_103368752 128
264 3300026078 Ga0207702_10078095 Ga0207702_100780952 128
265 3300026078 Ga0207702_11003410 Ga0207702_110034102 128
266 3300026078 Ga0207702_11918650 Ga0207702_119186502 128
267 3300026088 Ga0207641_10019011 Ga0207641_100190112 128
268 3300026088 Ga0207641_10121814 Ga0207641_101218142 128
269 3300026088 Ga0207641_10176970 Ga0207641_101769702 128
270 3300026088 Ga0207641_12055682 Ga0207641_120556821 128
271 3300026089 Ga0207648_10049361 Ga0207648_100493612 128
272 3300026095 Ga0207676_10197367 Ga0207676_101973672 128
273 3300026116 Ga0207674_10053011 Ga0207674_100530112 128
274 3300026116 Ga0207674_10314725 Ga0207674_103147252 128
275 3300026118 Ga0207675_100000216 Ga0207675_1000002169 128
276 3300026121 Ga0207683_10777511 Ga0207683_107775112 128
277 3300026142 Ga0207698_10100776 Ga0207698_101007762 128
278 3300026142 Ga0207698_10576920 Ga0207698_105769201 128
279 3300026142 Ga0207698_10982606 Ga0207698_109826062 128
280 3300027866 Ga0209813_10188488 Ga0209813_101884882 128
281 3300028381 Ga0268264_10120988 Ga0268264_101209882 128
282 3300028381 Ga0268264_11190180 Ga0268264_111901802 128
283 3300028786 Ga0307517_10226113 Ga0307517_102261132 128
284 3300028794 Ga0307515_10000588 Ga0307515_1000058860 128
285 3300028794 Ga0307515_10350882 Ga0307515_103508822 128
286 3300030742 Ga0316183_1205824 Ga0316183_12058242 128
287 3300030744 Ga0316181_1077792 Ga0316181_10777921 128
288 3300030744 Ga0316181_1222123 Ga0316181_12221233 128
289 3300030745 Ga0316182_1158317 Ga0316182_11583172 128
290 3300031235 Ga0265330_10063991 Ga0265330_100639912 128
291 3300031238 Ga0265332_10000401 Ga0265332_1000040114 128
292 3300031250 Ga0265331_10000262 Ga0265331_1000026215 128
293 3300031251 Ga0265327_10009701 Ga0265327_100097017 128
294 3300031456 Ga0307513_10228514 Ga0307513_102285142 128
295 3300031456 Ga0307513_10271620 Ga0307513_102716201 128
296 3300031507 Ga0307509_10401709 Ga0307509_104017092 128
297 3300031548 Ga0307408_100166395 Ga0307408_1001663952 128
298 3300031616 Ga0307508_10000030 Ga0307508_1000003038 128
299 3300031649 Ga0307514_10002589 Ga0307514_1000258916 128
300 3300031649 Ga0307514_10022816 Ga0307514_100228161 128
301 3300031711 Ga0265314_10063499 Ga0265314_100634992 128
302 3300031712 Ga0265342_10034460 Ga0265342_100344603 128
303 3300031712 Ga0265342_10143406 Ga0265342_101434062 128
304 3300031730 Ga0307516_10002018 Ga0307516_1000201820 128
305 3300031730 Ga0307516_10074468 Ga0307516_100744682 128
306 3300031731 Ga0307405_10073519 Ga0307405_100735192 128
307 3300031901 Ga0307406_10585168 Ga0307406_105851682 128
308 3300031911 Ga0307412_10139289 Ga0307412_101392892 128
309 3300031911 Ga0307412_10179871 Ga0307412_101798712 128
310 3300031911 Ga0307412_10268140 Ga0307412_102681402 128
311 3300032004 Ga0307414_11304740 Ga0307414_113047401 128
312 3300033179 Ga0307507_10155844 Ga0307507_101558442 128
313 3300034818 Ga0373950_0074729 Ga0373950_0074729_117_539 128
314 3300034819 Ga0373958_0043707 Ga0373958_0043707_206_628 128
315 3300035084 Ga0373928_0014799 Ga0373928_0014799_720_1142 128
316 3300035112 Ga0373932_0137755 Ga0373932_0137755_207_629 128
317 3300035170 Ga0373943_0305856 Ga0373943_0305856_314_736 128
318 3300035170 Ga0373943_0945225 Ga0373943_0945225_13_438 128
319 3300035692 Ga0373935_0257976 Ga0373935_0257976_416_838 128
