F455496
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 500 | 313 | 478 | 140 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100263941|Ga0068853_1002639412 |
| Length | 170 |
| Sequence | MVESAPQLTASESSILSSSNLPPIHSEFTMNDRNLLRGLFLLAISLAFGLTSLRYPIGQFSRAGPGLFPLMVSCLLLLIAVITILRSRFVEHLPLGFNIKNISIILASLCGFALISEFVNMIAGIVFMVFCASFAGTASYSVVRNLKIAAGLVAVALAFQKLLGFNLPLY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 8 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 9 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 10 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 11 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 12 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 13 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 14 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 15 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 16 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 17 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 18 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 19 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 20 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 21 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 179 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 180 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 215 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 222 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 223 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 224 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 225 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 226 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 227 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 228 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 237 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 285 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 286 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 287 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 288 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 289 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 305 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 306 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 311 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 312 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.2 |
| Metatranscriptomes | 0.4 |
| Isolates | 4.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.4 |
| Nodule | 0 |
| Rhizoplane | 9 |
| Rhizosphere | 70.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1133905 | 2162886007 | Bacteria | 1705 |
| 2 | SwRhRL2b_contig_805671 | 2162886007 | Bacteria | 1200 |
| 3 | JGI25152J39213_1003768 | 3300002773 | Bacteria | 5047 |
| 4 | JGI25151J46595_10024381 | 3300003187 | Bacteria | 2475 |
| 5 | rootH1_10009465 | 3300003316 | Bacteria | 1518 |
| 6 | rootH1_10042863 | 3300003323 | Bacteria | 1528 |
| 7 | Ga0006562J51391_1151502 | 3300003578 | Bacteria | 2510 |
| 8 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 9 | Ga0055535_1000075 | 3300003761 | Bacteria | 111667 |
| 10 | Ga0055542_1000059 | 3300003762 | Bacteria | 162670 |
| 11 | Ga0055530_10000110 | 3300003791 | Bacteria | 71015 |
| 12 | Ga0055540_1001401 | 3300003792 | Bacteria | 14381 |
| 13 | Ga0055540_1002424 | 3300003792 | Bacteria | 9858 |
| 14 | Ga0055531_10001413 | 3300003794 | Bacteria | 17732 |
| 15 | Ga0055543_1000644 | 3300004625 | Bacteria | 18672 |
| 16 | Ga0058862_11893894 | 3300004803 | Bacteria | 629 |
| 17 | Ga0065714_10003364 | 3300005288 | Bacteria | 12768 |
| 18 | Ga0065704_10008021 | 3300005289 | Bacteria | 2814 |
| 19 | Ga0070658_10018794 | 3300005327 | Bacteria | 5536 |
| 20 | Ga0070676_10547651 | 3300005328 | Bacteria | 828 |
| 21 | Ga0070683_100037905 | 3300005329 | Bacteria | 4415 |
| 22 | Ga0070683_100197063 | 3300005329 | Bacteria | 1913 |
| 23 | Ga0070680_100050642 | 3300005336 | Bacteria | 3388 |
| 24 | Ga0068868_100980961 | 3300005338 | Bacteria | 772 |
| 25 | Ga0068868_101055707 | 3300005338 | Bacteria | 746 |
| 26 | Ga0070660_100011925 | 3300005339 | Bacteria | 6200 |
| 27 | Ga0070660_100239910 | 3300005339 | Bacteria | 1476 |
| 28 | Ga0070661_100026217 | 3300005344 | Bacteria | 4190 |
| 29 | Ga0070669_100043497 | 3300005353 | Bacteria | 3271 |
| 30 | Ga0070675_101848967 | 3300005354 | Bacteria | 557 |
| 31 | Ga0070671_100006289 | 3300005355 | Bacteria | 9466 |
| 32 | Ga0070659_100012771 | 3300005366 | Bacteria | 6236 |
| 33 | Ga0070667_100850646 | 3300005367 | Bacteria | 848 |
| 34 | Ga0070714_100281266 | 3300005435 | Bacteria | 1546 |
| 35 | Ga0070713_100002534 | 3300005436 | Bacteria | 11950 |
| 36 | Ga0070694_100779511 | 3300005444 | Unclassified | 783 |
| 37 | Ga0070708_100189520 | 3300005445 | Bacteria | 1923 |
| 38 | Ga0070678_100648075 | 3300005456 | Bacteria | 947 |
| 39 | Ga0070678_101539945 | 3300005456 | Bacteria | 623 |
| 40 | Ga0070662_100095764 | 3300005457 | Bacteria | 2238 |
| 41 | Ga0070681_10210008 | 3300005458 | Bacteria | 1863 |
| 42 | Ga0070681_10269862 | 3300005458 | Bacteria | 1613 |
| 43 | Ga0068867_100169390 | 3300005459 | Bacteria | 1729 |
| 44 | Ga0070706_100002053 | 3300005467 | Bacteria | 20636 |
| 45 | Ga0070706_100106729 | 3300005467 | Bacteria | 2605 |
| 46 | Ga0070706_100167442 | 3300005467 | Bacteria | 2052 |
| 47 | Ga0070707_100073705 | 3300005468 | Bacteria | 3292 |
| 48 | Ga0070707_100086667 | 3300005468 | Bacteria | 3028 |
| 49 | Ga0070707_100209098 | 3300005468 | Bacteria | 1902 |
| 50 | Ga0070698_100144502 | 3300005471 | Bacteria | 2329 |
| 51 | Ga0070698_100568509 | 3300005471 | Bacteria | 1073 |
| 52 | Ga0070699_100070610 | 3300005518 | Bacteria | 3036 |
| 53 | Ga0070699_100346288 | 3300005518 | Bacteria | 1338 |
| 54 | Ga0070679_100154427 | 3300005530 | Bacteria | 2271 |
| 55 | Ga0070684_100040104 | 3300005535 | Bacteria | 4030 |
| 56 | Ga0070697_100038643 | 3300005536 | Bacteria | 3857 |
| 57 | Ga0070697_100183223 | 3300005536 | Bacteria | 1775 |
| 58 | Ga0070697_100879216 | 3300005536 | Bacteria | 794 |
| 59 | Ga0068853_100263941 | 3300005539 | Bacteria | 1584 |
| 60 | Ga0068853_100731835 | 3300005539 | Bacteria | 945 |
| 61 | Ga0070672_100405838 | 3300005543 | Bacteria | 1168 |
| 62 | Ga0070695_100209656 | 3300005545 | Bacteria | 1398 |
| 63 | Ga0070693_100058782 | 3300005547 | Bacteria | 2227 |
| 64 | Ga0070704_100042061 | 3300005549 | Bacteria | 3158 |
| 65 | Ga0068855_100020731 | 3300005563 | Bacteria | 7883 |
| 66 | Ga0068855_100075156 | 3300005563 | Bacteria | 3924 |
| 67 | Ga0070664_100197120 | 3300005564 | Bacteria | 1795 |
| 68 | Ga0070664_100306808 | 3300005564 | Bacteria | 1435 |
| 69 | Ga0068857_100039274 | 3300005577 | Bacteria | 4192 |
| 70 | Ga0068854_100023726 | 3300005578 | Bacteria | 4192 |
| 71 | Ga0068856_100045151 | 3300005614 | Bacteria | 4337 |
| 72 | Ga0068856_100146124 | 3300005614 | Bacteria | 2372 |
| 73 | Ga0068856_101587004 | 3300005614 | Bacteria | 668 |
| 74 | Ga0068852_100193466 | 3300005616 | Bacteria | 1921 |
| 75 | Ga0068852_100869859 | 3300005616 | Bacteria | 917 |
| 76 | Ga0068852_102149999 | 3300005616 | Bacteria | 580 |
| 77 | Ga0068851_10021016 | 3300005834 | Bacteria | 3166 |
| 78 | Ga0068851_10022285 | 3300005834 | Bacteria | 3083 |
| 79 | Ga0068863_100055539 | 3300005841 | Bacteria | 3750 |
| 80 | Ga0068863_100140314 | 3300005841 | Bacteria | 2309 |
| 81 | Ga0068863_100731174 | 3300005841 | Bacteria | 985 |
| 82 | Ga0068863_101631500 | 3300005841 | Bacteria | 654 |
| 83 | Ga0068858_100185412 | 3300005842 | Bacteria | 1965 |
| 84 | Ga0068858_101040500 | 3300005842 | Bacteria | 803 |
| 85 | Ga0068858_101533645 | 3300005842 | Unclassified | 657 |
| 86 | Ga0068860_100177803 | 3300005843 | Bacteria | 2057 |
| 87 | Ga0081455_10000529 | 3300005937 | Bacteria | 49513 |
| 88 | Ga0075365_10368868 | 3300006038 | Bacteria | 1012 |
| 89 | Ga0075365_10955186 | 3300006038 | Bacteria | 604 |
| 90 | Ga0075368_10186748 | 3300006042 | Bacteria | 875 |
| 91 | Ga0075363_100288999 | 3300006048 | Bacteria | 950 |
| 92 | Ga0075363_100421555 | 3300006048 | Bacteria | 786 |
| 93 | Ga0075364_10054702 | 3300006051 | Bacteria | 2610 |
| 94 | Ga0075362_10309204 | 3300006177 | Bacteria | 785 |
| 95 | Ga0075367_10024820 | 3300006178 | Bacteria | 3382 |
| 96 | Ga0075367_10686544 | 3300006178 | Unclassified | 651 |
| 97 | Ga0075366_10161603 | 3300006195 | Bacteria | 1357 |
| 98 | Ga0097621_101351016 | 3300006237 | Bacteria | 674 |
| 99 | Ga0097621_101527055 | 3300006237 | Bacteria | 634 |
| 100 | Ga0075370_10004816 | 3300006353 | Bacteria | 6609 |
| 101 | Ga0075370_10048797 | 3300006353 | Bacteria | 2399 |