320 3300035695 Ga0373927_0765745 Ga0373927_0765745_150_572 128
321 3300035725 Ga0373947_0574243 Ga0373947_0574243_149_571 128
322 3300035725 Ga0373947_0669185 Ga0373947_0669185_186_608 128
323 3300036401 Ga0373937_0738037 Ga0373937_0738037_33_455 128
324 3300037068 Ga0373925_0633744 Ga0373925_0633744_104_526 128
325 3300037312 Ga0395899_0008027 Ga0395899_0008027_6303_6725 128
326 3300037418 Ga0395900_0112102 Ga0395900_0112102_316_738 128
327 3300037418 Ga0395900_0122997 Ga0395900_0122997_42_464 128
328 3300037418 Ga0395900_0163570 Ga0395900_0163570_994_1416 128
329 3300037466 Ga0395898_0023928 Ga0395898_0023928_1803_2225 128
330 3300037466 Ga0395898_0064104 Ga0395898_0064104_2005_2427 128
331 3300037466 Ga0395898_1144034 Ga0395898_1144034_100_579 128
332 3300037471 Ga0395905_0129996 Ga0395905_0129996_1255_1677 128
333 3300037471 Ga0395905_0712504 Ga0395905_0712504_158_607 128
334 3300037471 Ga0395905_0750804 Ga0395905_0750804_232_654 128
335 3300038443 Ga0395901_0293102 Ga0395901_0293102_412_834 128
336 3300039437 Ga0436365_0120135 Ga0436365_0120135_78_500 128
337 3300039447 Ga0436361_0091030 Ga0436361_0091030_1019_1486 128
338 3300041441 Ga0451787_732463 Ga0451787_732463_227_652 128
339 3300041443 Ga0451789_0208144 Ga0451789_0208144_979_1404 128
340 3300041453 Ga0451797_1207466 Ga0451797_1207466_398_823 128
341 3300041459 Ga0451800_1261555 Ga0451800_1261555_160_585 128
342 3300041460 Ga0451802_1175484 Ga0451802_1175484_285_710 128
343 3300041486 Ga0451807_0433055 Ga0451807_0433055_28_453 128
344 3300041486 Ga0451807_1653191 Ga0451807_1653191_305_730 128
345 3300041491 Ga0451833_0702241 Ga0451833_0702241_578_1003 128
346 3300041492 Ga0451835_0121393 Ga0451835_0121393_409_834 128
347 3300041496 Ga0451839_1208443 Ga0451839_1208443_467_892 128
348 3300041498 Ga0451841_0118537 Ga0451841_0118537_69_491 128
349 3300041501 Ga0451845_0541005 Ga0451845_0541005_230_655 128
350 3300041507 Ga0451851_1291770 Ga0451851_1291770_182_607 128
351 3300041509 Ga0451843_0852173 Ga0451843_0852173_1902_2327 128
352 3300041511 Ga0451855_2054749 Ga0451855_2054749_186_611 128
353 3300041512 Ga0451853_3754481 Ga0451853_3754481_37_462 128
354 3300042007 Ga0439449_0037794 Ga0439449_0037794_85_507 128
355 3300042012 Ga0439455_0011263 Ga0439455_0011263_612_1097 128
356 3300042439 Ga0439464_0090092 Ga0439464_0090092_47_469 128
357 3300042876 Ga0451577_0240257 Ga0451577_0240257_277_708 128
358 3300042876 Ga0451577_0263266 Ga0451577_0263266_312_737 128
359 3300042876 Ga0451577_1692403 Ga0451577_1692403_155_541 128
360 3300044656 Ga0466969_0194863 Ga0466969_0194863_147_569 128
361 3300044656 Ga0466969_0336965 Ga0466969_0336965_97_519 128
362 3300044673 Ga0453683_0021324 Ga0453683_0021324_3060_3482 128
363 3300044673 Ga0453683_0260770 Ga0453683_0260770_13_444 128
364 3300044683 Ga0466965_0135852 Ga0466965_0135852_635_1066 128
365 3300044693 Ga0466961_0189447 Ga0466961_0189447_47_469 128
366 3300044712 Ga0453684_0465695 Ga0453684_0465695_154_579 128
367 3300044719 Ga0466971_0094165 Ga0466971_0094165_596_1018 128
368 3300044765 Ga0466970_0367875 Ga0466970_0367875_237_668 128
369 3300044842 Ga0466957_0264821 Ga0466957_0264821_531_953 128
370 3300044901 Ga0466960_0021035 Ga0466960_0021035_1049_1480 128
371 3300044901 Ga0466960_0159829 Ga0466960_0159829_151_573 128
372 3300045049 Ga0466959_0466161 Ga0466959_0466161_19_441 128
373 3300045051 Ga0451576_0215421 Ga0451576_0215421_792_1214 128
374 3300045051 Ga0451576_0647610 Ga0451576_0647610_396_818 128
375 3300045976 Ga0466967_0892961 Ga0466967_0892961_402_824 128
376 3300046454 Ga0495592_0000328 Ga0495592_0000328_18006_18497 128
377 3300046472 Ga0495580_0024117 Ga0495580_0024117_3933_4355 128
378 3300046472 Ga0495580_0064769 Ga0495580_0064769_2073_2495 128
379 3300046473 Ga0495582_0147315 Ga0495582_0147315_370_792 128
380 3300046475 Ga0495639_0002544 Ga0495639_0002544_3633_4019 128
381 3300046475 Ga0495639_0323352 Ga0495639_0323352_70_492 128
382 3300046512 Ga0495610_0016380 Ga0495610_0016380_93_518 128
383 3300046519 Ga0495632_0179430 Ga0495632_0179430_478_903 128
384 3300046519 Ga0495632_0198534 Ga0495632_0198534_290_715 128
385 3300046522 Ga0495643_0085589 Ga0495643_0085589_632_1057 128
386 3300046522 Ga0495643_0156440 Ga0495643_0156440_653_1075 128
387 3300046522 Ga0495643_0187262 Ga0495643_0187262_404_829 128
388 3300046535 Ga0495586_0068923 Ga0495586_0068923_1433_1858 128
389 3300046535 Ga0495586_0125125 Ga0495586_0125125_137_562 128
390 3300046543 Ga0495645_0006456 Ga0495645_0006456_2738_3163 128
391 3300046660 Ga0495625_0003304 Ga0495625_0003304_1059_1484 128
392 3300046674 Ga0495588_0077058 Ga0495588_0077058_386_772 128
393 3300046683 Ga0495658_0023210 Ga0495658_0023210_2690_3112 128
394 3300046692 Ga0495671_0580736 Ga0495671_0580736_100_522 128
395 3300047317 Ga0495604_0254759 Ga0495604_0254759_334_756 128
396 3300047321 Ga0495676_0153249 Ga0495676_0153249_593_1015 128
397 3300047321 Ga0495676_0336519 Ga0495676_0336519_530_916 128
398 3300047443 Ga0495687_216436 Ga0495687_216436_19_441 128
399 3300047472 Ga0495686_0144795 Ga0495686_0144795_425_850 128
400 3300047673 Ga0495593_0210271 Ga0495593_0210271_412_798 128
401 3300047673 Ga0495593_0481720 Ga0495593_0481720_163_585 128
402 3300048903 Ga0496100_0109914 Ga0496100_0109914_260_646 128
403 3300048903 Ga0496100_0114481 Ga0496100_0114481_1321_1743 128
404 3300048903 Ga0496100_0368195 Ga0496100_0368195_549_971 128
405 3300048904 Ga0496101_0005715 Ga0496101_0005715_4006_4392 128
406 3300048904 Ga0496101_0053030 Ga0496101_0053030_2369_2791 128
407 3300048905 Ga0496102_0005508 Ga0496102_0005508_9373_9759 128
408 3300048905 Ga0496102_0035422 Ga0496102_0035422_1014_1439 128
409 3300048905 Ga0496102_0243665 Ga0496102_0243665_715_1137 128
410 3300048905 Ga0496102_0639269 Ga0496102_0639269_359_781 128
411 3300048906 Ga0496103_0265559 Ga0496103_0265559_584_970 128
412 3300048906 Ga0496103_0600020 Ga0496103_0600020_226_648 128
413 3300048907 Ga0496104_0332872 Ga0496104_0332872_380_802 128
414 3300048907 Ga0496104_0396805 Ga0496104_0396805_705_1130 128
415 3300048907 Ga0496104_0498979 Ga0496104_0498979_126_548 128
416 3300048907 Ga0496104_0559621 Ga0496104_0559621_299_721 128
417 3300048908 Ga0496105_0005462 Ga0496105_0005462_8206_8592 128
418 3300048908 Ga0496105_0220561 Ga0496105_0220561_926_1351 128
419 3300048909 Ga0496106_0053197 Ga0496106_0053197_2231_2617 128
420 3300048910 Ga0496107_0038399 Ga0496107_0038399_2483_2905 128
421 3300048911 Ga0496108_0068417 Ga0496108_0068417_1940_2362 128
422 3300048911 Ga0496108_0267992 Ga0496108_0267992_982_1404 128
423 3300048911 Ga0496108_0331442 Ga0496108_0331442_295_681 128