| 102 | Ga0075370_10050853 | 3300006353 | Bacteria | 2351 |
| 103 | Ga0068871_100064781 | 3300006358 | Bacteria | 2992 |
| 104 | Ga0068871_100728579 | 3300006358 | Bacteria | 910 |
| 105 | Ga0075434_100311127 | 3300006871 | Bacteria | 1595 |
| 106 | Ga0075434_100504952 | 3300006871 | Bacteria | 1230 |
| 107 | Ga0075436_100390698 | 3300006914 | Bacteria | 1007 |
| 108 | Ga0075435_100242382 | 3300007076 | Bacteria | 1533 |
| 109 | Ga0075435_100378493 | 3300007076 | Bacteria | 1216 |
| 110 | Ga0099795_10395329 | 3300007788 | Bacteria | 627 |
| 111 | Ga0099795_10409304 | 3300007788 | Unclassified | 618 |
| 112 | Ga0105244_10001741 | 3300009036 | Bacteria | 17118 |
| 113 | Ga0105250_10164128 | 3300009092 | Bacteria | 928 |
| 114 | Ga0105240_10002500 | 3300009093 | Bacteria | 29543 |
| 115 | Ga0105240_10013969 | 3300009093 | Bacteria | 10992 |
| 116 | Ga0105240_10158852 | 3300009093 | Bacteria | 2687 |
| 117 | Ga0105240_10163703 | 3300009093 | Bacteria | 2640 |
| 118 | Ga0105240_10394371 | 3300009093 | Bacteria | 1560 |
| 119 | Ga0105245_11216601 | 3300009098 | Bacteria | 801 |
| 120 | Ga0114129_11415327 | 3300009147 | Bacteria | 857 |
| 121 | Ga0105243_10006549 | 3300009148 | Bacteria | 8996 |
| 122 | Ga0105243_10050457 | 3300009148 | Bacteria | 3287 |
| 123 | Ga0105243_10320348 | 3300009148 | Bacteria | 1412 |
| 124 | Ga0105241_10396362 | 3300009174 | Bacteria | 1210 |
| 125 | Ga0105242_10324007 | 3300009176 | Bacteria | 1414 |
| 126 | Ga0105248_10029905 | 3300009177 | Bacteria | 6078 |
| 127 | Ga0105237_10015430 | 3300009545 | Bacteria | 7951 |
| 128 | Ga0105237_10196836 | 3300009545 | Bacteria | 2015 |
| 129 | Ga0105238_10046432 | 3300009551 | Bacteria | 4384 |
| 130 | Ga0105238_10053582 | 3300009551 | Bacteria | 4053 |
| 131 | Ga0105238_10059178 | 3300009551 | Bacteria | 3839 |
| 132 | Ga0105238_10181069 | 3300009551 | Bacteria | 2084 |
| 133 | Ga0105238_10190543 | 3300009551 | Bacteria | 2027 |
| 134 | Ga0105238_11034431 | 3300009551 | Bacteria | 843 |
| 135 | Ga0105238_11203509 | 3300009551 | Bacteria | 782 |
| 136 | Ga0105239_10264706 | 3300010375 | Bacteria | 1933 |
| 137 | Ga0105239_10484359 | 3300010375 | Bacteria | 1405 |
| 138 | Ga0105246_10086083 | 3300011119 | Bacteria | 2252 |
| 139 | Ga0157373_10006142 | 3300013100 | Bacteria | 8982 |
| 140 | Ga0157373_10027357 | 3300013100 | Bacteria | 4114 |
| 141 | Ga0157373_10035735 | 3300013100 | Bacteria | 3565 |
| 142 | Ga0157371_10013731 | 3300013102 | Bacteria | 6141 |
| 143 | Ga0157371_10228626 | 3300013102 | Bacteria | 1337 |
| 144 | Ga0157371_10268154 | 3300013102 | Bacteria | 1232 |
| 145 | Ga0157370_10219255 | 3300013104 | Bacteria | 1762 |
| 146 | Ga0157370_10624902 | 3300013104 | Bacteria | 985 |
| 147 | Ga0157370_10719497 | 3300013104 | Bacteria | 911 |
| 148 | Ga0157369_10000843 | 3300013105 | Bacteria | 39252 |
| 149 | Ga0157369_10060646 | 3300013105 | Bacteria | 4079 |
| 150 | Ga0157374_10031324 | 3300013296 | Bacteria | 4833 |
| 151 | Ga0157374_10240703 | 3300013296 | Bacteria | 1779 |
| 152 | Ga0157378_10020288 | 3300013297 | Bacteria | 5845 |
| 153 | Ga0157378_10688837 | 3300013297 | Bacteria | 1040 |
| 154 | Ga0157378_11287358 | 3300013297 | Bacteria | 772 |
| 155 | Ga0157372_10014374 | 3300013307 | Bacteria | 8465 |
| 156 | Ga0157372_10030694 | 3300013307 | Bacteria | 5881 |
| 157 | Ga0157372_10041765 | 3300013307 | Bacteria | 5070 |
| 158 | Ga0157372_12643798 | 3300013307 | Bacteria | 576 |
| 159 | Ga0157375_10762661 | 3300013308 | Bacteria | 1118 |
| 160 | Ga0182008_10001695 | 3300014497 | Bacteria | 14479 |
| 161 | Ga0182008_10018301 | 3300014497 | Bacteria | 3627 |
| 162 | Ga0182008_10169992 | 3300014497 | Bacteria | 1100 |
| 163 | Ga0157376_10293249 | 3300014969 | Bacteria | 1537 |
| 164 | Ga0157376_10790852 | 3300014969 | Bacteria | 961 |
| 165 | Ga0182006_1001421 | 3300015261 | Bacteria | 14485 |
| 166 | Ga0182006_1054110 | 3300015261 | Bacteria | 1537 |
| 167 | Ga0182007_10000269 | 3300015262 | Bacteria | 34602 |
| 168 | Ga0182007_10060516 | 3300015262 | Bacteria | 1241 |
| 169 | Ga0182005_1055896 | 3300015265 | Bacteria | 1076 |
| 170 | Ga0163161_10079679 | 3300017792 | Bacteria | 2409 |
| 171 | Ga0163161_10338879 | 3300017792 | Bacteria | 1192 |
| 172 | Ga0163161_10986849 | 3300017792 | Bacteria | 718 |
| 173 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 174 | Ga0209051_1000979 | 3300025303 | Bacteria | 27790 |
| 175 | Ga0207656_10022314 | 3300025321 | Bacteria | 2538 |
| 176 | Ga0207656_10023216 | 3300025321 | Bacteria | 2495 |
| 177 | Ga0207656_10035942 | 3300025321 | Bacteria | 2077 |
| 178 | Ga0207653_10205235 | 3300025885 | Bacteria | 744 |
| 179 | Ga0207680_11004681 | 3300025903 | Bacteria | 597 |
| 180 | Ga0207645_10208452 | 3300025907 | Bacteria | 1287 |
| 181 | Ga0207643_10335998 | 3300025908 | Bacteria | 946 |
| 182 | Ga0207705_10082515 | 3300025909 | Bacteria | 2344 |
| 183 | Ga0207684_10054550 | 3300025910 | Bacteria | 3391 |
| 184 | Ga0207684_10576008 | 3300025910 | Bacteria | 962 |
| 185 | Ga0207684_10883649 | 3300025910 | Bacteria | 752 |
| 186 | Ga0207654_10223827 | 3300025911 | Bacteria | 1249 |
| 187 | Ga0207707_10122830 | 3300025912 | Bacteria | 2271 |
| 188 | Ga0207695_10040490 | 3300025913 | Bacteria | 4994 |
| 189 | Ga0207695_10062860 | 3300025913 | Bacteria | 3830 |
| 190 | Ga0207695_10171178 | 3300025913 | Bacteria | 2097 |
| 191 | Ga0207695_10304354 | 3300025913 | Bacteria | 1485 |
| 192 | Ga0207671_10008619 | 3300025914 | Bacteria | 8617 |
| 193 | Ga0207671_10039086 | 3300025914 | Bacteria | 3515 |
| 194 | Ga0207671_10039920 | 3300025914 | Bacteria | 3475 |
| 195 | Ga0207660_10148383 | 3300025917 | Bacteria | 1800 |
| 196 | Ga0207657_10016574 | 3300025919 | Bacteria | 7099 |
| 197 | Ga0207657_10093005 | 3300025919 | Bacteria | 2512 |
| 198 | Ga0207657_10353789 | 3300025919 | Bacteria | 1158 |
| 199 | Ga0207657_10455933 | 3300025919 | Bacteria | 1003 |
| 200 | Ga0207649_10043086 | 3300025920 | Bacteria | 2757 |
| 201 | Ga0207652_10128265 | 3300025921 | Bacteria | 2261 |
| 202 | Ga0207652_10447531 | 3300025921 | Bacteria | 1164 |
| 203 | Ga0207646_10001985 | 3300025922 | Bacteria | 24574 |
| 204 | Ga0207646_10640695 | 3300025922 | Bacteria | 952 |
| 205 | Ga0207646_10648246 | 3300025922 | Bacteria | 946 |
| 206 | Ga0207681_11168299 | 3300025923 | Bacteria | 646 |
| 207 | Ga0207694_10011581 | 3300025924 | Bacteria | 6654 |
| 208 | Ga0207694_10031848 | 3300025924 | Bacteria | 4031 |
| 209 | Ga0207694_10106212 | 3300025924 | Bacteria | 2230 |
| 210 | Ga0207694_10243677 | 3300025924 | Bacteria | 1469 |
| 211 | Ga0207694_10507830 | 3300025924 | Bacteria | 1010 |
| 212 | Ga0207694_10828918 | 3300025924 | Bacteria | 782 |
| 213 | Ga0207650_10354946 | 3300025925 | Bacteria | 1207 |
| 214 | Ga0207659_10570225 | 3300025926 | Bacteria | 963 |
| 215 | Ga0207687_10009492 | 3300025927 | Bacteria | 6363 |
| 216 | Ga0207687_10586269 | 3300025927 | Bacteria | 938 |
| 217 | Ga0207700_10000023 | 3300025928 | Bacteria | 152285 |
| 218 | Ga0207664_10252464 | 3300025929 | Bacteria | 1540 |
| 219 | Ga0207644_10005689 | 3300025931 | Bacteria | 8115 |
| 220 | Ga0207690_10041570 | 3300025932 | Bacteria | 3013 |
| 221 | Ga0207690_10209176 | 3300025932 | Bacteria | 1486 |
| 222 | Ga0207706_10038066 | 3300025933 | Bacteria | 4267 |
| 223 | Ga0207706_10130152 | 3300025933 | Bacteria | 2213 |
| 224 | Ga0207686_10345486 | 3300025934 | Bacteria | 1119 |
| 225 | Ga0207709_10858962 | 3300025935 | Bacteria | 735 |
| 226 | Ga0207709_11245038 | 3300025935 | Bacteria | 614 |
| 227 | Ga0207670_10446444 | 3300025936 | Unclassified | 1042 |
| 228 | Ga0207704_10312584 | 3300025938 | Bacteria | 1209 |
| 229 | Ga0207665_10027809 | 3300025939 | Bacteria | 3736 |
| 230 | Ga0207665_10877827 | 3300025939 | Bacteria | 711 |
| 231 | Ga0207691_10222421 | 3300025940 | Bacteria | 1637 |
| 232 | Ga0207711_10013786 | 3300025941 | Bacteria | 6711 |
| 233 | Ga0207689_10000485 | 3300025942 | Bacteria | 37567 |
| 234 | Ga0207689_10497350 | 3300025942 | Bacteria | 1021 |
| 235 | Ga0207661_10152085 | 3300025944 | Bacteria | 2001 |
| 236 | Ga0207679_10399865 | 3300025945 | Bacteria | 1208 |
| 237 | Ga0207667_10070033 | 3300025949 | Bacteria | 3651 |
| 238 | Ga0207640_10404827 | 3300025981 | Bacteria | 1112 |
| 239 | Ga0207640_10579721 | 3300025981 | Bacteria | 947 |
| 240 | Ga0207658_10406238 | 3300025986 | Bacteria | 1198 |
| 241 | Ga0207658_10628519 | 3300025986 | Bacteria | 966 |
| 242 | Ga0207677_10385619 | 3300026023 | Bacteria | 1184 |
| 243 | Ga0207677_10397262 | 3300026023 | Bacteria | 1168 |
| 244 | Ga0207677_10942626 | 3300026023 | Unclassified | 780 |
| 245 | Ga0207703_10063010 | 3300026035 | Bacteria | 3038 |