424 3300048912 Ga0496109_0446621 Ga0496109_0446621_632_1054 128
425 3300048913 Ga0496110_0026020 Ga0496110_0026020_3922_4308 128
426 3300048913 Ga0496110_0044555 Ga0496110_0044555_848_1270 128
427 3300048914 Ga0496111_0114695 Ga0496111_0114695_1056_1478 128
428 3300048914 Ga0496111_0131026 Ga0496111_0131026_369_755 128
429 3300048914 Ga0496111_0200368 Ga0496111_0200368_996_1418 128
430 3300048914 Ga0496111_0705975 Ga0496111_0705975_204_626 128
431 3300048915 Ga0496112_0043599 Ga0496112_0043599_2557_2979 128
432 3300048915 Ga0496112_0904911 Ga0496112_0904911_318_740 128
433 3300048916 Ga0496113_0099411 Ga0496113_0099411_1390_1812 128
434 3300048916 Ga0496113_0132626 Ga0496113_0132626_1151_1537 128
435 3300048917 Ga0496114_0123916 Ga0496114_0123916_1140_1526 128
436 3300048918 Ga0496115_0114743 Ga0496115_0114743_22_444 128
437 3300048920 Ga0496117_0090613 Ga0496117_0090613_719_1204 128
438 3300048921 Ga0496118_0019314 Ga0496118_0019314_4718_5203 128
439 3300048925 Ga0496122_0000688 Ga0496122_0000688_15508_15930 128
440 3300048925 Ga0496122_0064646 Ga0496122_0064646_691_1113 128
441 3300048925 Ga0496122_0173095 Ga0496122_0173095_707_1192 128
442 3300048926 Ga0496123_0000314 Ga0496123_0000314_79957_80379 128
443 3300048926 Ga0496123_0077880 Ga0496123_0077880_158_646 128
444 3300048926 Ga0496123_0214684 Ga0496123_0214684_15_521 128
445 3300048927 Ga0496124_0039875 Ga0496124_0039875_2689_3111 128
446 3300048927 Ga0496124_0119653 Ga0496124_0119653_1117_1602 128
447 3300048928 Ga0496125_0081972 Ga0496125_0081972_1121_1606 128
448 3300048928 Ga0496125_0206662 Ga0496125_0206662_11_433 128
449 3300048928 Ga0496125_0750761 Ga0496125_0750761_81_467 128
450 3300049653 Ga0501206_016097 Ga0501206_016097_96_650 128
451 3300049705 Ga0501225_0010347 Ga0501225_0010347_1744_2166 128
452 3300050489 nmdc:mga03683_1992_c1 nmdc:mga03683_1992_c1_731_1117 128
453 3300050490 nmdc:mga03n38_204035_c1 nmdc:mga03n38_204035_c1_196_618 128
454 3300050491 nmdc:mga00v17_1014678_c1 nmdc:mga00v17_1014678_c1_119_505 128
455 3300050491 nmdc:mga00v17_363630_c1 nmdc:mga00v17_363630_c1_235_621 128
456 3300050492 nmdc:mga0yw44_375176_c1 nmdc:mga0yw44_375176_c1_400_786 128
457 3300050493 nmdc:mga0k408_101826_c1 nmdc:mga0k408_101826_c1_605_1027 128
458 3300050493 nmdc:mga0k408_333326_c1 nmdc:mga0k408_333326_c1_213_689 128
459 3300050493 nmdc:mga0k408_377245_c1 nmdc:mga0k408_377245_c1_226_711 128
460 3300050493 nmdc:mga0k408_940415_c1 nmdc:mga0k408_940415_c1_57_443 128
461 3300050494 nmdc:mga06z11_114389_c1 nmdc:mga06z11_114389_c1_977_1399 128
462 3300050494 nmdc:mga06z11_557972_c1 nmdc:mga06z11_557972_c1_17_439 128
463 3300050495 nmdc:mga04h51_150219_c1 nmdc:mga04h51_150219_c1_286_708 128
464 3300050496 nmdc:mga07m45_110796_c1 nmdc:mga07m45_110796_c1_284_670 128
465 3300050496 nmdc:mga07m45_135754_c1 nmdc:mga07m45_135754_c1_487_963 128
466 3300050496 nmdc:mga07m45_45882_c1 nmdc:mga07m45_45882_c1_1006_1428 128
467 3300050507 nmdc:mga05p37_2127583_c1 nmdc:mga05p37_2127583_c1_68_490 128
468 3300050512 nmdc:mga0n895_1532692_c1 nmdc:mga0n895_1532692_c1_155_541 128
469 3300050512 nmdc:mga0n895_214406_c1 nmdc:mga0n895_214406_c1_1052_1474 128
470 3300050512 nmdc:mga0n895_470091_c1 nmdc:mga0n895_470091_c1_307_729 128
471 3300050513 nmdc:mga0rr50_337035_c1 nmdc:mga0rr50_337035_c1_236_658 128
472 3300050513 nmdc:mga0rr50_595903_c1 nmdc:mga0rr50_595903_c1_375_797 128