| 246 | Ga0207703_10122628 | 3300026035 | Bacteria | 2233 |
| 247 | Ga0207639_10005201 | 3300026041 | Bacteria | 8778 |
| 248 | Ga0207639_10056507 | 3300026041 | Bacteria | 3008 |
| 249 | Ga0207639_10555439 | 3300026041 | Bacteria | 1054 |
| 250 | Ga0207639_10674729 | 3300026041 | Bacteria | 957 |
| 251 | Ga0207678_10019010 | 3300026067 | Bacteria | 6036 |
| 252 | Ga0207678_10336875 | 3300026067 | Bacteria | 1299 |
| 253 | Ga0207702_10078095 | 3300026078 | Bacteria | 2865 |
| 254 | Ga0207702_11003410 | 3300026078 | Archaea | 828 |
| 255 | Ga0207702_11918650 | 3300026078 | Bacteria | 583 |
| 256 | Ga0207641_10019011 | 3300026088 | Bacteria | 5636 |
| 257 | Ga0207641_10121814 | 3300026088 | Bacteria | 2329 |
| 258 | Ga0207641_10176970 | 3300026088 | Bacteria | 1951 |
| 259 | Ga0207641_12055682 | 3300026088 | Bacteria | 572 |
| 260 | Ga0207648_10049361 | 3300026089 | Bacteria | 3682 |
| 261 | Ga0207676_10197367 | 3300026095 | Bacteria | 1775 |
| 262 | Ga0207674_10053011 | 3300026116 | Bacteria | 4135 |
| 263 | Ga0207674_10314725 | 3300026116 | Bacteria | 1514 |
| 264 | Ga0207675_100000216 | 3300026118 | Bacteria | 54012 |
| 265 | Ga0207683_10777511 | 3300026121 | Unclassified | 888 |
| 266 | Ga0207698_10100776 | 3300026142 | Bacteria | 2393 |
| 267 | Ga0207698_10576920 | 3300026142 | Bacteria | 1106 |
| 268 | Ga0207698_10982606 | 3300026142 | Bacteria | 854 |
| 269 | Ga0209813_10188488 | 3300027866 | Bacteria | 758 |
| 270 | Ga0268264_10120988 | 3300028381 | Bacteria | 2307 |
| 271 | Ga0268264_11190180 | 3300028381 | Bacteria | 771 |
| 272 | Ga0307517_10226113 | 3300028786 | Unclassified | 1130 |
| 273 | Ga0307515_10000588 | 3300028794 | Bacteria | 85228 |
| 274 | Ga0307515_10350882 | 3300028794 | Bacteria | 1122 |
| 275 | Ga0316183_1205824 | 3300030742 | Bacteria | 1798 |
| 276 | Ga0316181_1077792 | 3300030744 | Bacteria | 786 |
| 277 | Ga0316181_1222123 | 3300030744 | Bacteria | 2027 |
| 278 | Ga0316182_1158317 | 3300030745 | Bacteria | 3990 |
| 279 | Ga0265330_10063991 | 3300031235 | Bacteria | 1598 |
| 280 | Ga0265332_10000401 | 3300031238 | Bacteria | 31298 |
| 281 | Ga0265331_10000262 | 3300031250 | Bacteria | 60603 |
| 282 | Ga0265327_10009701 | 3300031251 | Bacteria | 6900 |
| 283 | Ga0307513_10228514 | 3300031456 | Bacteria | 1675 |
| 284 | Ga0307513_10271620 | 3300031456 | Bacteria | 1478 |
| 285 | Ga0307509_10401709 | 3300031507 | Bacteria | 1077 |
| 286 | Ga0307408_100166395 | 3300031548 | Bacteria | 1756 |
| 287 | Ga0307508_10000030 | 3300031616 | Bacteria | 165616 |
| 288 | Ga0307514_10002589 | 3300031649 | Bacteria | 18532 |
| 289 | Ga0307514_10022816 | 3300031649 | Bacteria | 5083 |
| 290 | Ga0265314_10063499 | 3300031711 | Bacteria | 2505 |
| 291 | Ga0265342_10034460 | 3300031712 | Bacteria | 3106 |
| 292 | Ga0265342_10143406 | 3300031712 | Bacteria | 1331 |
| 293 | Ga0307516_10002018 | 3300031730 | Bacteria | 27692 |
| 294 | Ga0307516_10074468 | 3300031730 | Bacteria | 3251 |
| 295 | Ga0307405_10073519 | 3300031731 | Bacteria | 2207 |
| 296 | Ga0307406_10585168 | 3300031901 | Bacteria | 918 |
| 297 | Ga0307412_10139289 | 3300031911 | Bacteria | 1774 |
| 298 | Ga0307412_10179871 | 3300031911 | Bacteria | 1589 |
| 299 | Ga0307412_10268140 | 3300031911 | Bacteria | 1335 |
| 300 | Ga0307414_11304740 | 3300032004 | Bacteria | 673 |
| 301 | Ga0307507_10155844 | 3300033179 | Bacteria | 1702 |
| 302 | Ga0373950_0074729 | 3300034818 | Bacteria | 699 |
| 303 | Ga0373958_0043707 | 3300034819 | Bacteria | 925 |
| 304 | Ga0373928_0014799 | 3300035084 | Bacteria | 1582 |
| 305 | Ga0373932_0137755 | 3300035112 | Bacteria | 828 |
| 306 | Ga0373943_0305856 | 3300035170 | Unclassified | 904 |
| 307 | Ga0373943_0945225 | 3300035170 | Bacteria | 516 |
| 308 | Ga0373935_0257976 | 3300035692 | Bacteria | 1222 |
| 309 | Ga0373927_0765745 | 3300035695 | Bacteria | 638 |
| 310 | Ga0373947_0574243 | 3300035725 | Bacteria | 768 |
| 311 | Ga0373947_0669185 | 3300035725 | Bacteria | 708 |
| 312 | Ga0373937_0738037 | 3300036401 | Bacteria | 932 |
| 313 | Ga0373925_0633744 | 3300037068 | Bacteria | 881 |
| 314 | Ga0395899_0008027 | 3300037312 | Bacteria | 8127 |
| 315 | Ga0395900_0112102 | 3300037418 | Bacteria | 2801 |
| 316 | Ga0395900_0122997 | 3300037418 | Bacteria | 2661 |
| 317 | Ga0395900_0163570 | 3300037418 | Bacteria | 2269 |
| 318 | Ga0395898_0023928 | 3300037466 | Bacteria | 6164 |
| 319 | Ga0395898_0064104 | 3300037466 | Bacteria | 3565 |
| 320 | Ga0395898_1144034 | 3300037466 | Bacteria | 711 |
| 321 | Ga0395905_0129996 | 3300037471 | Bacteria | 2368 |
| 322 | Ga0395905_0712504 | 3300037471 | Bacteria | 906 |
| 323 | Ga0395905_0750804 | 3300037471 | Bacteria | 878 |
| 324 | Ga0395901_0293102 | 3300038443 | Bacteria | 1688 |
| 325 | Ga0436365_0120135 | 3300039437 | Bacteria | 692 |
| 326 | Ga0436361_0091030 | 3300039447 | Bacteria | 2094 |
| 327 | Ga0451787_732463 | 3300041441 | Bacteria | 934 |
| 328 | Ga0451789_0208144 | 3300041443 | Bacteria | 1487 |
| 329 | Ga0451797_1207466 | 3300041453 | Bacteria | 1033 |
| 330 | Ga0451800_1261555 | 3300041459 | Bacteria | 1038 |
| 331 | Ga0451802_1175484 | 3300041460 | Bacteria | 958 |
| 332 | Ga0451807_0433055 | 3300041486 | Bacteria | 527 |
| 333 | Ga0451807_1653191 | 3300041486 | Bacteria | 948 |
| 334 | Ga0451833_0702241 | 3300041491 | Bacteria | 1080 |
| 335 | Ga0451835_0121393 | 3300041492 | Bacteria | 976 |
| 336 | Ga0451839_1208443 | 3300041496 | Bacteria | 914 |
| 337 | Ga0451841_0118537 | 3300041498 | Bacteria | 577 |
| 338 | Ga0451845_0541005 | 3300041501 | Bacteria | 1955 |
| 339 | Ga0451851_1291770 | 3300041507 | Bacteria | 777 |
| 340 | Ga0451843_0852173 | 3300041509 | Bacteria | 2370 |
| 341 | Ga0451855_2054749 | 3300041511 | Bacteria | 748 |
| 342 | Ga0451853_3754481 | 3300041512 | Bacteria | 1256 |
| 343 | Ga0439449_0037794 | 3300042007 | Bacteria | 1796 |
| 344 | Ga0439455_0011263 | 3300042012 | Bacteria | 1983 |
| 345 | Ga0439434_0320390 | 3300042435 | Bacteria | 538 |
| 346 | Ga0439464_0090092 | 3300042439 | Bacteria | 924 |
| 347 | Ga0451577_0240257 | 3300042876 | Bacteria | 1639 |
| 348 | Ga0451577_0263266 | 3300042876 | Bacteria | 1561 |
| 349 | Ga0451577_1692403 | 3300042876 | Bacteria | 557 |
| 350 | Ga0466969_0194863 | 3300044656 | Bacteria | 925 |
| 351 | Ga0466969_0336965 | 3300044656 | Bacteria | 683 |
| 352 | Ga0453683_0021324 | 3300044673 | Bacteria | 4137 |
| 353 | Ga0453683_0260770 | 3300044673 | Bacteria | 1106 |
| 354 | Ga0466965_0135852 | 3300044683 | Bacteria | 1277 |
| 355 | Ga0466961_0189447 | 3300044693 | Bacteria | 1275 |
| 356 | Ga0453684_0465695 | 3300044712 | Bacteria | 1404 |
| 357 | Ga0466971_0094165 | 3300044719 | Bacteria | 1373 |
| 358 | Ga0466970_0367875 | 3300044765 | Bacteria | 817 |
| 359 | Ga0466957_0264821 | 3300044842 | Bacteria | 1146 |
| 360 | Ga0466960_0021035 | 3300044901 | Bacteria | 2899 |
| 361 | Ga0466960_0159829 | 3300044901 | Bacteria | 1209 |
| 362 | Ga0466959_0466161 | 3300045049 | Bacteria | 856 |
| 363 | Ga0451576_0215421 | 3300045051 | Bacteria | 2005 |
| 364 | Ga0451576_0647610 | 3300045051 | Bacteria | 1110 |
| 365 | Ga0466967_0892961 | 3300045976 | Bacteria | 884 |
| 366 | Ga0495592_0000328 | 3300046454 | Bacteria | 39423 |
| 367 | Ga0495580_0024117 | 3300046472 | Bacteria | 4459 |
| 368 | Ga0495580_0064769 | 3300046472 | Bacteria | 2561 |
| 369 | Ga0495582_0147315 | 3300046473 | Bacteria | 1336 |
| 370 | Ga0495639_0002544 | 3300046475 | Bacteria | 7956 |
| 371 | Ga0495639_0323352 | 3300046475 | Bacteria | 772 |
| 372 | Ga0495664_0508658 | 3300046477 | Bacteria | 719 |
| 373 | Ga0495610_0016380 | 3300046512 | Bacteria | 4269 |
| 374 | Ga0495632_0179430 | 3300046519 | Bacteria | 970 |
| 375 | Ga0495632_0198534 | 3300046519 | Bacteria | 914 |
| 376 | Ga0495643_0085589 | 3300046522 | Bacteria | 1634 |
| 377 | Ga0495643_0156440 | 3300046522 | Bacteria | 1125 |
| 378 | Ga0495643_0187262 | 3300046522 | Bacteria | 1001 |
| 379 | Ga0495586_0068923 | 3300046535 | Bacteria | 1930 |
| 380 | Ga0495586_0125125 | 3300046535 | Bacteria | 1438 |
| 381 | Ga0495645_0006456 | 3300046543 | Bacteria | 8136 |
| 382 | Ga0495625_0003304 | 3300046660 | Bacteria | 16271 |
| 383 | Ga0495588_0077058 | 3300046674 | Bacteria | 1738 |
| 384 | Ga0495658_0023210 | 3300046683 | Bacteria | 3291 |
| 385 | Ga0495671_0580736 | 3300046692 | Bacteria | 533 |
| 386 | Ga0495604_0254759 | 3300047317 | Bacteria | 1195 |
| 387 | Ga0495676_0153249 | 3300047321 | Bacteria | 1638 |
| 388 | Ga0495676_0336519 | 3300047321 | Bacteria | 1011 |
| 389 | Ga0495687_216436 | 3300047443 | Bacteria | 596 |
| 390 | Ga0495686_0144795 | 3300047472 | Bacteria | 1400 |
| 391 | Ga0495593_0210271 | 3300047673 | Bacteria | 977 |
| 392 | Ga0495593_0481720 | 3300047673 | Bacteria | 622 |
| 393 | Ga0496100_0109914 | 3300048903 | Bacteria | 1913 |
| 394 | Ga0496100_0114481 | 3300048903 | Bacteria | 1879 |
| 395 | Ga0496100_0368195 | 3300048903 | Bacteria | 1089 |
| 396 | Ga0496101_0005715 | 3300048904 | Bacteria | 7942 |
| 397 | Ga0496101_0053030 | 3300048904 | Bacteria | 2925 |
| 398 | Ga0496102_0005508 | 3300048905 | Bacteria | 10749 |
| 399 | Ga0496102_0035422 | 3300048905 | Bacteria | 4493 |
| 400 | Ga0496102_0243665 | 3300048905 | Bacteria | 1695 |
| 401 | Ga0496102_0639269 | 3300048905 | Bacteria | 987 |
| 402 | Ga0496103_0265559 | 3300048906 | Bacteria | 1104 |
| 403 | Ga0496103_0600020 | 3300048906 | Bacteria | 701 |
| 404 | Ga0496104_0332872 | 3300048907 | Bacteria | 1431 |
| 405 | Ga0496104_0396805 | 3300048907 | Bacteria | 1292 |
| 406 | Ga0496104_0498979 | 3300048907 | Bacteria | 1128 |
| 407 | Ga0496104_0559621 | 3300048907 | Bacteria | 1054 |
| 408 | Ga0496105_0005462 | 3300048908 | Bacteria | 9647 |
| 409 | Ga0496105_0220561 | 3300048908 | Bacteria | 1544 |
| 410 | Ga0496106_0053197 | 3300048909 | Bacteria | 3057 |
| 411 | Ga0496107_0038399 | 3300048910 | Bacteria | 3435 |
| 412 | Ga0496108_0068417 | 3300048911 | Bacteria | 2996 |
| 413 | Ga0496108_0267992 | 3300048911 | Bacteria | 1486 |
| 414 | Ga0496108_0331442 | 3300048911 | Bacteria | 1327 |
| 415 | Ga0496109_0446621 | 3300048912 | Bacteria | 1221 |
| 416 | Ga0496110_0026020 | 3300048913 | Bacteria | 5003 |
| 417 | Ga0496110_0044555 | 3300048913 | Bacteria | 3874 |
| 418 | Ga0496111_0114695 | 3300048914 | Bacteria | 1986 |
| 419 | Ga0496111_0131026 | 3300048914 | Bacteria | 1855 |
| 420 | Ga0496111_0200368 | 3300048914 | Bacteria | 1484 |
| 421 | Ga0496111_0705975 | 3300048914 | Bacteria | 733 |
| 422 | Ga0496112_0043599 | 3300048915 | Bacteria | 4392 |
| 423 | Ga0496112_0904911 | 3300048915 | Bacteria | 804 |
| 424 | Ga0496113_0099411 | 3300048916 | Bacteria | 2253 |
| 425 | Ga0496113_0132626 | 3300048916 | Bacteria | 1956 |
| 426 | Ga0496114_0123916 | 3300048917 | Bacteria | 2225 |
| 427 | Ga0496115_0114743 | 3300048918 | Bacteria | 2214 |
| 428 | Ga0496117_0090613 | 3300048920 | Bacteria | 1969 |
| 429 | Ga0496118_0019314 | 3300048921 | Bacteria | 6095 |
| 430 | Ga0496122_0000688 | 3300048925 | Bacteria | 67392 |
| 431 | Ga0496122_0064646 | 3300048925 | Bacteria | 2660 |
| 432 | Ga0496122_0173095 | 3300048925 | Bacteria | 1298 |
| 433 | Ga0496123_0000314 | 3300048926 | Bacteria | 92927 |
| 434 | Ga0496123_0077880 | 3300048926 | Bacteria | 2034 |
| 435 | Ga0496123_0214684 | 3300048926 | Bacteria | 975 |
| 436 | Ga0496124_0039875 | 3300048927 | Bacteria | 4066 |
| 437 | Ga0496124_0119653 | 3300048927 | Bacteria | 2106 |
| 438 | Ga0496125_0081972 | 3300048928 | Bacteria | 2461 |
| 439 | Ga0496125_0206662 | 3300048928 | Bacteria | 1280 |
| 440 | Ga0496125_0750761 | 3300048928 | Bacteria | 511 |
| 441 | Ga0501206_016097 | 3300049653 | Bacteria | 1039 |
| 442 | Ga0501225_0010347 | 3300049705 | Bacteria | 2642 |
| 443 | nmdc:mga03683_1992_c1 | 3300050489 | Bacteria | 1612 |
| 444 | nmdc:mga03n38_204035_c1 | 3300050490 | Bacteria | 1024 |
| 445 | nmdc:mga03n38_439699_c1 | 3300050490 | Unclassified | 724 |
| 446 | nmdc:mga00v17_1014678_c1 | 3300050491 | Bacteria | 522 |
| 447 | nmdc:mga00v17_363630_c1 | 3300050491 | Bacteria | 941 |
| 448 | nmdc:mga0yw44_375176_c1 | 3300050492 | Bacteria | 960 |
| 449 | nmdc:mga0k408_101826_c1 | 3300050493 | Bacteria | 1694 |
| 450 | nmdc:mga0k408_333326_c1 | 3300050493 | Bacteria | 905 |
| 451 | nmdc:mga0k408_377245_c1 | 3300050493 | Bacteria | 845 |
| 452 | nmdc:mga0k408_940415_c1 | 3300050493 | Bacteria | 501 |
| 453 | nmdc:mga06z11_114389_c1 | 3300050494 | Bacteria | 1498 |
| 454 | nmdc:mga06z11_557972_c1 | 3300050494 | Bacteria | 696 |
| 455 | nmdc:mga04h51_150219_c1 | 3300050495 | Bacteria | 890 |
| 456 | nmdc:mga07m45_110796_c1 | 3300050496 | Bacteria | 1581 |
| 457 | nmdc:mga07m45_135754_c1 | 3300050496 | Bacteria | 1424 |
| 458 | nmdc:mga07m45_45882_c1 | 3300050496 | Bacteria | 2454 |
| 459 | nmdc:mga05p37_2127583_c1 | 3300050507 | Bacteria | 524 |
| 460 | nmdc:mga0n895_1532692_c1 | 3300050512 | Unclassified | 632 |
| 461 | nmdc:mga0n895_214406_c1 | 3300050512 | Bacteria | 1955 |
| 462 | nmdc:mga0n895_470091_c1 | 3300050512 | Bacteria | 1268 |
| 463 | nmdc:mga0rr50_337035_c1 | 3300050513 | Bacteria | 1267 |
| 464 | nmdc:mga0rr50_595903_c1 | 3300050513 | Bacteria | 942 |
| 465 | nmdc:mga0rr50_601009_c1 | 3300050513 | Bacteria | 938 |
| 466 | nmdc:mga08x19_350734_c1 | 3300050514 | Bacteria | 1030 |
| 467 | nmdc:mga0a205_675157_c1 | 3300050515 | Bacteria | 884 |
| 468 | Ga0495601_0099995 | 3300053077 | Bacteria | 1872 |
| 469 | Ga0500646_0029362 | 3300053090 | Bacteria | 1505 |
| 470 | Ga0500608_054840 | 3300053122 | Bacteria | 1912 |
| 471 | Ga0500618_043307 | 3300053125 | Bacteria | 1029 |
| 472 | Ga0500658_0044912 | 3300053134 | Bacteria | 1784 |
| 473 | Ga0500559_0013547 | 3300053136 | Bacteria | 3451 |
| 474 | Ga0500564_035821 | 3300053138 | Bacteria | 2291 |
| 475 | Ga0500622_0271440 | 3300053156 | Bacteria | 735 |
| 476 | Ga0500567_081028 | 3300053723 | Bacteria | 1401 |
| 477 | Ga0500587_007339 | 3300053739 | Bacteria | 1437 |
| 478 | Ga0466962_0335901 | 3300061719 | Bacteria | 751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005536 | Ga0070697_100183223 | Ga0070697_1001832232 | 115 |
| 2 | 3300005444 | Ga0070694_100779511 | Ga0070694_1007795112 | 117 |
| 3 | 3300005545 | Ga0070695_100209656 | Ga0070695_1002096562 | 117 |
| 4 | 3300005549 | Ga0070704_100042061 | Ga0070704_1000420612 | 117 |
| 5 | 3300025939 | Ga0207665_10027809 | Ga0207665_100278093 | 117 |
| 6 | 3300042435 | Ga0439434_0320390 | Ga0439434_0320390_12_365 | 117 |
| 7 | 3300046477 | Ga0495664_0508658 | Ga0495664_0508658_133_558 | 117 |
| 8 | iso_pu_bacteria | 2599185214 | 2599622999 | 124 |
| 9 | iso_pu_bacteria | 2599185226 | 2599674646 | 124 |
| 10 | iso_pu_bacteria | 2599185227 | 2599680603 | 124 |
| 11 | iso_pu_bacteria | 2599185229 | 2599692618 | 124 |
| 12 | iso_pu_bacteria | 2904449895 | 2904455281 | 124 |
| 13 | iso_pu_bacteria | 2904456579 | 2904461314 | 124 |
| 14 | iso_pu_bacteria | 2928070936 | 2928075825 | 124 |
| 15 | iso_pu_bacteria | 2945972063 | 2945972417 | 124 |
| 16 | 3300006048 | Ga0075363_100421555 | Ga0075363_1004215552 | 127 |
| 17 | 3300025925 | Ga0207650_10354946 | Ga0207650_103549461 | 127 |
| 18 | 3300050490 | nmdc:mga03n38_439699_c1 | nmdc:mga03n38_439699_c1_179_661 | 127 |
| 19 | 2162886007 | SwRhRL2b_contig_1133905 | SwRhRL2b_0207.00002880 | 128 |
| 20 | 2162886007 | SwRhRL2b_contig_805671 | SwRhRL2b_0928.00004210 | 128 |
| 21 | 3300002773 | JGI25152J39213_1003768 | JGI25152J39213_10037684 | 128 |
| 22 | 3300003187 | JGI25151J46595_10024381 | JGI25151J46595_100243811 | 128 |
| 23 | 3300003316 | rootH1_10009465 | rootH1_100094652 | 128 |
| 24 | 3300003323 | rootH1_10042863 | rootH1_100428633 | 128 |
| 25 | 3300003578 | Ga0006562J51391_1151502 | Ga0006562J51391_11515021 | 128 |
| 26 | 3300003759 | Ga0055525_1000021 | Ga0055525_1000021152 | 128 |
| 27 | 3300003761 | Ga0055535_1000075 | Ga0055535_100007578 | 128 |
| 28 | 3300003762 | Ga0055542_1000059 | Ga0055542_1000059125 | 128 |
| 29 | 3300003791 | Ga0055530_10000110 | Ga0055530_1000011037 | 128 |
| 30 | 3300003792 | Ga0055540_1001401 | Ga0055540_10014012 | 128 |
| 31 | 3300003792 | Ga0055540_1002424 | Ga0055540_10024242 | 128 |
| 32 | 3300003794 | Ga0055531_10001413 | Ga0055531_1000141310 | 128 |
| 33 | 3300004625 | Ga0055543_1000644 | Ga0055543_10006448 | 128 |
| 34 | 3300004803 | Ga0058862_11893894 | Ga0058862_118938942 | 128 |
| 35 | 3300005288 | Ga0065714_10003364 | Ga0065714_100033644 | 128 |
| 36 | 3300005289 | Ga0065704_10008021 | Ga0065704_100080213 | 128 |
| 37 | 3300005327 | Ga0070658_10018794 | Ga0070658_100187947 | 128 |
| 38 | 3300005328 | Ga0070676_10547651 | Ga0070676_105476511 | 128 |
| 39 | 3300005329 | Ga0070683_100037905 | Ga0070683_1000379052 | 128 |
| 40 | 3300005329 | Ga0070683_100197063 | Ga0070683_1001970631 | 128 |
| 41 | 3300005336 | Ga0070680_100050642 | Ga0070680_1000506426 | 128 |
| 42 | 3300005338 | Ga0068868_100980961 | Ga0068868_1009809611 | 128 |
| 43 | 3300005338 | Ga0068868_101055707 | Ga0068868_1010557071 | 128 |
| 44 | 3300005339 | Ga0070660_100011925 | Ga0070660_1000119252 | 128 |
| 45 | 3300005339 | Ga0070660_100239910 | Ga0070660_1002399102 | 128 |
| 46 | 3300005344 | Ga0070661_100026217 | Ga0070661_1000262172 | 128 |
| 47 | 3300005353 | Ga0070669_100043497 | Ga0070669_1000434971 | 128 |
| 48 | 3300005354 | Ga0070675_101848967 | Ga0070675_1018489671 | 128 |
| 49 | 3300005355 | Ga0070671_100006289 | Ga0070671_1000062896 | 128 |