473 3300050513 nmdc:mga0rr50_601009_c1 nmdc:mga0rr50_601009_c1_378_800 128
474 3300050514 nmdc:mga08x19_350734_c1 nmdc:mga08x19_350734_c1_464_886 128
475 3300050515 nmdc:mga0a205_675157_c1 nmdc:mga0a205_675157_c1_107_529 128
476 3300053077 Ga0495601_0099995 Ga0495601_0099995_1182_1604 128
477 3300053090 Ga0500646_0029362 Ga0500646_0029362_179_601 128
478 3300053122 Ga0500608_054840 Ga0500608_054840_1325_1747 128
479 3300053125 Ga0500618_043307 Ga0500618_043307_74_496 128
480 3300053134 Ga0500658_0044912 Ga0500658_0044912_1167_1592 128
481 3300053136 Ga0500559_0013547 Ga0500559_0013547_1096_1518 128
482 3300053138 Ga0500564_035821 Ga0500564_035821_1422_1913 128
483 3300053156 Ga0500622_0271440 Ga0500622_0271440_252_674 128
484 3300053723 Ga0500567_081028 Ga0500567_081028_163_585 128
485 3300053739 Ga0500587_007339 Ga0500587_007339_230_655 128
486 3300061719 Ga0466962_0335901 Ga0466962_0335901_23_445 128
487 iso_pu_bacteria 2585428062 2587754982 128
488 iso_pu_bacteria 2643221609 2644058529 128
489 iso_pu_bacteria 2643221611 2644070658 128
490 iso_pu_bacteria 2818991446 2819601752 128
491 iso_pu_bacteria 2842677519 2842680378 128
492 iso_pu_bacteria 2842733646 2842736823 128
493 iso_pu_bacteria 2842747753 2842747893 128
494 iso_pu_bacteria 2899924645 2899928694 128
495 iso_pu_bacteria 2899924645 2899930819 128
496 iso_pu_bacteria 2919462493 2919467414 128
497 iso_pu_bacteria 2928051484 2928055592 128
498 iso_pu_bacteria 2928051484 2928056297 128
499 iso_pu_bacteria 2928064002 2928069689 128
500 iso_pu_bacteria 2954767861 2954768160 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

35

168

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g2j-assembly1.cif.gz_J mouse mitochondrial complex i in the active state 0.498 58 119
7bgn-assembly2.cif.gz_C crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.374 50 126
7nyu-assembly1.cif.gz_K respiratory complex i from escherichia coli - conformation 2 0.3661 58 117
8qhp-assembly1.cif.gz_B cysteine trna ligase homodimer 0.3637 25 124
7qj1-assembly1.cif.gz_l structure of the recombinant human gamma-tubulin ring complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) 0.3571 37 113
ID Description Score Start End Superfamily
af_Q8LPK6_255_358_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7644 65 99 1.10.10.10
af_K7LL22_254_348_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.729 57 100 1.10.10.10
af_K7TUS1_445_604_2.60.40.740 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6852 50 97 2.60.40.740
af_D4A0G9_1_71_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5287 55 114 1.25.40.10
af_Q496H8_42_120_1.10.110.10 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins 0.518 57 125 1.10.110.10
ID Description Score Start End GO Terms
AF-A0A840SKV2-F1-model_v4 DUF1468 domain-containing protein 0.9007 2 124 GO:0016020
AF-A0A433SBB6-F1-model_v4 DUF1468 domain-containing protein 0.8904 2 128 GO:0016020
AF-A0A433SBB6-F1-model_v4 DUF1468 domain-containing protein 0.8777 2 128 GO:0016020
AF-A0A4R6DZF8-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8769 2 128 GO:0016020
AF-A0A1K2HWY7-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8681 2 128 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.19 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map