| 50 | 3300005366 | Ga0070659_100012771 | Ga0070659_1000127717 | 128 |
| 51 | 3300005367 | Ga0070667_100850646 | Ga0070667_1008506461 | 128 |
| 52 | 3300005435 | Ga0070714_100281266 | Ga0070714_1002812661 | 128 |
| 53 | 3300005436 | Ga0070713_100002534 | Ga0070713_10000253410 | 128 |
| 54 | 3300005445 | Ga0070708_100189520 | Ga0070708_1001895202 | 128 |
| 55 | 3300005456 | Ga0070678_100648075 | Ga0070678_1006480752 | 128 |
| 56 | 3300005456 | Ga0070678_101539945 | Ga0070678_1015399451 | 128 |
| 57 | 3300005457 | Ga0070662_100095764 | Ga0070662_1000957641 | 128 |
| 58 | 3300005458 | Ga0070681_10210008 | Ga0070681_102100082 | 128 |
| 59 | 3300005458 | Ga0070681_10269862 | Ga0070681_102698622 | 128 |
| 60 | 3300005459 | Ga0068867_100169390 | Ga0068867_1001693903 | 128 |
| 61 | 3300005467 | Ga0070706_100002053 | Ga0070706_1000020537 | 128 |
| 62 | 3300005467 | Ga0070706_100106729 | Ga0070706_1001067292 | 128 |
| 63 | 3300005467 | Ga0070706_100167442 | Ga0070706_1001674422 | 128 |
| 64 | 3300005468 | Ga0070707_100073705 | Ga0070707_1000737052 | 128 |
| 65 | 3300005468 | Ga0070707_100086667 | Ga0070707_1000866672 | 128 |
| 66 | 3300005468 | Ga0070707_100209098 | Ga0070707_1002090982 | 128 |
| 67 | 3300005471 | Ga0070698_100144502 | Ga0070698_1001445022 | 128 |
| 68 | 3300005471 | Ga0070698_100568509 | Ga0070698_1005685091 | 128 |
| 69 | 3300005518 | Ga0070699_100070610 | Ga0070699_1000706102 | 128 |
| 70 | 3300005518 | Ga0070699_100346288 | Ga0070699_1003462882 | 128 |
| 71 | 3300005530 | Ga0070679_100154427 | Ga0070679_1001544272 | 128 |
| 72 | 3300005535 | Ga0070684_100040104 | Ga0070684_1000401043 | 128 |
| 73 | 3300005536 | Ga0070697_100038643 | Ga0070697_1000386432 | 128 |
| 74 | 3300005536 | Ga0070697_100879216 | Ga0070697_1008792162 | 128 |
| 75 | 3300005539 | Ga0068853_100263941 | Ga0068853_1002639412 | 128 |
| 76 | 3300005539 | Ga0068853_100731835 | Ga0068853_1007318352 | 128 |
| 77 | 3300005543 | Ga0070672_100405838 | Ga0070672_1004058381 | 128 |
| 78 | 3300005547 | Ga0070693_100058782 | Ga0070693_1000587823 | 128 |
| 79 | 3300005563 | Ga0068855_100020731 | Ga0068855_1000207317 | 128 |
| 80 | 3300005563 | Ga0068855_100075156 | Ga0068855_1000751562 | 128 |
| 81 | 3300005564 | Ga0070664_100197120 | Ga0070664_1001971201 | 128 |
| 82 | 3300005564 | Ga0070664_100306808 | Ga0070664_1003068082 | 128 |
| 83 | 3300005577 | Ga0068857_100039274 | Ga0068857_1000392744 | 128 |
| 84 | 3300005578 | Ga0068854_100023726 | Ga0068854_1000237262 | 128 |
| 85 | 3300005614 | Ga0068856_100045151 | Ga0068856_1000451512 | 128 |
| 86 | 3300005614 | Ga0068856_100146124 | Ga0068856_1001461242 | 128 |
| 87 | 3300005614 | Ga0068856_101587004 | Ga0068856_1015870042 | 128 |
| 88 | 3300005616 | Ga0068852_100193466 | Ga0068852_1001934662 | 128 |
| 89 | 3300005616 | Ga0068852_100869859 | Ga0068852_1008698592 | 128 |
| 90 | 3300005616 | Ga0068852_102149999 | Ga0068852_1021499992 | 128 |
| 91 | 3300005834 | Ga0068851_10021016 | Ga0068851_100210163 | 128 |
| 92 | 3300005834 | Ga0068851_10022285 | Ga0068851_100222852 | 128 |
| 93 | 3300005841 | Ga0068863_100055539 | Ga0068863_1000555392 | 128 |
| 94 | 3300005841 | Ga0068863_100140314 | Ga0068863_1001403143 | 128 |
| 95 | 3300005841 | Ga0068863_100731174 | Ga0068863_1007311742 | 128 |
| 96 | 3300005841 | Ga0068863_101631500 | Ga0068863_1016315002 | 128 |
| 97 | 3300005842 | Ga0068858_100185412 | Ga0068858_1001854122 | 128 |
| 98 | 3300005842 | Ga0068858_101040500 | Ga0068858_1010405001 | 128 |
| 99 | 3300005842 | Ga0068858_101533645 | Ga0068858_1015336452 | 128 |
| 100 | 3300005843 | Ga0068860_100177803 | Ga0068860_1001778032 | 128 |
| 101 | 3300005937 | Ga0081455_10000529 | Ga0081455_1000052928 | 128 |
| 102 | 3300006038 | Ga0075365_10368868 | Ga0075365_103688682 | 128 |
| 103 | 3300006038 | Ga0075365_10955186 | Ga0075365_109551861 | 128 |
| 104 | 3300006042 | Ga0075368_10186748 | Ga0075368_101867482 | 128 |
| 105 | 3300006048 | Ga0075363_100288999 | Ga0075363_1002889992 | 128 |
| 106 | 3300006051 | Ga0075364_10054702 | Ga0075364_100547022 | 128 |
| 107 | 3300006177 | Ga0075362_10309204 | Ga0075362_103092042 | 128 |
| 108 | 3300006178 | Ga0075367_10024820 | Ga0075367_100248204 | 128 |
| 109 | 3300006178 | Ga0075367_10686544 | Ga0075367_106865441 | 128 |
| 110 | 3300006195 | Ga0075366_10161603 | Ga0075366_101616032 | 128 |
| 111 | 3300006237 | Ga0097621_101351016 | Ga0097621_1013510162 | 128 |
| 112 | 3300006237 | Ga0097621_101527055 | Ga0097621_1015270552 | 128 |
| 113 | 3300006353 | Ga0075370_10004816 | Ga0075370_100048169 | 128 |
| 114 | 3300006353 | Ga0075370_10048797 | Ga0075370_100487972 | 128 |
| 115 | 3300006353 | Ga0075370_10050853 | Ga0075370_100508534 | 128 |
| 116 | 3300006358 | Ga0068871_100064781 | Ga0068871_1000647813 | 128 |
| 117 | 3300006358 | Ga0068871_100728579 | Ga0068871_1007285792 | 128 |
| 118 | 3300006871 | Ga0075434_100311127 | Ga0075434_1003111272 | 128 |
| 119 | 3300006871 | Ga0075434_100504952 | Ga0075434_1005049522 | 128 |
| 120 | 3300006914 | Ga0075436_100390698 | Ga0075436_1003906982 | 128 |
| 121 | 3300007076 | Ga0075435_100242382 | Ga0075435_1002423822 | 128 |
| 122 | 3300007076 | Ga0075435_100378493 | Ga0075435_1003784932 | 128 |
| 123 | 3300007788 | Ga0099795_10395329 | Ga0099795_103953292 | 128 |
| 124 | 3300007788 | Ga0099795_10409304 | Ga0099795_104093041 | 128 |
| 125 | 3300009036 | Ga0105244_10001741 | Ga0105244_1000174114 | 128 |
| 126 | 3300009092 | Ga0105250_10164128 | Ga0105250_101641282 | 128 |
| 127 | 3300009093 | Ga0105240_10002500 | Ga0105240_1000250026 | 128 |
| 128 | 3300009093 | Ga0105240_10013969 | Ga0105240_100139695 | 128 |
| 129 | 3300009093 | Ga0105240_10158852 | Ga0105240_101588523 | 128 |
| 130 | 3300009093 | Ga0105240_10163703 | Ga0105240_101637032 | 128 |
| 131 | 3300009093 | Ga0105240_10394371 | Ga0105240_103943712 | 128 |
| 132 | 3300009098 | Ga0105245_11216601 | Ga0105245_112166012 | 128 |
| 133 | 3300009147 | Ga0114129_11415327 | Ga0114129_114153271 | 128 |
| 134 | 3300009148 | Ga0105243_10006549 | Ga0105243_1000654910 | 128 |
| 135 | 3300009148 | Ga0105243_10050457 | Ga0105243_100504573 | 128 |
| 136 | 3300009148 | Ga0105243_10320348 | Ga0105243_103203482 | 128 |
| 137 | 3300009174 | Ga0105241_10396362 | Ga0105241_103963622 | 128 |
| 138 | 3300009176 | Ga0105242_10324007 | Ga0105242_103240072 | 128 |
| 139 | 3300009177 | Ga0105248_10029905 | Ga0105248_100299056 | 128 |
| 140 | 3300009545 | Ga0105237_10015430 | Ga0105237_100154306 | 128 |
| 141 | 3300009545 | Ga0105237_10196836 | Ga0105237_101968362 | 128 |
| 142 | 3300009551 | Ga0105238_10046432 | Ga0105238_100464326 | 128 |
| 143 | 3300009551 | Ga0105238_10053582 | Ga0105238_100535822 | 128 |
| 144 | 3300009551 | Ga0105238_10059178 | Ga0105238_100591783 | 128 |
| 145 | 3300009551 | Ga0105238_10181069 | Ga0105238_101810693 | 128 |
| 146 | 3300009551 | Ga0105238_10190543 | Ga0105238_101905432 | 128 |
| 147 | 3300009551 | Ga0105238_11034431 | Ga0105238_110344312 | 128 |
| 148 | 3300009551 | Ga0105238_11203509 | Ga0105238_112035091 | 128 |
| 149 | 3300010375 | Ga0105239_10264706 | Ga0105239_102647062 | 128 |
| 150 | 3300010375 | Ga0105239_10484359 | Ga0105239_104843593 | 128 |
| 151 | 3300011119 | Ga0105246_10086083 | Ga0105246_100860832 | 128 |
| 152 | 3300013100 | Ga0157373_10006142 | Ga0157373_100061427 | 128 |
| 153 | 3300013100 | Ga0157373_10027357 | Ga0157373_100273575 | 128 |
| 154 | 3300013100 | Ga0157373_10035735 | Ga0157373_100357352 | 128 |
| 155 | 3300013102 | Ga0157371_10013731 | Ga0157371_100137316 | 128 |
| 156 | 3300013102 | Ga0157371_10228626 | Ga0157371_102286262 | 128 |
| 157 | 3300013102 | Ga0157371_10268154 | Ga0157371_102681541 | 128 |
| 158 | 3300013104 | Ga0157370_10219255 | Ga0157370_102192552 | 128 |
| 159 | 3300013104 | Ga0157370_10624902 | Ga0157370_106249021 | 128 |
| 160 | 3300013104 | Ga0157370_10719497 | Ga0157370_107194972 | 128 |
| 161 | 3300013105 | Ga0157369_10000843 | Ga0157369_1000084321 | 128 |
| 162 | 3300013105 | Ga0157369_10060646 | Ga0157369_100606462 | 128 |
| 163 | 3300013296 | Ga0157374_10031324 | Ga0157374_100313242 | 128 |
| 164 | 3300013296 | Ga0157374_10240703 | Ga0157374_102407032 | 128 |
| 165 | 3300013297 | Ga0157378_10020288 | Ga0157378_100202884 | 128 |
| 166 | 3300013297 | Ga0157378_10688837 | Ga0157378_106888372 | 128 |
| 167 | 3300013297 | Ga0157378_11287358 | Ga0157378_112873582 | 128 |
| 168 | 3300013307 | Ga0157372_10014374 | Ga0157372_100143742 | 128 |
| 169 | 3300013307 | Ga0157372_10030694 | Ga0157372_100306947 | 128 |
| 170 | 3300013307 | Ga0157372_10041765 | Ga0157372_100417656 | 128 |
| 171 | 3300013307 | Ga0157372_12643798 | Ga0157372_126437982 | 128 |
| 172 | 3300013308 | Ga0157375_10762661 | Ga0157375_107626611 | 128 |
| 173 | 3300014497 | Ga0182008_10001695 | Ga0182008_100016959 | 128 |
| 174 | 3300014497 | Ga0182008_10018301 | Ga0182008_100183013 | 128 |
| 175 | 3300014497 | Ga0182008_10169992 | Ga0182008_101699921 | 128 |
| 176 | 3300014969 | Ga0157376_10293249 | Ga0157376_102932492 | 128 |
| 177 | 3300014969 | Ga0157376_10790852 | Ga0157376_107908522 | 128 |
| 178 | 3300015261 | Ga0182006_1001421 | Ga0182006_10014214 | 128 |
| 179 | 3300015261 | Ga0182006_1054110 | Ga0182006_10541102 | 128 |
| 180 | 3300015262 | Ga0182007_10000269 | Ga0182007_100002692 | 128 |
| 181 | 3300015262 | Ga0182007_10060516 | Ga0182007_100605162 | 128 |
| 182 | 3300015265 | Ga0182005_1055896 | Ga0182005_10558962 | 128 |
| 183 | 3300017792 | Ga0163161_10079679 | Ga0163161_100796792 | 128 |
| 184 | 3300017792 | Ga0163161_10338879 | Ga0163161_103388792 | 128 |
| 185 | 3300017792 | Ga0163161_10986849 | Ga0163161_109868492 | 128 |
| 186 | 3300025230 | Ga0209563_100005 | Ga0209563_100005175 | 128 |
| 187 | 3300025303 | Ga0209051_1000979 | Ga0209051_100097930 | 128 |
| 188 | 3300025321 | Ga0207656_10022314 | Ga0207656_100223142 | 128 |
| 189 | 3300025321 | Ga0207656_10023216 | Ga0207656_100232162 | 128 |
| 190 | 3300025321 | Ga0207656_10035942 | Ga0207656_100359423 | 128 |
| 191 | 3300025885 | Ga0207653_10205235 | Ga0207653_102052351 | 128 |
| 192 | 3300025903 | Ga0207680_11004681 | Ga0207680_110046812 | 128 |
| 193 | 3300025907 | Ga0207645_10208452 | Ga0207645_102084523 | 128 |
| 194 | 3300025908 | Ga0207643_10335998 | Ga0207643_103359982 | 128 |
| 195 | 3300025909 | Ga0207705_10082515 | Ga0207705_100825151 | 128 |
| 196 | 3300025910 | Ga0207684_10054550 | Ga0207684_100545503 | 128 |
| 197 | 3300025910 | Ga0207684_10576008 | Ga0207684_105760082 | 128 |
| 198 | 3300025910 | Ga0207684_10883649 | Ga0207684_108836492 | 128 |
| 199 | 3300025911 | Ga0207654_10223827 | Ga0207654_102238272 | 128 |
| 200 | 3300025912 | Ga0207707_10122830 | Ga0207707_101228302 | 128 |
| 201 | 3300025913 | Ga0207695_10040490 | Ga0207695_100404904 | 128 |
| 202 | 3300025913 | Ga0207695_10062860 | Ga0207695_100628603 | 128 |
| 203 | 3300025913 | Ga0207695_10171178 | Ga0207695_101711781 | 128 |
| 204 | 3300025913 | Ga0207695_10304354 | Ga0207695_103043542 | 128 |
| 205 | 3300025914 | Ga0207671_10008619 | Ga0207671_100086196 | 128 |
| 206 | 3300025914 | Ga0207671_10039086 | Ga0207671_100390862 | 128 |
| 207 | 3300025914 | Ga0207671_10039920 | Ga0207671_100399202 | 128 |
| 208 | 3300025917 | Ga0207660_10148383 | Ga0207660_101483832 | 128 |
| 209 | 3300025919 | Ga0207657_10016574 | Ga0207657_100165742 | 128 |
| 210 | 3300025919 | Ga0207657_10093005 | Ga0207657_100930054 | 128 |
| 211 | 3300025919 | Ga0207657_10353789 | Ga0207657_103537892 | 128 |
| 212 | 3300025919 | Ga0207657_10455933 | Ga0207657_104559332 | 128 |
| 213 | 3300025920 | Ga0207649_10043086 | Ga0207649_100430863 | 128 |
| 214 | 3300025921 | Ga0207652_10128265 | Ga0207652_101282652 | 128 |
| 215 | 3300025921 | Ga0207652_10447531 | Ga0207652_104475312 | 128 |
| 216 | 3300025922 | Ga0207646_10001985 | Ga0207646_1000198521 | 128 |
| 217 | 3300025922 | Ga0207646_10640695 | Ga0207646_106406952 | 128 |
| 218 | 3300025922 | Ga0207646_10648246 | Ga0207646_106482461 | 128 |
| 219 | 3300025923 | Ga0207681_11168299 | Ga0207681_111682992 | 128 |
| 220 | 3300025924 | Ga0207694_10011581 | Ga0207694_100115818 | 128 |
| 221 | 3300025924 | Ga0207694_10031848 | Ga0207694_100318482 | 128 |
| 222 | 3300025924 | Ga0207694_10106212 | Ga0207694_101062123 | 128 |
| 223 | 3300025924 | Ga0207694_10243677 | Ga0207694_102436772 | 128 |
| 224 | 3300025924 | Ga0207694_10507830 | Ga0207694_105078302 | 128 |
| 225 | 3300025924 | Ga0207694_10828918 | Ga0207694_108289182 | 128 |
| 226 | 3300025926 | Ga0207659_10570225 | Ga0207659_105702252 | 128 |
| 227 | 3300025927 | Ga0207687_10009492 | Ga0207687_100094927 | 128 |
| 228 | 3300025927 | Ga0207687_10586269 | Ga0207687_105862692 | 128 |
| 229 | 3300025928 | Ga0207700_10000023 | Ga0207700_1000002358 | 128 |
| 230 | 3300025929 | Ga0207664_10252464 | Ga0207664_102524641 | 128 |
| 231 | 3300025931 | Ga0207644_10005689 | Ga0207644_100056898 | 128 |
| 232 | 3300025932 | Ga0207690_10041570 | Ga0207690_100415704 | 128 |
| 233 | 3300025932 | Ga0207690_10209176 | Ga0207690_102091762 | 128 |
| 234 | 3300025933 | Ga0207706_10038066 | Ga0207706_100380662 | 128 |
| 235 | 3300025933 | Ga0207706_10130152 | Ga0207706_101301523 | 128 |
| 236 | 3300025934 | Ga0207686_10345486 | Ga0207686_103454862 | 128 |
| 237 | 3300025935 | Ga0207709_10858962 | Ga0207709_108589621 | 128 |
| 238 | 3300025935 | Ga0207709_11245038 | Ga0207709_112450381 | 128 |
| 239 | 3300025936 | Ga0207670_10446444 | Ga0207670_104464441 | 128 |
| 240 | 3300025938 | Ga0207704_10312584 | Ga0207704_103125842 | 128 |
| 241 | 3300025939 | Ga0207665_10877827 | Ga0207665_108778272 | 128 |
| 242 | 3300025940 | Ga0207691_10222421 | Ga0207691_102224212 | 128 |
| 243 | 3300025941 | Ga0207711_10013786 | Ga0207711_100137863 | 128 |
| 244 | 3300025942 | Ga0207689_10000485 | Ga0207689_100004858 | 128 |
| 245 | 3300025942 | Ga0207689_10497350 | Ga0207689_104973502 | 128 |
| 246 | 3300025944 | Ga0207661_10152085 | Ga0207661_101520852 | 128 |
| 247 | 3300025945 | Ga0207679_10399865 | Ga0207679_103998652 | 128 |
| 248 | 3300025949 | Ga0207667_10070033 | Ga0207667_100700332 | 128 |
| 249 | 3300025981 | Ga0207640_10404827 | Ga0207640_104048272 | 128 |
| 250 | 3300025981 | Ga0207640_10579721 | Ga0207640_105797212 | 128 |
| 251 | 3300025986 | Ga0207658_10406238 | Ga0207658_104062382 | 128 |
| 252 | 3300025986 | Ga0207658_10628519 | Ga0207658_106285192 | 128 |
| 253 | 3300026023 | Ga0207677_10385619 | Ga0207677_103856191 | 128 |
| 254 | 3300026023 | Ga0207677_10397262 | Ga0207677_103972622 | 128 |
| 255 | 3300026023 | Ga0207677_10942626 | Ga0207677_109426261 | 128 |
| 256 | 3300026035 | Ga0207703_10063010 | Ga0207703_100630102 | 128 |
| 257 | 3300026035 | Ga0207703_10122628 | Ga0207703_101226282 | 128 |
| 258 | 3300026041 | Ga0207639_10005201 | Ga0207639_100052017 | 128 |
| 259 | 3300026041 | Ga0207639_10056507 | Ga0207639_100565073 | 128 |
| 260 | 3300026041 | Ga0207639_10555439 | Ga0207639_105554392 | 128 |
| 261 | 3300026041 | Ga0207639_10674729 | Ga0207639_106747292 | 128 |
| 262 | 3300026067 | Ga0207678_10019010 | Ga0207678_100190107 | 128 |
| 263 | 3300026067 | Ga0207678_10336875 | Ga0207678_103368752 | 128 |
| 264 | 3300026078 | Ga0207702_10078095 | Ga0207702_100780952 | 128 |
| 265 | 3300026078 | Ga0207702_11003410 | Ga0207702_110034102 | 128 |
| 266 | 3300026078 | Ga0207702_11918650 | Ga0207702_119186502 | 128 |
| 267 | 3300026088 | Ga0207641_10019011 | Ga0207641_100190112 | 128 |
| 268 | 3300026088 | Ga0207641_10121814 | Ga0207641_101218142 | 128 |
| 269 | 3300026088 | Ga0207641_10176970 | Ga0207641_101769702 | 128 |
| 270 | 3300026088 | Ga0207641_12055682 | Ga0207641_120556821 | 128 |
| 271 | 3300026089 | Ga0207648_10049361 | Ga0207648_100493612 | 128 |
| 272 | 3300026095 | Ga0207676_10197367 | Ga0207676_101973672 | 128 |
| 273 | 3300026116 | Ga0207674_10053011 | Ga0207674_100530112 | 128 |
| 274 | 3300026116 | Ga0207674_10314725 | Ga0207674_103147252 | 128 |
| 275 | 3300026118 | Ga0207675_100000216 | Ga0207675_1000002169 | 128 |
| 276 | 3300026121 | Ga0207683_10777511 | Ga0207683_107775112 | 128 |
| 277 | 3300026142 | Ga0207698_10100776 | Ga0207698_101007762 | 128 |
| 278 | 3300026142 | Ga0207698_10576920 | Ga0207698_105769201 | 128 |
| 279 | 3300026142 | Ga0207698_10982606 | Ga0207698_109826062 | 128 |
| 280 | 3300027866 | Ga0209813_10188488 | Ga0209813_101884882 | 128 |
| 281 | 3300028381 | Ga0268264_10120988 | Ga0268264_101209882 | 128 |
| 282 | 3300028381 | Ga0268264_11190180 | Ga0268264_111901802 | 128 |
| 283 | 3300028786 | Ga0307517_10226113 | Ga0307517_102261132 | 128 |
| 284 | 3300028794 | Ga0307515_10000588 | Ga0307515_1000058860 | 128 |
| 285 | 3300028794 | Ga0307515_10350882 | Ga0307515_103508822 | 128 |
| 286 | 3300030742 | Ga0316183_1205824 | Ga0316183_12058242 | 128 |
| 287 | 3300030744 | Ga0316181_1077792 | Ga0316181_10777921 | 128 |
| 288 | 3300030744 | Ga0316181_1222123 | Ga0316181_12221233 | 128 |
| 289 | 3300030745 | Ga0316182_1158317 | Ga0316182_11583172 | 128 |
| 290 | 3300031235 | Ga0265330_10063991 | Ga0265330_100639912 | 128 |
| 291 | 3300031238 | Ga0265332_10000401 | Ga0265332_1000040114 | 128 |
| 292 | 3300031250 | Ga0265331_10000262 | Ga0265331_1000026215 | 128 |
| 293 | 3300031251 | Ga0265327_10009701 | Ga0265327_100097017 | 128 |
| 294 | 3300031456 | Ga0307513_10228514 | Ga0307513_102285142 | 128 |
| 295 | 3300031456 | Ga0307513_10271620 | Ga0307513_102716201 | 128 |
| 296 | 3300031507 | Ga0307509_10401709 | Ga0307509_104017092 | 128 |
| 297 | 3300031548 | Ga0307408_100166395 | Ga0307408_1001663952 | 128 |
| 298 | 3300031616 | Ga0307508_10000030 | Ga0307508_1000003038 | 128 |
| 299 | 3300031649 | Ga0307514_10002589 | Ga0307514_1000258916 | 128 |
| 300 | 3300031649 | Ga0307514_10022816 | Ga0307514_100228161 | 128 |
| 301 | 3300031711 | Ga0265314_10063499 | Ga0265314_100634992 | 128 |
| 302 | 3300031712 | Ga0265342_10034460 | Ga0265342_100344603 | 128 |
| 303 | 3300031712 | Ga0265342_10143406 | Ga0265342_101434062 | 128 |
| 304 | 3300031730 | Ga0307516_10002018 | Ga0307516_1000201820 | 128 |
| 305 | 3300031730 | Ga0307516_10074468 | Ga0307516_100744682 | 128 |
| 306 | 3300031731 | Ga0307405_10073519 | Ga0307405_100735192 | 128 |
| 307 | 3300031901 | Ga0307406_10585168 | Ga0307406_105851682 | 128 |
| 308 | 3300031911 | Ga0307412_10139289 | Ga0307412_101392892 | 128 |
| 309 | 3300031911 | Ga0307412_10179871 | Ga0307412_101798712 | 128 |
| 310 | 3300031911 | Ga0307412_10268140 | Ga0307412_102681402 | 128 |
| 311 | 3300032004 | Ga0307414_11304740 | Ga0307414_113047401 | 128 |
| 312 | 3300033179 | Ga0307507_10155844 | Ga0307507_101558442 | 128 |
| 313 | 3300034818 | Ga0373950_0074729 | Ga0373950_0074729_117_539 | 128 |
| 314 | 3300034819 | Ga0373958_0043707 | Ga0373958_0043707_206_628 | 128 |
| 315 | 3300035084 | Ga0373928_0014799 | Ga0373928_0014799_720_1142 | 128 |
| 316 | 3300035112 | Ga0373932_0137755 | Ga0373932_0137755_207_629 | 128 |
| 317 | 3300035170 | Ga0373943_0305856 | Ga0373943_0305856_314_736 | 128 |
| 318 | 3300035170 | Ga0373943_0945225 | Ga0373943_0945225_13_438 | 128 |
| 319 | 3300035692 | Ga0373935_0257976 | Ga0373935_0257976_416_838 | 128 |
| 320 | 3300035695 | Ga0373927_0765745 | Ga0373927_0765745_150_572 | 128 |
| 321 | 3300035725 | Ga0373947_0574243 | Ga0373947_0574243_149_571 | 128 |
| 322 | 3300035725 | Ga0373947_0669185 | Ga0373947_0669185_186_608 | 128 |
| 323 | 3300036401 | Ga0373937_0738037 | Ga0373937_0738037_33_455 | 128 |
| 324 | 3300037068 | Ga0373925_0633744 | Ga0373925_0633744_104_526 | 128 |
| 325 | 3300037312 | Ga0395899_0008027 | Ga0395899_0008027_6303_6725 | 128 |
| 326 | 3300037418 | Ga0395900_0112102 | Ga0395900_0112102_316_738 | 128 |
| 327 | 3300037418 | Ga0395900_0122997 | Ga0395900_0122997_42_464 | 128 |
| 328 | 3300037418 | Ga0395900_0163570 | Ga0395900_0163570_994_1416 | 128 |
| 329 | 3300037466 | Ga0395898_0023928 | Ga0395898_0023928_1803_2225 | 128 |
| 330 | 3300037466 | Ga0395898_0064104 | Ga0395898_0064104_2005_2427 | 128 |
| 331 | 3300037466 | Ga0395898_1144034 | Ga0395898_1144034_100_579 | 128 |
| 332 | 3300037471 | Ga0395905_0129996 | Ga0395905_0129996_1255_1677 | 128 |
| 333 | 3300037471 | Ga0395905_0712504 | Ga0395905_0712504_158_607 | 128 |
| 334 | 3300037471 | Ga0395905_0750804 | Ga0395905_0750804_232_654 | 128 |
| 335 | 3300038443 | Ga0395901_0293102 | Ga0395901_0293102_412_834 | 128 |
| 336 | 3300039437 | Ga0436365_0120135 | Ga0436365_0120135_78_500 | 128 |
| 337 | 3300039447 | Ga0436361_0091030 | Ga0436361_0091030_1019_1486 | 128 |
| 338 | 3300041441 | Ga0451787_732463 | Ga0451787_732463_227_652 | 128 |
| 339 | 3300041443 | Ga0451789_0208144 | Ga0451789_0208144_979_1404 | 128 |
| 340 | 3300041453 | Ga0451797_1207466 | Ga0451797_1207466_398_823 | 128 |
| 341 | 3300041459 | Ga0451800_1261555 | Ga0451800_1261555_160_585 | 128 |
| 342 | 3300041460 | Ga0451802_1175484 | Ga0451802_1175484_285_710 | 128 |
| 343 | 3300041486 | Ga0451807_0433055 | Ga0451807_0433055_28_453 | 128 |
| 344 | 3300041486 | Ga0451807_1653191 | Ga0451807_1653191_305_730 | 128 |
| 345 | 3300041491 | Ga0451833_0702241 | Ga0451833_0702241_578_1003 | 128 |
| 346 | 3300041492 | Ga0451835_0121393 | Ga0451835_0121393_409_834 | 128 |
| 347 | 3300041496 | Ga0451839_1208443 | Ga0451839_1208443_467_892 | 128 |
| 348 | 3300041498 | Ga0451841_0118537 | Ga0451841_0118537_69_491 | 128 |
| 349 | 3300041501 | Ga0451845_0541005 | Ga0451845_0541005_230_655 | 128 |
| 350 | 3300041507 | Ga0451851_1291770 | Ga0451851_1291770_182_607 | 128 |
| 351 | 3300041509 | Ga0451843_0852173 | Ga0451843_0852173_1902_2327 | 128 |
| 352 | 3300041511 | Ga0451855_2054749 | Ga0451855_2054749_186_611 | 128 |
| 353 | 3300041512 | Ga0451853_3754481 | Ga0451853_3754481_37_462 | 128 |
| 354 | 3300042007 | Ga0439449_0037794 | Ga0439449_0037794_85_507 | 128 |
| 355 | 3300042012 | Ga0439455_0011263 | Ga0439455_0011263_612_1097 | 128 |
| 356 | 3300042439 | Ga0439464_0090092 | Ga0439464_0090092_47_469 | 128 |
| 357 | 3300042876 | Ga0451577_0240257 | Ga0451577_0240257_277_708 | 128 |
| 358 | 3300042876 | Ga0451577_0263266 | Ga0451577_0263266_312_737 | 128 |
| 359 | 3300042876 | Ga0451577_1692403 | Ga0451577_1692403_155_541 | 128 |
| 360 | 3300044656 | Ga0466969_0194863 | Ga0466969_0194863_147_569 | 128 |
| 361 | 3300044656 | Ga0466969_0336965 | Ga0466969_0336965_97_519 | 128 |
| 362 | 3300044673 | Ga0453683_0021324 | Ga0453683_0021324_3060_3482 | 128 |
| 363 | 3300044673 | Ga0453683_0260770 | Ga0453683_0260770_13_444 | 128 |
| 364 | 3300044683 | Ga0466965_0135852 | Ga0466965_0135852_635_1066 | 128 |
| 365 | 3300044693 | Ga0466961_0189447 | Ga0466961_0189447_47_469 | 128 |
| 366 | 3300044712 | Ga0453684_0465695 | Ga0453684_0465695_154_579 | 128 |
| 367 | 3300044719 | Ga0466971_0094165 | Ga0466971_0094165_596_1018 | 128 |
| 368 | 3300044765 | Ga0466970_0367875 | Ga0466970_0367875_237_668 | 128 |
| 369 | 3300044842 | Ga0466957_0264821 | Ga0466957_0264821_531_953 | 128 |
| 370 | 3300044901 | Ga0466960_0021035 | Ga0466960_0021035_1049_1480 | 128 |
| 371 | 3300044901 | Ga0466960_0159829 | Ga0466960_0159829_151_573 | 128 |
| 372 | 3300045049 | Ga0466959_0466161 | Ga0466959_0466161_19_441 | 128 |
| 373 | 3300045051 | Ga0451576_0215421 | Ga0451576_0215421_792_1214 | 128 |
| 374 | 3300045051 | Ga0451576_0647610 | Ga0451576_0647610_396_818 | 128 |
| 375 | 3300045976 | Ga0466967_0892961 | Ga0466967_0892961_402_824 | 128 |
| 376 | 3300046454 | Ga0495592_0000328 | Ga0495592_0000328_18006_18497 | 128 |
| 377 | 3300046472 | Ga0495580_0024117 | Ga0495580_0024117_3933_4355 | 128 |
| 378 | 3300046472 | Ga0495580_0064769 | Ga0495580_0064769_2073_2495 | 128 |
| 379 | 3300046473 | Ga0495582_0147315 | Ga0495582_0147315_370_792 | 128 |
| 380 | 3300046475 | Ga0495639_0002544 | Ga0495639_0002544_3633_4019 | 128 |
| 381 | 3300046475 | Ga0495639_0323352 | Ga0495639_0323352_70_492 | 128 |
| 382 | 3300046512 | Ga0495610_0016380 | Ga0495610_0016380_93_518 | 128 |
| 383 | 3300046519 | Ga0495632_0179430 | Ga0495632_0179430_478_903 | 128 |
| 384 | 3300046519 | Ga0495632_0198534 | Ga0495632_0198534_290_715 | 128 |
| 385 | 3300046522 | Ga0495643_0085589 | Ga0495643_0085589_632_1057 | 128 |
| 386 | 3300046522 | Ga0495643_0156440 | Ga0495643_0156440_653_1075 | 128 |
| 387 | 3300046522 | Ga0495643_0187262 | Ga0495643_0187262_404_829 | 128 |
| 388 | 3300046535 | Ga0495586_0068923 | Ga0495586_0068923_1433_1858 | 128 |
| 389 | 3300046535 | Ga0495586_0125125 | Ga0495586_0125125_137_562 | 128 |
| 390 | 3300046543 | Ga0495645_0006456 | Ga0495645_0006456_2738_3163 | 128 |
| 391 | 3300046660 | Ga0495625_0003304 | Ga0495625_0003304_1059_1484 | 128 |
| 392 | 3300046674 | Ga0495588_0077058 | Ga0495588_0077058_386_772 | 128 |
| 393 | 3300046683 | Ga0495658_0023210 | Ga0495658_0023210_2690_3112 | 128 |
| 394 | 3300046692 | Ga0495671_0580736 | Ga0495671_0580736_100_522 | 128 |
| 395 | 3300047317 | Ga0495604_0254759 | Ga0495604_0254759_334_756 | 128 |
| 396 | 3300047321 | Ga0495676_0153249 | Ga0495676_0153249_593_1015 | 128 |
| 397 | 3300047321 | Ga0495676_0336519 | Ga0495676_0336519_530_916 | 128 |
| 398 | 3300047443 | Ga0495687_216436 | Ga0495687_216436_19_441 | 128 |
| 399 | 3300047472 | Ga0495686_0144795 | Ga0495686_0144795_425_850 | 128 |
| 400 | 3300047673 | Ga0495593_0210271 | Ga0495593_0210271_412_798 | 128 |
| 401 | 3300047673 | Ga0495593_0481720 | Ga0495593_0481720_163_585 | 128 |
| 402 | 3300048903 | Ga0496100_0109914 | Ga0496100_0109914_260_646 | 128 |
| 403 | 3300048903 | Ga0496100_0114481 | Ga0496100_0114481_1321_1743 | 128 |
| 404 | 3300048903 | Ga0496100_0368195 | Ga0496100_0368195_549_971 | 128 |
| 405 | 3300048904 | Ga0496101_0005715 | Ga0496101_0005715_4006_4392 | 128 |
| 406 | 3300048904 | Ga0496101_0053030 | Ga0496101_0053030_2369_2791 | 128 |
| 407 | 3300048905 | Ga0496102_0005508 | Ga0496102_0005508_9373_9759 | 128 |
| 408 | 3300048905 | Ga0496102_0035422 | Ga0496102_0035422_1014_1439 | 128 |
| 409 | 3300048905 | Ga0496102_0243665 | Ga0496102_0243665_715_1137 | 128 |
| 410 | 3300048905 | Ga0496102_0639269 | Ga0496102_0639269_359_781 | 128 |
| 411 | 3300048906 | Ga0496103_0265559 | Ga0496103_0265559_584_970 | 128 |
| 412 | 3300048906 | Ga0496103_0600020 | Ga0496103_0600020_226_648 | 128 |
| 413 | 3300048907 | Ga0496104_0332872 | Ga0496104_0332872_380_802 | 128 |
| 414 | 3300048907 | Ga0496104_0396805 | Ga0496104_0396805_705_1130 | 128 |
| 415 | 3300048907 | Ga0496104_0498979 | Ga0496104_0498979_126_548 | 128 |
| 416 | 3300048907 | Ga0496104_0559621 | Ga0496104_0559621_299_721 | 128 |
| 417 | 3300048908 | Ga0496105_0005462 | Ga0496105_0005462_8206_8592 | 128 |
| 418 | 3300048908 | Ga0496105_0220561 | Ga0496105_0220561_926_1351 | 128 |
| 419 | 3300048909 | Ga0496106_0053197 | Ga0496106_0053197_2231_2617 | 128 |
| 420 | 3300048910 | Ga0496107_0038399 | Ga0496107_0038399_2483_2905 | 128 |
| 421 | 3300048911 | Ga0496108_0068417 | Ga0496108_0068417_1940_2362 | 128 |
| 422 | 3300048911 | Ga0496108_0267992 | Ga0496108_0267992_982_1404 | 128 |
| 423 | 3300048911 | Ga0496108_0331442 | Ga0496108_0331442_295_681 | 128 |
| 424 | 3300048912 | Ga0496109_0446621 | Ga0496109_0446621_632_1054 | 128 |
| 425 | 3300048913 | Ga0496110_0026020 | Ga0496110_0026020_3922_4308 | 128 |
| 426 | 3300048913 | Ga0496110_0044555 | Ga0496110_0044555_848_1270 | 128 |
| 427 | 3300048914 | Ga0496111_0114695 | Ga0496111_0114695_1056_1478 | 128 |
| 428 | 3300048914 | Ga0496111_0131026 | Ga0496111_0131026_369_755 | 128 |
| 429 | 3300048914 | Ga0496111_0200368 | Ga0496111_0200368_996_1418 | 128 |
| 430 | 3300048914 | Ga0496111_0705975 | Ga0496111_0705975_204_626 | 128 |
| 431 | 3300048915 | Ga0496112_0043599 | Ga0496112_0043599_2557_2979 | 128 |
| 432 | 3300048915 | Ga0496112_0904911 | Ga0496112_0904911_318_740 | 128 |
| 433 | 3300048916 | Ga0496113_0099411 | Ga0496113_0099411_1390_1812 | 128 |
| 434 | 3300048916 | Ga0496113_0132626 | Ga0496113_0132626_1151_1537 | 128 |
| 435 | 3300048917 | Ga0496114_0123916 | Ga0496114_0123916_1140_1526 | 128 |
| 436 | 3300048918 | Ga0496115_0114743 | Ga0496115_0114743_22_444 | 128 |
| 437 | 3300048920 | Ga0496117_0090613 | Ga0496117_0090613_719_1204 | 128 |
| 438 | 3300048921 | Ga0496118_0019314 | Ga0496118_0019314_4718_5203 | 128 |
| 439 | 3300048925 | Ga0496122_0000688 | Ga0496122_0000688_15508_15930 | 128 |
| 440 | 3300048925 | Ga0496122_0064646 | Ga0496122_0064646_691_1113 | 128 |
| 441 | 3300048925 | Ga0496122_0173095 | Ga0496122_0173095_707_1192 | 128 |
| 442 | 3300048926 | Ga0496123_0000314 | Ga0496123_0000314_79957_80379 | 128 |
| 443 | 3300048926 | Ga0496123_0077880 | Ga0496123_0077880_158_646 | 128 |
| 444 | 3300048926 | Ga0496123_0214684 | Ga0496123_0214684_15_521 | 128 |
| 445 | 3300048927 | Ga0496124_0039875 | Ga0496124_0039875_2689_3111 | 128 |
| 446 | 3300048927 | Ga0496124_0119653 | Ga0496124_0119653_1117_1602 | 128 |
| 447 | 3300048928 | Ga0496125_0081972 | Ga0496125_0081972_1121_1606 | 128 |
| 448 | 3300048928 | Ga0496125_0206662 | Ga0496125_0206662_11_433 | 128 |
| 449 | 3300048928 | Ga0496125_0750761 | Ga0496125_0750761_81_467 | 128 |
| 450 | 3300049653 | Ga0501206_016097 | Ga0501206_016097_96_650 | 128 |
| 451 | 3300049705 | Ga0501225_0010347 | Ga0501225_0010347_1744_2166 | 128 |
| 452 | 3300050489 | nmdc:mga03683_1992_c1 | nmdc:mga03683_1992_c1_731_1117 | 128 |
| 453 | 3300050490 | nmdc:mga03n38_204035_c1 | nmdc:mga03n38_204035_c1_196_618 | 128 |
| 454 | 3300050491 | nmdc:mga00v17_1014678_c1 | nmdc:mga00v17_1014678_c1_119_505 | 128 |
| 455 | 3300050491 | nmdc:mga00v17_363630_c1 | nmdc:mga00v17_363630_c1_235_621 | 128 |
| 456 | 3300050492 | nmdc:mga0yw44_375176_c1 | nmdc:mga0yw44_375176_c1_400_786 | 128 |
| 457 | 3300050493 | nmdc:mga0k408_101826_c1 | nmdc:mga0k408_101826_c1_605_1027 | 128 |
| 458 | 3300050493 | nmdc:mga0k408_333326_c1 | nmdc:mga0k408_333326_c1_213_689 | 128 |
| 459 | 3300050493 | nmdc:mga0k408_377245_c1 | nmdc:mga0k408_377245_c1_226_711 | 128 |
| 460 | 3300050493 | nmdc:mga0k408_940415_c1 | nmdc:mga0k408_940415_c1_57_443 | 128 |
| 461 | 3300050494 | nmdc:mga06z11_114389_c1 | nmdc:mga06z11_114389_c1_977_1399 | 128 |
| 462 | 3300050494 | nmdc:mga06z11_557972_c1 | nmdc:mga06z11_557972_c1_17_439 | 128 |
| 463 | 3300050495 | nmdc:mga04h51_150219_c1 | nmdc:mga04h51_150219_c1_286_708 | 128 |
| 464 | 3300050496 | nmdc:mga07m45_110796_c1 | nmdc:mga07m45_110796_c1_284_670 | 128 |
| 465 | 3300050496 | nmdc:mga07m45_135754_c1 | nmdc:mga07m45_135754_c1_487_963 | 128 |
| 466 | 3300050496 | nmdc:mga07m45_45882_c1 | nmdc:mga07m45_45882_c1_1006_1428 | 128 |
| 467 | 3300050507 | nmdc:mga05p37_2127583_c1 | nmdc:mga05p37_2127583_c1_68_490 | 128 |
| 468 | 3300050512 | nmdc:mga0n895_1532692_c1 | nmdc:mga0n895_1532692_c1_155_541 | 128 |
| 469 | 3300050512 | nmdc:mga0n895_214406_c1 | nmdc:mga0n895_214406_c1_1052_1474 | 128 |
| 470 | 3300050512 | nmdc:mga0n895_470091_c1 | nmdc:mga0n895_470091_c1_307_729 | 128 |
| 471 | 3300050513 | nmdc:mga0rr50_337035_c1 | nmdc:mga0rr50_337035_c1_236_658 | 128 |
| 472 | 3300050513 | nmdc:mga0rr50_595903_c1 | nmdc:mga0rr50_595903_c1_375_797 | 128 |
| 473 | 3300050513 | nmdc:mga0rr50_601009_c1 | nmdc:mga0rr50_601009_c1_378_800 | 128 |
| 474 | 3300050514 | nmdc:mga08x19_350734_c1 | nmdc:mga08x19_350734_c1_464_886 | 128 |
| 475 | 3300050515 | nmdc:mga0a205_675157_c1 | nmdc:mga0a205_675157_c1_107_529 | 128 |
| 476 | 3300053077 | Ga0495601_0099995 | Ga0495601_0099995_1182_1604 | 128 |
| 477 | 3300053090 | Ga0500646_0029362 | Ga0500646_0029362_179_601 | 128 |
| 478 | 3300053122 | Ga0500608_054840 | Ga0500608_054840_1325_1747 | 128 |
| 479 | 3300053125 | Ga0500618_043307 | Ga0500618_043307_74_496 | 128 |
| 480 | 3300053134 | Ga0500658_0044912 | Ga0500658_0044912_1167_1592 | 128 |
| 481 | 3300053136 | Ga0500559_0013547 | Ga0500559_0013547_1096_1518 | 128 |
| 482 | 3300053138 | Ga0500564_035821 | Ga0500564_035821_1422_1913 | 128 |
| 483 | 3300053156 | Ga0500622_0271440 | Ga0500622_0271440_252_674 | 128 |
| 484 | 3300053723 | Ga0500567_081028 | Ga0500567_081028_163_585 | 128 |
| 485 | 3300053739 | Ga0500587_007339 | Ga0500587_007339_230_655 | 128 |
| 486 | 3300061719 | Ga0466962_0335901 | Ga0466962_0335901_23_445 | 128 |
| 487 | iso_pu_bacteria | 2585428062 | 2587754982 | 128 |
| 488 | iso_pu_bacteria | 2643221609 | 2644058529 | 128 |
| 489 | iso_pu_bacteria | 2643221611 | 2644070658 | 128 |
| 490 | iso_pu_bacteria | 2818991446 | 2819601752 | 128 |
| 491 | iso_pu_bacteria | 2842677519 | 2842680378 | 128 |
| 492 | iso_pu_bacteria | 2842733646 | 2842736823 | 128 |
| 493 | iso_pu_bacteria | 2842747753 | 2842747893 | 128 |
| 494 | iso_pu_bacteria | 2899924645 | 2899928694 | 128 |
| 495 | iso_pu_bacteria | 2899924645 | 2899930819 | 128 |
| 496 | iso_pu_bacteria | 2919462493 | 2919467414 | 128 |
| 497 | iso_pu_bacteria | 2928051484 | 2928055592 | 128 |
| 498 | iso_pu_bacteria | 2928051484 | 2928056297 | 128 |
| 499 | iso_pu_bacteria | 2928064002 | 2928069689 | 128 |
| 500 | iso_pu_bacteria | 2954767861 | 2954768160 | 128 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g2j-assembly1.cif.gz_J | mouse mitochondrial complex i in the active state | 0.498 | 58 | 119 |
| 7bgn-assembly2.cif.gz_C | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.374 | 50 | 126 |
| 7nyu-assembly1.cif.gz_K | respiratory complex i from escherichia coli - conformation 2 | 0.3661 | 58 | 117 |
| 8qhp-assembly1.cif.gz_B | cysteine trna ligase homodimer | 0.3637 | 25 | 124 |
| 7qj1-assembly1.cif.gz_l | structure of the recombinant human gamma-tubulin ring complex 6-spoked assembly intermediate (spokes 7-12, homogeneous dataset) | 0.3571 | 37 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8LPK6_255_358_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7644 | 65 | 99 | 1.10.10.10 |
| af_K7LL22_254_348_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.729 | 57 | 100 | 1.10.10.10 |
| af_K7TUS1_445_604_2.60.40.740 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6852 | 50 | 97 | 2.60.40.740 |
| af_D4A0G9_1_71_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5287 | 55 | 114 | 1.25.40.10 |
| af_Q496H8_42_120_1.10.110.10 | Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins | 0.518 | 57 | 125 | 1.10.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840SKV2-F1-model_v4 | DUF1468 domain-containing protein | 0.9007 | 2 | 124 |
GO:0016020
|
| AF-A0A433SBB6-F1-model_v4 | DUF1468 domain-containing protein | 0.8904 | 2 | 128 |
GO:0016020
|
| AF-A0A433SBB6-F1-model_v4 | DUF1468 domain-containing protein | 0.8777 | 2 | 128 |
GO:0016020
|
| AF-A0A4R6DZF8-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.8769 | 2 | 128 |
GO:0016020
|
| AF-A0A1K2HWY7-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.8681 | 2 | 128 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar