F455550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 500 | 306 | 474 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300025928|Ga0207700_10030218|Ga0207700_100302185 |
| Length | 274 |
| Sequence | VNASSISQKPDIRYNSTLSTIPGINQLTLQAVVFDAYGTLYDIQSVAEITEEAFPGYGDLITQIWRIKQLEYSWLRSLMRRYQDFSFVTRDSLAYTLRTLGLRYDDETFGRIIDKYLHLDLYPDALGALSALRDRTLAILSNGSPDMLNALVANSGLDRILTATLSVDAHKAFKPSPEAYSLIEEKLGVKPANVLFVSSNPWDACGAKAFGLNVAWLERVTPEAMALACVENDLLAPLTLFKALRTQMDALGVEVDHRIRSLSELADIVAFHES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 6 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 9 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 10 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 11 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 12 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 13 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 14 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 15 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 16 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 17 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 18 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 19 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 282 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 283 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 284 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 286 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 289 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 290 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 293 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 294 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 297 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 298 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 300 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 301 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 302 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 303 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 304 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 305 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 306 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.99 |
| Metatranscriptomes | 0 |
| Isolates | 5.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.2 |
| Nodule | 3.8 |
| Rhizoplane | 7.4 |
| Rhizosphere | 71.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000371 | 3300003215 | Bacteria | 30777 |
| 2 | Ga0070676_10070124 | 3300005328 | Bacteria | 2102 |
| 3 | Ga0070676_10216912 | 3300005328 | Bacteria | 1262 |
| 4 | Ga0070683_100003434 | 3300005329 | Bacteria | 12861 |
| 5 | Ga0070683_100125746 | 3300005329 | Bacteria | 2424 |
| 6 | Ga0070670_100203033 | 3300005331 | Bacteria | 1723 |
| 7 | Ga0068869_100103714 | 3300005334 | Bacteria | 2155 |
| 8 | Ga0070680_100179591 | 3300005336 | Bacteria | 1783 |
| 9 | Ga0070680_100353003 | 3300005336 | Bacteria | 1250 |
| 10 | Ga0070682_100030922 | 3300005337 | Bacteria | 3235 |
| 11 | Ga0070682_100116743 | 3300005337 | Bacteria | 1786 |
| 12 | Ga0068868_100085990 | 3300005338 | Bacteria | 2527 |
| 13 | Ga0070660_100333375 | 3300005339 | Bacteria | 1248 |
| 14 | Ga0070689_100233874 | 3300005340 | Bacteria | 1511 |
| 15 | Ga0070691_10079547 | 3300005341 | Bacteria | 1603 |
| 16 | Ga0070668_100027647 | 3300005347 | Bacteria | 4306 |
| 17 | Ga0070668_100044624 | 3300005347 | Bacteria | 3400 |
| 18 | Ga0070668_100379986 | 3300005347 | Bacteria | 1202 |
| 19 | Ga0070669_100314843 | 3300005353 | Bacteria | 1262 |
| 20 | Ga0070674_100119052 | 3300005356 | Bacteria | 1952 |
| 21 | Ga0070688_100164938 | 3300005365 | Bacteria | 1525 |
| 22 | Ga0070667_100220150 | 3300005367 | Bacteria | 1689 |
| 23 | Ga0070709_10086101 | 3300005434 | Bacteria | 2062 |
| 24 | Ga0070709_10115621 | 3300005434 | Bacteria | 1810 |
| 25 | Ga0070714_100044149 | 3300005435 | Bacteria | 3773 |
| 26 | Ga0070714_100248501 | 3300005435 | Bacteria | 1644 |
| 27 | Ga0070713_100005334 | 3300005436 | Bacteria | 8772 |
| 28 | Ga0070713_100028331 | 3300005436 | Bacteria | 4422 |
| 29 | Ga0070713_100544532 | 3300005436 | Bacteria | 1098 |
| 30 | Ga0070710_10010883 | 3300005437 | Bacteria | 4480 |
| 31 | Ga0070701_10204181 | 3300005438 | Bacteria | 1170 |
| 32 | Ga0070711_100006314 | 3300005439 | Bacteria | 7135 |
| 33 | Ga0070711_100027834 | 3300005439 | Bacteria | 3714 |
| 34 | Ga0070711_100186816 | 3300005439 | Bacteria | 1590 |
| 35 | Ga0070700_100154288 | 3300005441 | Bacteria | 1574 |
| 36 | Ga0070663_100009946 | 3300005455 | Bacteria | 5912 |
| 37 | Ga0070663_100041847 | 3300005455 | Bacteria | 3216 |
| 38 | Ga0070663_100189560 | 3300005455 | Bacteria | 1599 |
| 39 | Ga0070663_100242256 | 3300005455 | Bacteria | 1424 |
| 40 | Ga0070678_100014130 | 3300005456 | Bacteria | 5028 |
| 41 | Ga0070678_100067232 | 3300005456 | Bacteria | 2666 |
| 42 | Ga0070678_100340869 | 3300005456 | Bacteria | 1286 |
| 43 | Ga0070662_100038959 | 3300005457 | Bacteria | 3379 |
| 44 | Ga0070662_100150407 | 3300005457 | Bacteria | 1812 |
| 45 | Ga0070662_100239147 | 3300005457 | Bacteria | 1456 |
| 46 | Ga0070681_10036493 | 3300005458 | Bacteria | 4936 |
| 47 | Ga0070681_10036669 | 3300005458 | Bacteria | 4923 |
| 48 | Ga0070681_10063863 | 3300005458 | Bacteria | 3655 |
| 49 | Ga0070681_10066319 | 3300005458 | Bacteria | 3578 |
| 50 | Ga0068867_100118992 | 3300005459 | Bacteria | 2039 |
| 51 | Ga0070685_10091281 | 3300005466 | Bacteria | 1844 |
| 52 | Ga0070707_100287136 | 3300005468 | Bacteria | 1599 |
| 53 | Ga0070698_100197354 | 3300005471 | Bacteria | 1949 |
| 54 | Ga0070679_100020155 | 3300005530 | Bacteria | 6498 |
| 55 | Ga0070679_100044206 | 3300005530 | Bacteria | 4438 |
| 56 | Ga0070679_100200146 | 3300005530 | Bacteria | 1964 |
| 57 | Ga0070684_100010514 | 3300005535 | Bacteria | 7333 |
| 58 | Ga0070684_100010579 | 3300005535 | Bacteria | 7315 |
| 59 | Ga0070697_100271391 | 3300005536 | Bacteria | 1454 |
| 60 | Ga0070697_100407254 | 3300005536 | Bacteria | 1181 |
| 61 | Ga0068853_100385356 | 3300005539 | Bacteria | 1310 |
| 62 | Ga0070672_100213802 | 3300005543 | Bacteria | 1615 |
| 63 | Ga0070696_100340016 | 3300005546 | Bacteria | 1160 |
| 64 | Ga0070665_100082915 | 3300005548 | Bacteria | 3211 |
| 65 | Ga0070665_100298902 | 3300005548 | Bacteria | 1612 |
| 66 | Ga0068855_100117899 | 3300005563 | Bacteria | 3041 |
| 67 | Ga0068855_100244621 | 3300005563 | Bacteria | 2003 |
| 68 | Ga0068855_100353404 | 3300005563 | Bacteria | 1618 |
| 69 | Ga0070664_100158597 | 3300005564 | Bacteria | 2000 |
| 70 | Ga0070664_100482562 | 3300005564 | Bacteria | 1141 |
| 71 | Ga0068857_100131062 | 3300005577 | Bacteria | 2261 |
| 72 | Ga0068857_100300780 | 3300005577 | Bacteria | 1479 |
| 73 | Ga0068852_100112957 | 3300005616 | Bacteria | 2473 |
| 74 | Ga0068852_100219604 | 3300005616 | Bacteria | 1807 |
| 75 | Ga0068852_100324664 | 3300005616 | Bacteria | 1496 |
| 76 | Ga0068852_100676606 | 3300005616 | Bacteria | 1041 |
| 77 | Ga0068864_100030394 | 3300005618 | Bacteria | 4578 |
| 78 | Ga0068861_100089955 | 3300005719 | Bacteria | 2420 |
| 79 | Ga0068861_100127997 | 3300005719 | Bacteria | 2058 |
| 80 | Ga0068863_100225733 | 3300005841 | Bacteria | 1805 |
| 81 | Ga0068858_100021643 | 3300005842 | Bacteria | 6010 |
| 82 | Ga0068860_100200531 | 3300005843 | Bacteria | 1933 |
| 83 | Ga0068860_100380379 | 3300005843 | Bacteria | 1393 |
| 84 | Ga0068862_100172610 | 3300005844 | Bacteria | 1936 |
| 85 | Ga0068862_100243072 | 3300005844 | Bacteria | 1637 |
| 86 | Ga0081455_10001281 | 3300005937 | Bacteria | 31263 |
| 87 | Ga0081455_10038108 | 3300005937 | Bacteria | 4259 |
| 88 | Ga0081538_10085961 | 3300005981 | Bacteria | 1649 |
| 89 | Ga0081540_1008353 | 3300005983 | Bacteria | 7236 |
| 90 | Ga0081540_1020858 | 3300005983 | Bacteria | 3925 |
| 91 | Ga0081540_1089061 | 3300005983 | Bacteria | 1363 |
| 92 | Ga0081539_10001606 | 3300005985 | Bacteria | 37203 |
| 93 | Ga0081539_10033579 | 3300005985 | Bacteria | 3121 |
| 94 | Ga0070717_10025976 | 3300006028 | Bacteria | 4668 |
| 95 | Ga0075365_10079992 | 3300006038 | Bacteria | 2212 |
| 96 | Ga0075365_10104682 | 3300006038 | Bacteria | 1940 |
| 97 | Ga0075365_10300075 | 3300006038 | Bacteria | 1130 |
| 98 | Ga0075363_100092193 | 3300006048 | Bacteria | 1668 |
| 99 | Ga0075364_10134586 | 3300006051 | Bacteria | 1660 |
| 100 | Ga0075432_10043244 | 3300006058 | Bacteria | 1578 |
| 101 | Ga0070716_100055960 | 3300006173 | Bacteria | 2260 |
| 102 | Ga0070712_100036260 | 3300006175 | Bacteria | 3354 |
| 103 | Ga0075362_10025287 | 3300006177 | Bacteria | 2526 |
| 104 | Ga0075367_10017544 | 3300006178 | Bacteria | 3931 |
| 105 | Ga0075367_10075768 | 3300006178 | Bacteria | 2029 |
| 106 | Ga0097621_100054611 | 3300006237 | Bacteria | 3259 |
| 107 | Ga0097621_100529196 | 3300006237 | Bacteria | 1071 |
| 108 | Ga0075370_10074220 | 3300006353 | Bacteria | 1949 |
| 109 | Ga0075370_10289413 | 3300006353 | Bacteria | 973 |
| 110 | Ga0068871_100132069 | 3300006358 | Bacteria | 2118 |
| 111 | Ga0068871_100238078 | 3300006358 | Bacteria | 1581 |
| 112 | Ga0075434_100292971 | 3300006871 | Bacteria | 1647 |
| 113 | Ga0068865_100043769 | 3300006881 | Bacteria | 3061 |
| 114 | Ga0075436_100416412 | 3300006914 | Bacteria | 975 |
| 115 | Ga0099795_10031402 | 3300007788 | Bacteria | 1828 |
| 116 | Ga0105250_10165453 | 3300009092 | Bacteria | 924 |
| 117 | Ga0105240_10113119 | 3300009093 | Bacteria | 3280 |
| 118 | Ga0105240_10223865 | 3300009093 | Bacteria | 2190 |
| 119 | Ga0111539_10216329 | 3300009094 | Bacteria | 2232 |
| 120 | Ga0105247_10168258 | 3300009101 | Bacteria | 1456 |
| 121 | Ga0105243_10062938 | 3300009148 | Bacteria | 2972 |
| 122 | Ga0105243_10106362 | 3300009148 | Bacteria | 2339 |
| 123 | Ga0105241_10040357 | 3300009174 | Bacteria | 3524 |
| 124 | Ga0105241_10042226 | 3300009174 | Bacteria | 3448 |
| 125 | Ga0105241_10318789 | 3300009174 | Bacteria | 1340 |
| 126 | Ga0105237_10053078 | 3300009545 | Bacteria | 4066 |
| 127 | Ga0105237_10117705 | 3300009545 | Bacteria | 2650 |
| 128 | Ga0105237_10168732 | 3300009545 | Bacteria | 2188 |
| 129 | Ga0105237_10289773 | 3300009545 | Bacteria | 1640 |
| 130 | Ga0105237_11043791 | 3300009545 | Bacteria | 824 |
| 131 | Ga0105238_10349255 | 3300009551 | Bacteria | 1468 |
| 132 | Ga0105238_10517482 | 3300009551 | Bacteria | 1196 |
| 133 | Ga0105239_10088717 | 3300010375 | Bacteria | 3410 |
| 134 | Ga0105239_10101560 | 3300010375 | Bacteria | 3182 |
| 135 | Ga0105239_10228164 | 3300010375 | Bacteria | 2089 |
| 136 | Ga0105239_10325840 | 3300010375 | Bacteria | 1733 |
| 137 | Ga0105246_10006526 | 3300011119 | Bacteria | 7122 |
| 138 | Ga0105246_10114529 | 3300011119 | Bacteria | 1987 |
| 139 | Ga0105246_10136335 | 3300011119 | Bacteria | 1840 |
| 140 | Ga0157370_10031235 | 3300013104 | Bacteria | 5212 |
| 141 | Ga0157370_10303380 | 3300013104 | Bacteria | 1474 |
| 142 | Ga0157369_10016172 | 3300013105 | Bacteria | 8398 |
| 143 | Ga0157369_10047280 | 3300013105 | Bacteria | 4673 |
| 144 | Ga0157369_10267371 | 3300013105 | Bacteria | 1783 |
| 145 | Ga0157369_10354879 | 3300013105 | Bacteria | 1523 |
| 146 | Ga0157374_10007199 | 3300013296 | Bacteria | 9475 |
| 147 | Ga0157374_10021300 | 3300013296 | Bacteria | 5766 |
| 148 | Ga0157374_10328196 | 3300013296 | Bacteria | 1517 |
| 149 | Ga0157378_10126165 | 3300013297 | Bacteria | 2364 |
| 150 | Ga0157378_10402826 | 3300013297 | Bacteria | 1348 |
| 151 | Ga0163162_10025470 | 3300013306 | Bacteria | 5845 |
| 152 | Ga0163162_10039746 | 3300013306 | Bacteria | 4702 |
| 153 | Ga0163162_10279493 | 3300013306 | Bacteria | 1801 |
| 154 | Ga0157372_10389211 | 3300013307 | Bacteria | 1624 |
| 155 | Ga0157372_10449992 | 3300013307 | Bacteria | 1501 |
| 156 | Ga0157375_10022464 | 3300013308 | Bacteria | 5806 |
| 157 | Ga0157375_10215594 | 3300013308 | Bacteria | 2077 |
| 158 | Ga0163163_10007524 | 3300014325 | Bacteria | 9616 |
| 159 | Ga0163163_10084192 | 3300014325 | Bacteria | 3186 |
| 160 | Ga0157376_10004438 | 3300014969 | Bacteria | 9773 |
| 161 | Ga0157376_10145245 | 3300014969 | Bacteria | 2133 |
| 162 | Ga0163161_10051367 | 3300017792 | Bacteria | 2986 |
| 163 | Ga0213876_10122996 | 3300021384 | Bacteria | 1378 |
| 164 | Ga0209677_102393 | 3300025253 | Bacteria | 7140 |
| 165 | Ga0209455_1013177 | 3300025272 | Bacteria | 1934 |
| 166 | Ga0209673_1036294 | 3300025273 | Bacteria | 1464 |
| 167 | Ga0209564_1002696 | 3300025295 | Bacteria | 13416 |
| 168 | Ga0209758_1000344 | 3300025297 | Bacteria | 85133 |
| 169 | Ga0209758_1000903 | 3300025297 | Bacteria | 40307 |
| 170 | Ga0209758_1047140 | 3300025297 | Bacteria | 1546 |
| 171 | Ga0209256_1016642 | 3300025299 | Bacteria | 2492 |
| 172 | Ga0207697_10055493 | 3300025315 | Bacteria | 1643 |
| 173 | Ga0207653_10082344 | 3300025885 | Bacteria | 1116 |
| 174 | Ga0207692_10005012 | 3300025898 | Bacteria | 5273 |
| 175 | Ga0207692_10014618 | 3300025898 | Bacteria | 3434 |
| 176 | Ga0207692_10135202 | 3300025898 | Bacteria | 1397 |
| 177 | Ga0207710_10095714 | 3300025900 | Bacteria | 1395 |
| 178 | Ga0207688_10027549 | 3300025901 | Bacteria | 3126 |
| 179 | Ga0207688_10039338 | 3300025901 | Bacteria | 2626 |
| 180 | Ga0207688_10177719 | 3300025901 | Bacteria | 1268 |
| 181 | Ga0207647_10027067 | 3300025904 | Bacteria | 3742 |
| 182 | Ga0207699_10009424 | 3300025906 | Bacteria | 4861 |
| 183 | Ga0207699_10072846 | 3300025906 | Bacteria | 2105 |
| 184 | Ga0207699_10101322 | 3300025906 | Bacteria | 1828 |
| 185 | Ga0207645_10059587 | 3300025907 | Bacteria | 2438 |
| 186 | Ga0207645_10141037 | 3300025907 | Bacteria | 1570 |
| 187 | Ga0207705_10346623 | 3300025909 | Bacteria | 1144 |
| 188 | Ga0207654_10003986 | 3300025911 | Bacteria | 7435 |
| 189 | Ga0207654_10269532 | 3300025911 | Bacteria | 1148 |
| 190 | Ga0207707_10004597 | 3300025912 | Bacteria | 12121 |
| 191 | Ga0207707_10038675 | 3300025912 | Bacteria | 4169 |
| 192 | Ga0207695_10099471 | 3300025913 | Bacteria | 2906 |
| 193 | Ga0207695_10177171 | 3300025913 | Bacteria | 2054 |
| 194 | Ga0207695_10338930 | 3300025913 | Bacteria | 1391 |
| 195 | Ga0207671_10193821 | 3300025914 | Bacteria | 1585 |
| 196 | Ga0207671_10382193 | 3300025914 | Bacteria | 1119 |
| 197 | Ga0207693_10049103 | 3300025915 | Bacteria | 3313 |
| 198 | Ga0207693_10077073 | 3300025915 | Bacteria | 2611 |
| 199 | Ga0207663_10020332 | 3300025916 | Bacteria | 3757 |
| 200 | Ga0207660_10058097 | 3300025917 | Bacteria | 2772 |
| 201 | Ga0207660_10128339 | 3300025917 | Bacteria | 1928 |
| 202 | Ga0207660_10461130 | 3300025917 | Bacteria | 1028 |
| 203 | Ga0207652_10007612 | 3300025921 | Bacteria | 8718 |
| 204 | Ga0207652_10477590 | 3300025921 | Bacteria | 1123 |
| 205 | Ga0207681_10095627 | 3300025923 | Bacteria | 2131 |
| 206 | Ga0207694_10069430 | 3300025924 | Bacteria | 2752 |
| 207 | Ga0207659_10207274 | 3300025926 | Bacteria | 1569 |
| 208 | Ga0207687_10025558 | 3300025927 | Bacteria | 3952 |
| 209 | Ga0207687_10216951 | 3300025927 | Bacteria | 1504 |
| 210 | Ga0207700_10030218 | 3300025928 | Bacteria | 3834 |
| 211 | Ga0207700_10031283 | 3300025928 | Bacteria | 3779 |
| 212 | Ga0207700_10108714 | 3300025928 | Bacteria | 2227 |
| 213 | Ga0207700_10470486 | 3300025928 | Bacteria | 1110 |
| 214 | Ga0207664_10239096 | 3300025929 | Bacteria | 1581 |
| 215 | Ga0207706_10056205 | 3300025933 | Bacteria | 3471 |
| 216 | Ga0207706_10089008 | 3300025933 | Bacteria | 2714 |
| 217 | Ga0207686_10060338 | 3300025934 | Bacteria | 2400 |
| 218 | Ga0207709_10021655 | 3300025935 | Bacteria | 3640 |
| 219 | Ga0207670_10323480 | 3300025936 | Bacteria | 1214 |
| 220 | Ga0207665_10028573 | 3300025939 | Bacteria | 3684 |
| 221 | Ga0207691_10036011 | 3300025940 | Bacteria | 4587 |
| 222 | Ga0207711_10051590 | 3300025941 | Bacteria | 3523 |
| 223 | Ga0207689_10014451 | 3300025942 | Bacteria | 6716 |
| 224 | Ga0207689_10125921 | 3300025942 | Bacteria | 2107 |
| 225 | Ga0207689_10179042 | 3300025942 | Bacteria | 1748 |
| 226 | Ga0207661_10002953 | 3300025944 | Bacteria | 11757 |
| 227 | Ga0207661_10017444 | 3300025944 | Bacteria | 5314 |
| 228 | Ga0207679_10030648 | 3300025945 | Bacteria | 3758 |
| 229 | Ga0207679_10090369 | 3300025945 | Bacteria | 2367 |
| 230 | Ga0207667_10400785 | 3300025949 | Bacteria | 1397 |
| 231 | Ga0207667_10657285 | 3300025949 | Bacteria | 1053 |
| 232 | Ga0207712_10321024 | 3300025961 | Bacteria | 1278 |
| 233 | Ga0207712_10434823 | 3300025961 | Bacteria | 1110 |
| 234 | Ga0207668_10010865 | 3300025972 | Bacteria | 5516 |
| 235 | Ga0207668_10030991 | 3300025972 | Bacteria | 3518 |
| 236 | Ga0207668_10157913 | 3300025972 | Bacteria | 1763 |
| 237 | Ga0207668_10268115 | 3300025972 | Bacteria | 1394 |
| 238 | Ga0207677_10321347 | 3300026023 | Bacteria | 1286 |
| 239 | Ga0207703_10344667 | 3300026035 | Bacteria | 1370 |
| 240 | Ga0207639_10138060 | 3300026041 | Bacteria | 2028 |
| 241 | Ga0207639_10319733 | 3300026041 | Bacteria | 1378 |
| 242 | Ga0207639_10666430 | 3300026041 | Bacteria | 963 |
| 243 | Ga0207678_10003472 | 3300026067 | Bacteria | 14191 |
| 244 | Ga0207678_10068008 | 3300026067 | Bacteria | 3057 |
| 245 | Ga0207678_10077553 | 3300026067 | Bacteria | 2846 |
| 246 | Ga0207678_10149884 | 3300026067 | Bacteria | 1991 |
| 247 | Ga0207708_10059862 | 3300026075 | Bacteria | 2907 |
| 248 | Ga0207702_10477171 | 3300026078 | Bacteria | 1213 |
| 249 | Ga0207702_10559703 | 3300026078 | Bacteria | 1119 |
| 250 | Ga0207702_10695437 | 3300026078 | Bacteria | 1002 |
| 251 | Ga0207641_10235857 | 3300026088 | Bacteria | 1702 |
| 252 | Ga0207648_10048143 | 3300026089 | Bacteria | 3733 |
| 253 | Ga0207648_10117006 | 3300026089 | Bacteria | 2343 |
| 254 | Ga0207676_10011441 | 3300026095 | Bacteria | 6342 |
| 255 | Ga0207674_10079911 | 3300026116 | Bacteria | 3273 |
| 256 | Ga0207674_10314745 | 3300026116 | Bacteria | 1514 |
| 257 | Ga0207674_10359564 | 3300026116 | Bacteria | 1407 |
| 258 | Ga0207675_100111738 | 3300026118 | Bacteria | 2578 |
| 259 | Ga0207675_100934028 | 3300026118 | Bacteria | 884 |
| 260 | Ga0207683_10022563 | 3300026121 | Bacteria | 5404 |
| 261 | Ga0207683_10046736 | 3300026121 | Bacteria | 3790 |
| 262 | Ga0207683_10101208 | 3300026121 | Bacteria | 2573 |
| 263 | Ga0207683_10282112 | 3300026121 | Bacteria | 1518 |
| 264 | Ga0207698_10066539 | 3300026142 | Bacteria | 2837 |
| 265 | Ga0207698_10121028 | 3300026142 | Bacteria | 2215 |
| 266 | Ga0207698_10158514 | 3300026142 | Bacteria | 1976 |
| 267 | Ga0207698_10732742 | 3300026142 | Bacteria | 986 |
| 268 | Ga0209179_1011233 | 3300027512 | Bacteria | 1581 |
| 269 | Ga0268266_10002572 | 3300028379 | Bacteria | 19242 |
| 270 | Ga0268266_10195150 | 3300028379 | Bacteria | 1850 |
| 271 | Ga0268265_10534334 | 3300028380 | Bacteria | 1110 |
| 272 | Ga0268264_10110307 | 3300028381 | Bacteria | 2409 |
| 273 | Ga0307515_10075181 | 3300028794 | Bacteria | 4505 |
| 274 | Ga0307511_10091980 | 3300030521 | Bacteria | 2049 |
| 275 | Ga0307511_10152124 | 3300030521 | Bacteria | 1325 |
| 276 | Ga0307508_10334222 | 3300031616 | Bacteria | 1106 |
| 277 | Ga0307516_10003967 | 3300031730 | Bacteria | 18582 |
| 278 | Ga0307411_10121359 | 3300032005 | Bacteria | 1892 |
| 279 | Ga0307507_10051491 | 3300033179 | Bacteria | 3962 |
| 280 | Ga0373944_0043662 | 3300035089 | Bacteria | 1394 |
| 281 | Ga0373953_0028328 | 3300035117 | Bacteria | 2159 |
| 282 | Ga0373953_0053292 | 3300035117 | Bacteria | 1639 |
| 283 | Ga0373954_0143745 | 3300035118 | Bacteria | 1164 |
| 284 | Ga0373957_0044174 | 3300035120 | Bacteria | 1685 |
| 285 | Ga0373943_0063377 | 3300035170 | Bacteria | 1853 |
| 286 | Ga0373943_0065661 | 3300035170 | Bacteria | 1825 |
| 287 | Ga0373955_0043381 | 3300035172 | Bacteria | 2419 |
| 288 | Ga0373935_0096142 | 3300035692 | Bacteria | 1946 |
| 289 | Ga0373935_0158079 | 3300035692 | Bacteria | 1543 |
| 290 | Ga0373927_0053987 | 3300035695 | Bacteria | 2599 |
| 291 | Ga0373927_0345049 | 3300035695 | Bacteria | 981 |
| 292 | Ga0373933_0072653 | 3300035724 | Bacteria | 2095 |
| 293 | Ga0373933_0085124 | 3300035724 | Bacteria | 1944 |
| 294 | Ga0373947_0078468 | 3300035725 | Bacteria | 2038 |
| 295 | Ga0373925_0089046 | 3300037068 | Bacteria | 2357 |
| 296 | Ga0373925_0737087 | 3300037068 | Bacteria | 812 |
| 297 | Ga0395900_0144447 | 3300037418 | Bacteria | 2434 |
| 298 | Ga0395900_0430804 | 3300037418 | Bacteria | 1278 |
| 299 | Ga0395898_0061962 | 3300037466 | Bacteria | 3634 |
| 300 | Ga0395898_0110483 | 3300037466 | Bacteria | 2635 |
| 301 | Ga0395905_0391002 | 3300037471 | Bacteria | 1285 |
| 302 | Ga0436364_0819459 | 3300037853 | Bacteria | 2481 |
| 303 | Ga0395901_0280812 | 3300038443 | Bacteria | 1730 |
| 304 | Ga0436365_0307257 | 3300039437 | Bacteria | 1066 |
| 305 | Ga0436365_0322079 | 3300039437 | Bacteria | 2069 |
| 306 | Ga0436365_0386501 | 3300039437 | Bacteria | 1603 |
| 307 | Ga0436365_1476851 | 3300039437 | Bacteria | 2337 |
| 308 | Ga0466966_0251201 | 3300044684 | Bacteria | 1065 |
| 309 | Ga0466964_0015910 | 3300044706 | Bacteria | 2866 |
| 310 | Ga0466957_0067477 | 3300044842 | Bacteria | 2207 |
| 311 | Ga0466967_0185436 | 3300045976 | Bacteria | 1965 |
| 312 | Ga0466967_0205963 | 3300045976 | Bacteria | 1864 |
| 313 | Ga0495617_111194 | 3300046452 | Bacteria | 886 |
| 314 | Ga0495592_0094256 | 3300046454 | Bacteria | 2143 |
| 315 | Ga0495603_0036150 | 3300046455 | Bacteria | 2965 |
| 316 | Ga0495629_0077186 | 3300046459 | Bacteria | 2325 |
| 317 | Ga0495638_0085725 | 3300046460 | Bacteria | 1904 |
| 318 | Ga0495638_0303857 | 3300046460 | Bacteria | 858 |
| 319 | Ga0495651_0078144 | 3300046462 | Bacteria | 2503 |
| 320 | Ga0495653_0123959 | 3300046463 | Bacteria | 1837 |
| 321 | Ga0495580_0067166 | 3300046472 | Bacteria | 2509 |
| 322 | Ga0495580_0195897 | 3300046472 | Bacteria | 1393 |
| 323 | Ga0495582_0226958 | 3300046473 | Bacteria | 1069 |
| 324 | Ga0495639_0062634 | 3300046475 | Bacteria | 1706 |
| 325 | Ga0495664_0020079 | 3300046477 | Bacteria | 3849 |
| 326 | Ga0495584_0085821 | 3300046491 | Bacteria | 1586 |
| 327 | Ga0495585_0045567 | 3300046492 | Bacteria | 2447 |
| 328 | Ga0495585_0057859 | 3300046492 | Bacteria | 2139 |
| 329 | Ga0495585_0179308 | 3300046492 | Bacteria | 1090 |
| 330 | Ga0495594_0068385 | 3300046499 | Bacteria | 1973 |
| 331 | Ga0495607_0201123 | 3300046501 | Bacteria | 986 |
| 332 | Ga0495616_0150494 | 3300046513 | Bacteria | 1053 |
| 333 | Ga0495618_0028066 | 3300046514 | Bacteria | 3507 |
| 334 | Ga0495618_0142079 | 3300046514 | Bacteria | 1535 |
| 335 | Ga0495628_0115008 | 3300046516 | Bacteria | 2066 |
| 336 | Ga0495630_0136812 | 3300046517 | Bacteria | 1861 |
| 337 | Ga0495630_0245800 | 3300046517 | Bacteria | 1367 |
| 338 | Ga0495632_0092402 | 3300046519 | Bacteria | 1433 |
| 339 | Ga0495652_0107270 | 3300046529 | Bacteria | 2253 |
| 340 | Ga0495652_0278139 | 3300046529 | Bacteria | 1227 |
| 341 | Ga0495665_0114325 | 3300046531 | Bacteria | 1414 |
| 342 | Ga0495640_0067602 | 3300046533 | Bacteria | 2406 |
| 343 | Ga0495640_0340791 | 3300046533 | Bacteria | 926 |
| 344 | Ga0495587_0054034 | 3300046536 | Bacteria | 2367 |
| 345 | Ga0495598_0006756 | 3300046537 | Bacteria | 2602 |
| 346 | Ga0495645_0001274 | 3300046543 | Bacteria | 17169 |
| 347 | Ga0495645_0023733 | 3300046543 | Bacteria | 4444 |
| 348 | Ga0495667_0173186 | 3300046559 | Bacteria | 1386 |
| 349 | Ga0495656_0103100 | 3300046615 | Bacteria | 1322 |
| 350 | Ga0495668_0033297 | 3300046616 | Bacteria | 2896 |
| 351 | Ga0495634_0036105 | 3300046642 | Bacteria | 3381 |
| 352 | Ga0495634_0350942 | 3300046642 | Bacteria | 883 |
| 353 | Ga0495635_0075709 | 3300046663 | Bacteria | 2306 |
| 354 | Ga0495659_0022420 | 3300046664 | Bacteria | 2137 |
| 355 | Ga0495657_0060651 | 3300046675 | Bacteria | 2505 |
| 356 | Ga0495599_0038423 | 3300046678 | Bacteria | 3008 |
| 357 | Ga0495623_0276356 | 3300046679 | Bacteria | 936 |
| 358 | Ga0495646_0065296 | 3300046680 | Bacteria | 2155 |
| 359 | Ga0495646_0096640 | 3300046680 | Bacteria | 1698 |
| 360 | Ga0495658_0148364 | 3300046683 | Bacteria | 1439 |
| 361 | Ga0495658_0206613 | 3300046683 | Bacteria | 1226 |
| 362 | Ga0495658_0229371 | 3300046683 | Bacteria | 1164 |
| 363 | Ga0495624_0051282 | 3300046690 | Bacteria | 2612 |
| 364 | Ga0495670_0054823 | 3300046691 | Bacteria | 1998 |
| 365 | Ga0495589_0188519 | 3300046794 | Bacteria | 976 |
| 366 | Ga0495600_0059009 | 3300046809 | Bacteria | 2506 |
| 367 | Ga0495674_0038132 | 3300047319 | Bacteria | 4315 |
| 368 | Ga0495674_0598817 | 3300047319 | Bacteria | 873 |
| 369 | Ga0495680_0048580 | 3300047322 | Bacteria | 3331 |
| 370 | Ga0495680_0433762 | 3300047322 | Bacteria | 902 |
| 371 | Ga0495675_0107764 | 3300047444 | Bacteria | 1740 |
| 372 | Ga0495684_0136518 | 3300047471 | Bacteria | 1840 |
| 373 | Ga0495593_0013126 | 3300047673 | Bacteria | 4730 |
| 374 | Ga0495602_0028167 | 3300048088 | Bacteria | 5381 |
| 375 | Ga0496100_0019580 | 3300048903 | Bacteria | 4041 |
| 376 | Ga0496100_0344624 | 3300048903 | Bacteria | 1124 |
| 377 | Ga0496100_0453652 | 3300048903 | Bacteria | 983 |
| 378 | Ga0496102_0009105 | 3300048905 | Bacteria | 8521 |
| 379 | Ga0496102_0033820 | 3300048905 | Bacteria | 4596 |
| 380 | Ga0496102_0157264 | 3300048905 | Bacteria | 2137 |
| 381 | Ga0496103_0085439 | 3300048906 | Bacteria | 1988 |
| 382 | Ga0496104_0009104 | 3300048907 | Bacteria | 8832 |
| 383 | Ga0496104_0713798 | 3300048907 | Bacteria | 910 |
| 384 | Ga0496105_0033056 | 3300048908 | Bacteria | 4246 |
| 385 | Ga0496106_0010522 | 3300048909 | Bacteria | 6833 |
| 386 | Ga0496106_0010776 | 3300048909 | Bacteria | 6755 |
| 387 | Ga0496106_0015830 | 3300048909 | Bacteria | 5578 |
| 388 | Ga0496106_0064750 | 3300048909 | Bacteria | 2782 |
| 389 | Ga0496106_0362157 | 3300048909 | Bacteria | 1165 |
| 390 | Ga0496107_0004840 | 3300048910 | Bacteria | 9144 |
| 391 | Ga0496107_0038067 | 3300048910 | Bacteria | 3452 |
| 392 | Ga0496107_0348436 | 3300048910 | Bacteria | 1102 |
| 393 | Ga0496108_0000392 | 3300048911 | Bacteria | 36249 |
| 394 | Ga0496108_0033055 | 3300048911 | Bacteria | 4298 |
| 395 | Ga0496108_0173613 | 3300048911 | Bacteria | 1865 |
| 396 | Ga0496109_0000509 | 3300048912 | Bacteria | 33001 |
| 397 | Ga0496109_0021973 | 3300048912 | Bacteria | 5648 |
| 398 | Ga0496110_0002823 | 3300048913 | Bacteria | 13112 |
| 399 | Ga0496110_0024278 | 3300048913 | Bacteria | 5165 |
| 400 | Ga0496110_0164285 | 3300048913 | Bacteria | 2013 |
| 401 | Ga0496111_0022655 | 3300048914 | Bacteria | 4400 |
| 402 | Ga0496112_0001604 | 3300048915 | Bacteria | 17489 |
| 403 | Ga0496112_0022947 | 3300048915 | Bacteria | 5955 |
| 404 | Ga0496112_0120193 | 3300048915 | Bacteria | 2597 |
| 405 | Ga0496112_0149898 | 3300048915 | Bacteria | 2299 |
| 406 | Ga0496113_0057085 | 3300048916 | Bacteria | 2932 |
| 407 | Ga0496113_0088782 | 3300048916 | Bacteria | 2378 |
| 408 | Ga0496114_0037785 | 3300048917 | Bacteria | 3994 |
| 409 | Ga0496114_0143888 | 3300048917 | Bacteria | 2066 |
| 410 | Ga0496114_0184522 | 3300048917 | Bacteria | 1823 |
| 411 | Ga0496115_0056345 | 3300048918 | Bacteria | 3159 |
| 412 | Ga0496117_0009803 | 3300048920 | Bacteria | 8831 |
| 413 | Ga0496117_0047849 | 3300048920 | Bacteria | 3062 |
| 414 | Ga0496118_0004079 | 3300048921 | Bacteria | 17718 |
| 415 | Ga0496118_0018456 | 3300048921 | Bacteria | 6294 |
| 416 | Ga0496121_0003552 | 3300048924 | Bacteria | 22075 |
| 417 | Ga0496121_0038816 | 3300048924 | Bacteria | 4208 |
| 418 | Ga0496121_0150823 | 3300048924 | Bacteria | 1711 |
| 419 | Ga0496121_0175073 | 3300048924 | Bacteria | 1554 |
| 420 | Ga0496122_0017207 | 3300048925 | Bacteria | 6776 |
| 421 | Ga0496123_0022865 | 3300048926 | Bacteria | 4803 |
| 422 | Ga0496124_0002443 | 3300048927 | Bacteria | 24353 |
| 423 | Ga0496125_0054251 | 3300048928 | Bacteria | 3278 |
| 424 | Ga0496125_0350524 | 3300048928 | Bacteria | 882 |
| 425 | Ga0496126_0004189 | 3300048929 | Bacteria | 17378 |
| 426 | Ga0496126_0030836 | 3300048929 | Bacteria | 5075 |
| 427 | Ga0496126_0127895 | 3300048929 | Bacteria | 2197 |
| 428 | Ga0496126_0196569 | 3300048929 | Bacteria | 1705 |
| 429 | Ga0501043_0289831 | 3300049579 | Bacteria | 1253 |
| 430 | Ga0501046_0419835 | 3300049580 | Bacteria | 964 |
| 431 | Ga0501047_0156403 | 3300049581 | Bacteria | 2153 |
| 432 | Ga0501070_0092604 | 3300049586 | Bacteria | 2501 |
| 433 | Ga0501073_0088663 | 3300049589 | Bacteria | 2151 |
| 434 | Ga0501074_0224799 | 3300049590 | Bacteria | 1336 |
| 435 | Ga0501080_0032454 | 3300049742 | Bacteria | 4871 |
| 436 | Ga0501035_0626307 | 3300049822 | Bacteria | 874 |
| 437 | Ga0501044_0181780 | 3300049823 | Bacteria | 2069 |
| 438 | nmdc:mga03n38_448_c1 | 3300050490 | Bacteria | 10279 |
| 439 | nmdc:mga06z11_22234_c1 | 3300050494 | Bacteria | 2959 |
| 440 | nmdc:mga06z11_71132_c1 | 3300050494 | Bacteria | 1841 |
| 441 | nmdc:mga07m45_253951_c1 | 3300050496 | Bacteria | 1023 |
| 442 | nmdc:mga07m45_36235_c1 | 3300050496 | Bacteria | 2747 |
| 443 | nmdc:mga07m45_80104_c1 | 3300050496 | Bacteria | 1865 |
| 444 | nmdc:mga08y16_205945_c1 | 3300050511 | Bacteria | 2038 |
| 445 | nmdc:mga0rr50_113206_c1 | 3300050513 | Bacteria | 2150 |
| 446 | Ga0495601_0081104 | 3300053077 | Bacteria | 2082 |
| 447 | Ga0495612_0052841 | 3300053078 | Bacteria | 1672 |
| 448 | Ga0495612_0137972 | 3300053078 | Bacteria | 1056 |
| 449 | Ga0500635_0001844 | 3300053080 | Bacteria | 5177 |
| 450 | Ga0500635_0024536 | 3300053080 | Bacteria | 1892 |
| 451 | Ga0500566_0005672 | 3300053094 | Bacteria | 7420 |
| 452 | Ga0500566_0065901 | 3300053094 | Bacteria | 2042 |
| 453 | Ga0500640_000168 | 3300053095 | Bacteria | 13302 |
| 454 | Ga0500572_028802 | 3300053111 | Bacteria | 1531 |
| 455 | Ga0500591_032578 | 3300053115 | Bacteria | 2509 |
| 456 | Ga0500595_043822 | 3300053119 | Bacteria | 1422 |
| 457 | Ga0500608_078351 | 3300053122 | Bacteria | 1563 |
| 458 | Ga0500614_014938 | 3300053123 | Bacteria | 1726 |
| 459 | Ga0500642_0121538 | 3300053130 | Bacteria | 1222 |
| 460 | Ga0500559_0013716 | 3300053136 | Bacteria | 3427 |
| 461 | Ga0500568_0006530 | 3300053139 | Bacteria | 5843 |
| 462 | Ga0500573_0138422 | 3300053140 | Bacteria | 1342 |
| 463 | Ga0500577_0170588 | 3300053142 | Bacteria | 930 |
| 464 | Ga0500590_081771 | 3300053148 | Bacteria | 1585 |
| 465 | Ga0500590_121511 | 3300053148 | Bacteria | 1223 |
| 466 | Ga0500590_139346 | 3300053148 | Bacteria | 1111 |
| 467 | Ga0500603_013725 | 3300053150 | Bacteria | 1882 |
| 468 | Ga0500603_038176 | 3300053150 | Bacteria | 1270 |
| 469 | Ga0500638_081804 | 3300053162 | Bacteria | 1532 |
| 470 | Ga0500639_000125 | 3300053163 | Bacteria | 36885 |
| 471 | Ga0500639_058918 | 3300053163 | Bacteria | 1983 |
| 472 | Ga0500636_0007829 | 3300053177 | Bacteria | 6179 |
| 473 | Ga0500552_001226 | 3300053733 | Bacteria | 2432 |
| 474 | Ga0500601_004601 | 3300053737 | Bacteria | 1505 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037068 | Ga0373925_0737087 | Ga0373925_0737087_22_711 | 224 |
| 2 | 3300046794 | Ga0495589_0188519 | Ga0495589_0188519_282_962 | 224 |
| 3 | iso_pu_bacteria | 2513237101 | 2513698857 | 224 |
| 4 | 3300025927 | Ga0207687_10216951 | Ga0207687_102169512 | 235 |
| 5 | 3300026142 | Ga0207698_10066539 | Ga0207698_100665392 | 235 |
| 6 | 3300005616 | Ga0068852_100676606 | Ga0068852_1006766062 | 237 |
| 7 | 3300009545 | Ga0105237_10168732 | Ga0105237_101687323 | 237 |
| 8 | 3300013296 | Ga0157374_10021300 | Ga0157374_100213004 | 237 |
| 9 | 3300048909 | Ga0496106_0362157 | Ga0496106_0362157_413_1132 | 237 |
| 10 | 3300050494 | nmdc:mga06z11_22234_c1 | nmdc:mga06z11_22234_c1_1811_2539 | 237 |
| 11 | 3300050496 | nmdc:mga07m45_253951_c1 | nmdc:mga07m45_253951_c1_181_909 | 237 |
| 12 | iso_pu_bacteria | 2513237098 | 2513677189 | 239 |
| 13 | iso_pu_bacteria | 2513237141 | 2513887891 | 239 |
| 14 | iso_pu_bacteria | 2517093001 | 2517104501 | 239 |
| 15 | iso_pu_bacteria | 2524023210 | 2524466327 | 239 |
| 16 | iso_pu_bacteria | 2721755755 | 2723842657 | 239 |
| 17 | iso_pu_bacteria | 2728368998 | 2728749060 | 239 |
| 18 | iso_pu_bacteria | 2791355199 | 2793080472 | 239 |
| 19 | iso_pu_bacteria | 2874604998 | 2874606668 | 239 |
| 20 | iso_pu_bacteria | 2874620515 | 2874625173 | 239 |
| 21 | iso_pu_bacteria | 2876808645 | 2876808733 | 239 |
| 22 | iso_pu_bacteria | 2879110137 | 2879111997 | 239 |
| 23 | iso_pu_bacteria | 2889033259 | 2889034047 | 239 |
| 24 | iso_pu_bacteria | 2903768456 | 2903772519 | 239 |
| 25 | iso_pu_bacteria | 2904666416 | 2904668727 | 239 |
| 26 | iso_pu_bacteria | 2904690495 | 2904697645 | 239 |
| 27 | iso_pu_bacteria | 2908756301 | 2908757752 | 239 |
| 28 | iso_pu_bacteria | 2922361189 | 2922367448 | 239 |
| 29 | iso_pu_bacteria | 2922386360 | 2922389856 | 239 |
| 30 | iso_pu_bacteria | 3005474847 | 3005476255 | 239 |
| 31 | iso_pu_bacteria | 8006964411 | 8006965964 | 239 |
| 32 | iso_pu_bacteria | 8006984368 | 8006989908 | 239 |
| 33 | iso_pu_bacteria | 8006994254 | 8006998264 | 239 |
| 34 | iso_pu_bacteria | 8056673599 | 8056677887 | 239 |
| 35 | iso_pu_bacteria | 8056681323 | 8056686057 | 239 |
| 36 | iso_pu_bacteria | 8056689827 | 8056695360 | 239 |
| 37 | 3300005329 | Ga0070683_100125746 | Ga0070683_1001257463 | 241 |
| 38 | 3300005334 | Ga0068869_100103714 | Ga0068869_1001037143 | 241 |
| 39 | 3300005337 | Ga0070682_100116743 | Ga0070682_1001167432 | 241 |
| 40 | 3300005455 | Ga0070663_100009946 | Ga0070663_1000099462 | 241 |
| 41 | 3300005456 | Ga0070678_100014130 | Ga0070678_1000141305 | 241 |
| 42 | 3300005616 | Ga0068852_100219604 | Ga0068852_1002196042 | 241 |
| 43 | 3300005618 | Ga0068864_100030394 | Ga0068864_1000303944 | 241 |
| 44 | 3300006237 | Ga0097621_100054611 | Ga0097621_1000546113 | 241 |
| 45 | 3300006358 | Ga0068871_100132069 | Ga0068871_1001320693 | 241 |
| 46 | 3300010375 | Ga0105239_10101560 | Ga0105239_101015603 | 241 |
| 47 | 3300011119 | Ga0105246_10006526 | Ga0105246_100065266 | 241 |
| 48 | 3300013296 | Ga0157374_10007199 | Ga0157374_100071993 | 241 |
| 49 | 3300013297 | Ga0157378_10126165 | Ga0157378_101261653 | 241 |
| 50 | 3300013306 | Ga0163162_10025470 | Ga0163162_100254702 | 241 |
| 51 | 3300013308 | Ga0157375_10022464 | Ga0157375_100224646 | 241 |
| 52 | 3300014325 | Ga0163163_10007524 | Ga0163163_1000752410 | 241 |
| 53 | 3300014969 | Ga0157376_10004438 | Ga0157376_100044383 | 241 |
| 54 | 3300025901 | Ga0207688_10027549 | Ga0207688_100275492 | 241 |
| 55 | 3300025909 | Ga0207705_10346623 | Ga0207705_103466232 | 241 |
| 56 | 3300026067 | Ga0207678_10003472 | Ga0207678_1000347214 | 241 |
| 57 | 3300026118 | Ga0207675_100934028 | Ga0207675_1009340281 | 241 |
| 58 | 3300026121 | Ga0207683_10022563 | Ga0207683_100225635 | 241 |
| 59 | 3300048903 | Ga0496100_0019580 | Ga0496100_0019580_2254_3018 | 241 |
| 60 | 3300048905 | Ga0496102_0009105 | Ga0496102_0009105_5402_6166 | 241 |
| 61 | 3300048906 | Ga0496103_0085439 | Ga0496103_0085439_966_1730 | 241 |
| 62 | 3300048907 | Ga0496104_0009104 | Ga0496104_0009104_4370_5134 | 241 |
| 63 | 3300048908 | Ga0496105_0033056 | Ga0496105_0033056_2400_3164 | 241 |
| 64 | 3300048909 | Ga0496106_0010522 | Ga0496106_0010522_2761_3525 | 241 |
| 65 | 3300048910 | Ga0496107_0004840 | Ga0496107_0004840_1061_1825 | 241 |
| 66 | 3300048911 | Ga0496108_0033055 | Ga0496108_0033055_904_1668 | 241 |
| 67 | 3300048912 | Ga0496109_0021973 | Ga0496109_0021973_3831_4595 | 241 |
| 68 | 3300048913 | Ga0496110_0024278 | Ga0496110_0024278_845_1609 | 241 |
| 69 | 3300048914 | Ga0496111_0022655 | Ga0496111_0022655_2623_3387 | 241 |
| 70 | 3300048915 | Ga0496112_0149898 | Ga0496112_0149898_979_1743 | 241 |
| 71 | 3300048917 | Ga0496114_0037785 | Ga0496114_0037785_1287_2051 | 241 |
| 72 | 3300005441 | Ga0070700_100154288 | Ga0070700_1001542882 | 242 |
| 73 | 3300003215 | JGI25153J46596_10000371 | JGI25153J46596_1000037122 | 243 |
| 74 | 3300005328 | Ga0070676_10070124 | Ga0070676_100701242 | 243 |
| 75 | 3300005328 | Ga0070676_10216912 | Ga0070676_102169121 | 243 |
| 76 | 3300005329 | Ga0070683_100003434 | Ga0070683_1000034343 | 243 |
| 77 | 3300005331 | Ga0070670_100203033 | Ga0070670_1002030331 | 243 |
| 78 | 3300005336 | Ga0070680_100179591 | Ga0070680_1001795912 | 243 |
| 79 | 3300005336 | Ga0070680_100353003 | Ga0070680_1003530032 | 243 |
| 80 | 3300005337 | Ga0070682_100030922 | Ga0070682_1000309224 | 243 |
| 81 | 3300005338 | Ga0068868_100085990 | Ga0068868_1000859903 | 243 |
| 82 | 3300005339 | Ga0070660_100333375 | Ga0070660_1003333752 | 243 |
| 83 | 3300005340 | Ga0070689_100233874 | Ga0070689_1002338742 | 243 |
| 84 | 3300005341 | Ga0070691_10079547 | Ga0070691_100795472 | 243 |
| 85 | 3300005347 | Ga0070668_100027647 | Ga0070668_1000276475 | 243 |
| 86 | 3300005347 | Ga0070668_100044624 | Ga0070668_1000446243 | 243 |
| 87 | 3300005347 | Ga0070668_100379986 | Ga0070668_1003799861 | 243 |
| 88 | 3300005353 | Ga0070669_100314843 | Ga0070669_1003148432 | 243 |
| 89 | 3300005356 | Ga0070674_100119052 | Ga0070674_1001190523 | 243 |
| 90 | 3300005365 | Ga0070688_100164938 | Ga0070688_1001649382 | 243 |
| 91 | 3300005367 | Ga0070667_100220150 | Ga0070667_1002201502 | 243 |
| 92 | 3300005434 | Ga0070709_10086101 | Ga0070709_100861012 | 243 |
| 93 | 3300005434 | Ga0070709_10115621 | Ga0070709_101156213 | 243 |
| 94 | 3300005435 | Ga0070714_100044149 | Ga0070714_1000441494 | 243 |
| 95 | 3300005435 | Ga0070714_100248501 | Ga0070714_1002485012 | 243 |
| 96 | 3300005436 | Ga0070713_100005334 | Ga0070713_1000053343 | 243 |
| 97 | 3300005436 | Ga0070713_100028331 | Ga0070713_1000283313 | 243 |
| 98 | 3300005436 | Ga0070713_100544532 | Ga0070713_1005445321 | 243 |
| 99 | 3300005437 | Ga0070710_10010883 | Ga0070710_100108833 | 243 |
| 100 | 3300005438 | Ga0070701_10204181 | Ga0070701_102041811 | 243 |
| 101 | 3300005439 | Ga0070711_100006314 | Ga0070711_1000063143 | 243 |
| 102 | 3300005439 | Ga0070711_100027834 | Ga0070711_1000278341 | 243 |
| 103 | 3300005439 | Ga0070711_100186816 | Ga0070711_1001868162 | 243 |
| 104 | 3300005455 | Ga0070663_100041847 | Ga0070663_1000418474 | 243 |
| 105 | 3300005455 | Ga0070663_100189560 | Ga0070663_1001895602 | 243 |
| 106 | 3300005455 | Ga0070663_100242256 | Ga0070663_1002422562 | 243 |
| 107 | 3300005456 | Ga0070678_100067232 | Ga0070678_1000672322 | 243 |
| 108 | 3300005456 | Ga0070678_100340869 | Ga0070678_1003408691 | 243 |
| 109 | 3300005457 | Ga0070662_100038959 | Ga0070662_1000389594 | 243 |
| 110 | 3300005457 | Ga0070662_100150407 | Ga0070662_1001504072 | 243 |
| 111 | 3300005457 | Ga0070662_100239147 | Ga0070662_1002391471 | 243 |
| 112 | 3300005458 | Ga0070681_10036493 | Ga0070681_100364933 | 243 |
| 113 | 3300005458 | Ga0070681_10036669 | Ga0070681_100366694 | 243 |
| 114 | 3300005458 | Ga0070681_10063863 | Ga0070681_100638633 | 243 |
| 115 | 3300005458 | Ga0070681_10066319 | Ga0070681_100663191 | 243 |
| 116 | 3300005459 | Ga0068867_100118992 | Ga0068867_1001189922 | 243 |
| 117 | 3300005466 | Ga0070685_10091281 | Ga0070685_100912813 | 243 |
| 118 | 3300005468 | Ga0070707_100287136 | Ga0070707_1002871361 | 243 |
| 119 | 3300005471 | Ga0070698_100197354 | Ga0070698_1001973543 | 243 |
| 120 | 3300005530 | Ga0070679_100020155 | Ga0070679_1000201553 | 243 |
| 121 | 3300005530 | Ga0070679_100044206 | Ga0070679_1000442063 | 243 |
| 122 | 3300005530 | Ga0070679_100200146 | Ga0070679_1002001463 | 243 |
| 123 | 3300005535 | Ga0070684_100010514 | Ga0070684_1000105148 | 243 |
| 124 | 3300005535 | Ga0070684_100010579 | Ga0070684_1000105798 | 243 |
| 125 | 3300005536 | Ga0070697_100271391 | Ga0070697_1002713912 | 243 |
| 126 | 3300005536 | Ga0070697_100407254 | Ga0070697_1004072541 | 243 |
| 127 | 3300005539 | Ga0068853_100385356 | Ga0068853_1003853562 | 243 |
| 128 | 3300005543 | Ga0070672_100213802 | Ga0070672_1002138022 | 243 |
| 129 | 3300005546 | Ga0070696_100340016 | Ga0070696_1003400162 | 243 |
| 130 | 3300005548 | Ga0070665_100082915 | Ga0070665_1000829153 | 243 |
| 131 | 3300005548 | Ga0070665_100298902 | Ga0070665_1002989022 | 243 |
| 132 | 3300005563 | Ga0068855_100117899 | Ga0068855_1001178992 | 243 |
| 133 | 3300005563 | Ga0068855_100244621 | Ga0068855_1002446214 | 243 |
| 134 | 3300005563 | Ga0068855_100353404 | Ga0068855_1003534042 | 243 |
| 135 | 3300005564 | Ga0070664_100158597 | Ga0070664_1001585973 | 243 |
| 136 | 3300005564 | Ga0070664_100482562 | Ga0070664_1004825622 | 243 |
| 137 | 3300005577 | Ga0068857_100131062 | Ga0068857_1001310622 | 243 |
| 138 | 3300005577 | Ga0068857_100300780 | Ga0068857_1003007802 | 243 |
| 139 | 3300005616 | Ga0068852_100112957 | Ga0068852_1001129573 | 243 |
| 140 | 3300005616 | Ga0068852_100324664 | Ga0068852_1003246642 | 243 |
| 141 | 3300005719 | Ga0068861_100089955 | Ga0068861_1000899553 | 243 |
| 142 | 3300005719 | Ga0068861_100127997 | Ga0068861_1001279972 | 243 |
| 143 | 3300005841 | Ga0068863_100225733 | Ga0068863_1002257332 | 243 |
| 144 | 3300005842 | Ga0068858_100021643 | Ga0068858_1000216437 | 243 |
| 145 | 3300005843 | Ga0068860_100200531 | Ga0068860_1002005313 | 243 |
| 146 | 3300005843 | Ga0068860_100380379 | Ga0068860_1003803792 | 243 |
| 147 | 3300005844 | Ga0068862_100172610 | Ga0068862_1001726102 | 243 |
| 148 | 3300005844 | Ga0068862_100243072 | Ga0068862_1002430721 | 243 |
| 149 | 3300005937 | Ga0081455_10001281 | Ga0081455_1000128131 | 243 |
| 150 | 3300005937 | Ga0081455_10038108 | Ga0081455_100381084 | 243 |
| 151 | 3300005981 | Ga0081538_10085961 | Ga0081538_100859612 | 243 |
| 152 | 3300005983 | Ga0081540_1008353 | Ga0081540_10083533 | 243 |
| 153 | 3300005983 | Ga0081540_1020858 | Ga0081540_10208584 | 243 |
| 154 | 3300005983 | Ga0081540_1089061 | Ga0081540_10890612 | 243 |
| 155 | 3300005985 | Ga0081539_10001606 | Ga0081539_100016062 | 243 |
| 156 | 3300005985 | Ga0081539_10033579 | Ga0081539_100335792 | 243 |
| 157 | 3300006028 | Ga0070717_10025976 | Ga0070717_100259766 | 243 |
| 158 | 3300006038 | Ga0075365_10079992 | Ga0075365_100799923 | 243 |
| 159 | 3300006038 | Ga0075365_10104682 | Ga0075365_101046822 | 243 |
| 160 | 3300006038 | Ga0075365_10300075 | Ga0075365_103000752 | 243 |
| 161 | 3300006048 | Ga0075363_100092193 | Ga0075363_1000921932 | 243 |
| 162 | 3300006051 | Ga0075364_10134586 | Ga0075364_101345863 | 243 |
| 163 | 3300006058 | Ga0075432_10043244 | Ga0075432_100432442 | 243 |
| 164 | 3300006173 | Ga0070716_100055960 | Ga0070716_1000559603 | 243 |
| 165 | 3300006175 | Ga0070712_100036260 | Ga0070712_1000362603 | 243 |
| 166 | 3300006177 | Ga0075362_10025287 | Ga0075362_100252876 | 243 |
| 167 | 3300006178 | Ga0075367_10017544 | Ga0075367_100175443 | 243 |
| 168 | 3300006178 | Ga0075367_10075768 | Ga0075367_100757682 | 243 |
| 169 | 3300006237 | Ga0097621_100529196 | Ga0097621_1005291962 | 243 |
| 170 | 3300006353 | Ga0075370_10074220 | Ga0075370_100742202 | 243 |
| 171 | 3300006353 | Ga0075370_10289413 | Ga0075370_102894132 | 243 |
| 172 | 3300006358 | Ga0068871_100238078 | Ga0068871_1002380781 | 243 |
| 173 | 3300006871 | Ga0075434_100292971 | Ga0075434_1002929712 | 243 |
| 174 | 3300006881 | Ga0068865_100043769 | Ga0068865_1000437694 | 243 |
| 175 | 3300006914 | Ga0075436_100416412 | Ga0075436_1004164121 | 243 |
| 176 | 3300007788 | Ga0099795_10031402 | Ga0099795_100314022 | 243 |
| 177 | 3300009092 | Ga0105250_10165453 | Ga0105250_101654531 | 243 |
| 178 | 3300009093 | Ga0105240_10113119 | Ga0105240_101131192 | 243 |
| 179 | 3300009093 | Ga0105240_10223865 | Ga0105240_102238653 | 243 |
| 180 | 3300009094 | Ga0111539_10216329 | Ga0111539_102163292 | 243 |
| 181 | 3300009101 | Ga0105247_10168258 | Ga0105247_101682582 | 243 |
| 182 | 3300009148 | Ga0105243_10062938 | Ga0105243_100629383 | 243 |
| 183 | 3300009148 | Ga0105243_10106362 | Ga0105243_101063622 | 243 |
| 184 | 3300009174 | Ga0105241_10040357 | Ga0105241_100403572 | 243 |
| 185 | 3300009174 | Ga0105241_10042226 | Ga0105241_100422265 | 243 |
| 186 | 3300009174 | Ga0105241_10318789 | Ga0105241_103187892 | 243 |
| 187 | 3300009545 | Ga0105237_10053078 | Ga0105237_100530782 | 243 |
| 188 | 3300009545 | Ga0105237_10117705 | Ga0105237_101177052 | 243 |
| 189 | 3300009545 | Ga0105237_10289773 | Ga0105237_102897732 | 243 |
| 190 | 3300009545 | Ga0105237_11043791 | Ga0105237_110437911 | 243 |
| 191 | 3300009551 | Ga0105238_10349255 | Ga0105238_103492552 | 243 |
| 192 | 3300009551 | Ga0105238_10517482 | Ga0105238_105174822 | 243 |
| 193 | 3300010375 | Ga0105239_10088717 | Ga0105239_100887174 | 243 |
| 194 | 3300010375 | Ga0105239_10228164 | Ga0105239_102281642 | 243 |
| 195 | 3300010375 | Ga0105239_10325840 | Ga0105239_103258402 | 243 |
| 196 | 3300011119 | Ga0105246_10114529 | Ga0105246_101145292 | 243 |
| 197 | 3300011119 | Ga0105246_10136335 | Ga0105246_101363351 | 243 |
| 198 | 3300013104 | Ga0157370_10031235 | Ga0157370_100312357 | 243 |
| 199 | 3300013104 | Ga0157370_10303380 | Ga0157370_103033802 | 243 |
| 200 | 3300013105 | Ga0157369_10016172 | Ga0157369_100161724 | 243 |
| 201 | 3300013105 | Ga0157369_10047280 | Ga0157369_100472804 | 243 |
| 202 | 3300013105 | Ga0157369_10267371 | Ga0157369_102673713 | 243 |
| 203 | 3300013105 | Ga0157369_10354879 | Ga0157369_103548792 | 243 |
| 204 | 3300013296 | Ga0157374_10328196 | Ga0157374_103281962 | 243 |
| 205 | 3300013297 | Ga0157378_10402826 | Ga0157378_104028261 | 243 |
| 206 | 3300013306 | Ga0163162_10039746 | Ga0163162_100397464 | 243 |
| 207 | 3300013306 | Ga0163162_10279493 | Ga0163162_102794933 | 243 |
| 208 | 3300013307 | Ga0157372_10389211 | Ga0157372_103892112 | 243 |
| 209 | 3300013307 | Ga0157372_10449992 | Ga0157372_104499922 | 243 |
| 210 | 3300013308 | Ga0157375_10215594 | Ga0157375_102155944 | 243 |
| 211 | 3300014325 | Ga0163163_10084192 | Ga0163163_100841924 | 243 |
| 212 | 3300014969 | Ga0157376_10145245 | Ga0157376_101452452 | 243 |
| 213 | 3300017792 | Ga0163161_10051367 | Ga0163161_100513672 | 243 |
| 214 | 3300021384 | Ga0213876_10122996 | Ga0213876_101229962 | 243 |
| 215 | 3300025253 | Ga0209677_102393 | Ga0209677_1023933 | 243 |
| 216 | 3300025272 | Ga0209455_1013177 | Ga0209455_10131772 | 243 |
| 217 | 3300025273 | Ga0209673_1036294 | Ga0209673_10362942 | 243 |
| 218 | 3300025295 | Ga0209564_1002696 | Ga0209564_100269611 | 243 |
| 219 | 3300025297 | Ga0209758_1000344 | Ga0209758_100034425 | 243 |
| 220 | 3300025297 | Ga0209758_1000903 | Ga0209758_100090321 | 243 |
| 221 | 3300025297 | Ga0209758_1047140 | Ga0209758_10471401 | 243 |
| 222 | 3300025299 | Ga0209256_1016642 | Ga0209256_10166423 | 243 |
| 223 | 3300025315 | Ga0207697_10055493 | Ga0207697_100554932 | 243 |
| 224 | 3300025885 | Ga0207653_10082344 | Ga0207653_100823442 | 243 |
| 225 | 3300025898 | Ga0207692_10005012 | Ga0207692_100050121 | 243 |
| 226 | 3300025898 | Ga0207692_10014618 | Ga0207692_100146183 | 243 |
| 227 | 3300025898 | Ga0207692_10135202 | Ga0207692_101352021 | 243 |
| 228 | 3300025900 | Ga0207710_10095714 | Ga0207710_100957142 | 243 |
| 229 | 3300025901 | Ga0207688_10039338 | Ga0207688_100393382 | 243 |
| 230 | 3300025901 | Ga0207688_10177719 | Ga0207688_101777191 | 243 |
| 231 | 3300025904 | Ga0207647_10027067 | Ga0207647_100270674 | 243 |
| 232 | 3300025906 | Ga0207699_10009424 | Ga0207699_100094243 | 243 |
| 233 | 3300025906 | Ga0207699_10072846 | Ga0207699_100728462 | 243 |
| 234 | 3300025906 | Ga0207699_10101322 | Ga0207699_101013223 | 243 |
| 235 | 3300025907 | Ga0207645_10059587 | Ga0207645_100595872 | 243 |
| 236 | 3300025907 | Ga0207645_10141037 | Ga0207645_101410372 | 243 |
| 237 | 3300025911 | Ga0207654_10003986 | Ga0207654_100039865 | 243 |
| 238 | 3300025911 | Ga0207654_10269532 | Ga0207654_102695321 | 243 |
| 239 | 3300025912 | Ga0207707_10004597 | Ga0207707_100045978 | 243 |
| 240 | 3300025912 | Ga0207707_10038675 | Ga0207707_100386754 | 243 |
| 241 | 3300025913 | Ga0207695_10099471 | Ga0207695_100994714 | 243 |
| 242 | 3300025913 | Ga0207695_10177171 | Ga0207695_101771713 | 243 |
| 243 | 3300025913 | Ga0207695_10338930 | Ga0207695_103389302 | 243 |
| 244 | 3300025914 | Ga0207671_10193821 | Ga0207671_101938212 | 243 |
| 245 | 3300025914 | Ga0207671_10382193 | Ga0207671_103821932 | 243 |
| 246 | 3300025915 | Ga0207693_10049103 | Ga0207693_100491033 | 243 |
| 247 | 3300025915 | Ga0207693_10077073 | Ga0207693_100770731 | 243 |
| 248 | 3300025916 | Ga0207663_10020332 | Ga0207663_100203321 | 243 |
| 249 | 3300025917 | Ga0207660_10058097 | Ga0207660_100580974 | 243 |
| 250 | 3300025917 | Ga0207660_10128339 | Ga0207660_101283393 | 243 |
| 251 | 3300025917 | Ga0207660_10461130 | Ga0207660_104611302 | 243 |
| 252 | 3300025921 | Ga0207652_10007612 | Ga0207652_100076123 | 243 |
| 253 | 3300025921 | Ga0207652_10477590 | Ga0207652_104775901 | 243 |
| 254 | 3300025923 | Ga0207681_10095627 | Ga0207681_100956272 | 243 |
| 255 | 3300025924 | Ga0207694_10069430 | Ga0207694_100694302 | 243 |
| 256 | 3300025926 | Ga0207659_10207274 | Ga0207659_102072743 | 243 |
| 257 | 3300025927 | Ga0207687_10025558 | Ga0207687_100255585 | 243 |
| 258 | 3300025928 | Ga0207700_10030218 | Ga0207700_100302185 | 243 |
| 259 | 3300025928 | Ga0207700_10031283 | Ga0207700_100312834 | 243 |
| 260 | 3300025928 | Ga0207700_10108714 | Ga0207700_101087142 | 243 |
| 261 | 3300025928 | Ga0207700_10470486 | Ga0207700_104704861 | 243 |
| 262 | 3300025929 | Ga0207664_10239096 | Ga0207664_102390962 | 243 |
| 263 | 3300025933 | Ga0207706_10056205 | Ga0207706_100562053 | 243 |
| 264 | 3300025933 | Ga0207706_10089008 | Ga0207706_100890083 | 243 |
| 265 | 3300025934 | Ga0207686_10060338 | Ga0207686_100603383 | 243 |
| 266 | 3300025935 | Ga0207709_10021655 | Ga0207709_100216552 | 243 |
| 267 | 3300025936 | Ga0207670_10323480 | Ga0207670_103234802 | 243 |
| 268 | 3300025939 | Ga0207665_10028573 | Ga0207665_100285732 | 243 |
| 269 | 3300025940 | Ga0207691_10036011 | Ga0207691_100360114 | 243 |
| 270 | 3300025941 | Ga0207711_10051590 | Ga0207711_100515903 | 243 |
| 271 | 3300025942 | Ga0207689_10014451 | Ga0207689_100144517 | 243 |
| 272 | 3300025942 | Ga0207689_10125921 | Ga0207689_101259214 | 243 |
| 273 | 3300025942 | Ga0207689_10179042 | Ga0207689_101790422 | 243 |
| 274 | 3300025944 | Ga0207661_10002953 | Ga0207661_100029533 | 243 |
| 275 | 3300025944 | Ga0207661_10017444 | Ga0207661_100174445 | 243 |
| 276 | 3300025945 | Ga0207679_10030648 | Ga0207679_100306486 | 243 |
| 277 | 3300025945 | Ga0207679_10090369 | Ga0207679_100903692 | 243 |
| 278 | 3300025949 | Ga0207667_10400785 | Ga0207667_104007852 | 243 |
| 279 | 3300025949 | Ga0207667_10657285 | Ga0207667_106572852 | 243 |
| 280 | 3300025961 | Ga0207712_10321024 | Ga0207712_103210242 | 243 |
| 281 | 3300025961 | Ga0207712_10434823 | Ga0207712_104348232 | 243 |
| 282 | 3300025972 | Ga0207668_10010865 | Ga0207668_100108656 | 243 |
| 283 | 3300025972 | Ga0207668_10030991 | Ga0207668_100309916 | 243 |
| 284 | 3300025972 | Ga0207668_10157913 | Ga0207668_101579132 | 243 |
| 285 | 3300025972 | Ga0207668_10268115 | Ga0207668_102681152 | 243 |
| 286 | 3300026023 | Ga0207677_10321347 | Ga0207677_103213472 | 243 |
| 287 | 3300026035 | Ga0207703_10344667 | Ga0207703_103446672 | 243 |
| 288 | 3300026041 | Ga0207639_10138060 | Ga0207639_101380602 | 243 |
| 289 | 3300026041 | Ga0207639_10319733 | Ga0207639_103197332 | 243 |
| 290 | 3300026041 | Ga0207639_10666430 | Ga0207639_106664302 | 243 |
| 291 | 3300026067 | Ga0207678_10068008 | Ga0207678_100680083 | 243 |
| 292 | 3300026067 | Ga0207678_10077553 | Ga0207678_100775532 | 243 |
| 293 | 3300026067 | Ga0207678_10149884 | Ga0207678_101498842 | 243 |
| 294 | 3300026075 | Ga0207708_10059862 | Ga0207708_100598622 | 243 |
| 295 | 3300026078 | Ga0207702_10477171 | Ga0207702_104771711 | 243 |
| 296 | 3300026078 | Ga0207702_10559703 | Ga0207702_105597032 | 243 |
| 297 | 3300026078 | Ga0207702_10695437 | Ga0207702_106954371 | 243 |
| 298 | 3300026088 | Ga0207641_10235857 | Ga0207641_102358572 | 243 |
| 299 | 3300026089 | Ga0207648_10048143 | Ga0207648_100481434 | 243 |
| 300 | 3300026089 | Ga0207648_10117006 | Ga0207648_101170062 | 243 |
| 301 | 3300026095 | Ga0207676_10011441 | Ga0207676_100114413 | 243 |
| 302 | 3300026116 | Ga0207674_10079911 | Ga0207674_100799115 | 243 |
| 303 | 3300026116 | Ga0207674_10314745 | Ga0207674_103147453 | 243 |
| 304 | 3300026116 | Ga0207674_10359564 | Ga0207674_103595642 | 243 |
| 305 | 3300026118 | Ga0207675_100111738 | Ga0207675_1001117385 | 243 |
| 306 | 3300026121 | Ga0207683_10046736 | Ga0207683_100467365 | 243 |
| 307 | 3300026121 | Ga0207683_10101208 | Ga0207683_101012083 | 243 |
| 308 | 3300026121 | Ga0207683_10282112 | Ga0207683_102821122 | 243 |
| 309 | 3300026142 | Ga0207698_10121028 | Ga0207698_101210282 | 243 |
| 310 | 3300026142 | Ga0207698_10158514 | Ga0207698_101585142 | 243 |
| 311 | 3300026142 | Ga0207698_10732742 | Ga0207698_107327421 | 243 |
| 312 | 3300027512 | Ga0209179_1011233 | Ga0209179_10112331 | 243 |
| 313 | 3300028379 | Ga0268266_10002572 | Ga0268266_1000257222 | 243 |
| 314 | 3300028379 | Ga0268266_10195150 | Ga0268266_101951501 | 243 |
| 315 | 3300028380 | Ga0268265_10534334 | Ga0268265_105343342 | 243 |
| 316 | 3300028381 | Ga0268264_10110307 | Ga0268264_101103073 | 243 |
| 317 | 3300028794 | Ga0307515_10075181 | Ga0307515_100751815 | 243 |
| 318 | 3300030521 | Ga0307511_10091980 | Ga0307511_100919802 | 243 |
| 319 | 3300030521 | Ga0307511_10152124 | Ga0307511_101521242 | 243 |
| 320 | 3300031616 | Ga0307508_10334222 | Ga0307508_103342222 | 243 |
| 321 | 3300031730 | Ga0307516_10003967 | Ga0307516_100039672 | 243 |
| 322 | 3300032005 | Ga0307411_10121359 | Ga0307411_101213593 | 243 |
| 323 | 3300033179 | Ga0307507_10051491 | Ga0307507_100514912 | 243 |
| 324 | 3300035089 | Ga0373944_0043662 | Ga0373944_0043662_439_1182 | 243 |
| 325 | 3300035117 | Ga0373953_0028328 | Ga0373953_0028328_281_1027 | 243 |
| 326 | 3300035117 | Ga0373953_0053292 | Ga0373953_0053292_804_1544 | 243 |
| 327 | 3300035118 | Ga0373954_0143745 | Ga0373954_0143745_139_879 | 243 |
| 328 | 3300035120 | Ga0373957_0044174 | Ga0373957_0044174_318_1058 | 243 |
| 329 | 3300035170 | Ga0373943_0063377 | Ga0373943_0063377_867_1613 | 243 |
| 330 | 3300035170 | Ga0373943_0065661 | Ga0373943_0065661_823_1569 | 243 |
| 331 | 3300035172 | Ga0373955_0043381 | Ga0373955_0043381_180_920 | 243 |
| 332 | 3300035692 | Ga0373935_0096142 | Ga0373935_0096142_282_1028 | 243 |
| 333 | 3300035692 | Ga0373935_0158079 | Ga0373935_0158079_733_1473 | 243 |
| 334 | 3300035695 | Ga0373927_0053987 | Ga0373927_0053987_1418_2164 | 243 |
| 335 | 3300035695 | Ga0373927_0345049 | Ga0373927_0345049_65_811 | 243 |
| 336 | 3300035724 | Ga0373933_0072653 | Ga0373933_0072653_723_1463 | 243 |
| 337 | 3300035724 | Ga0373933_0085124 | Ga0373933_0085124_1107_1841 | 243 |
| 338 | 3300035725 | Ga0373947_0078468 | Ga0373947_0078468_135_881 | 243 |
| 339 | 3300037068 | Ga0373925_0089046 | Ga0373925_0089046_397_1143 | 243 |
| 340 | 3300037418 | Ga0395900_0144447 | Ga0395900_0144447_624_1370 | 243 |
| 341 | 3300037418 | Ga0395900_0430804 | Ga0395900_0430804_150_899 | 243 |
| 342 | 3300037466 | Ga0395898_0061962 | Ga0395898_0061962_981_1730 | 243 |
| 343 | 3300037466 | Ga0395898_0110483 | Ga0395898_0110483_307_1053 | 243 |
| 344 | 3300037471 | Ga0395905_0391002 | Ga0395905_0391002_49_795 | 243 |
| 345 | 3300037853 | Ga0436364_0819459 | Ga0436364_0819459_329_1075 | 243 |
| 346 | 3300038443 | Ga0395901_0280812 | Ga0395901_0280812_149_895 | 243 |
| 347 | 3300039437 | Ga0436365_0307257 | Ga0436365_0307257_256_996 | 243 |
| 348 | 3300039437 | Ga0436365_0322079 | Ga0436365_0322079_1219_1965 | 243 |
| 349 | 3300039437 | Ga0436365_0386501 | Ga0436365_0386501_427_1173 | 243 |
| 350 | 3300039437 | Ga0436365_1476851 | Ga0436365_1476851_1059_1805 | 243 |
| 351 | 3300044684 | Ga0466966_0251201 | Ga0466966_0251201_150_896 | 243 |
| 352 | 3300044706 | Ga0466964_0015910 | Ga0466964_0015910_1738_2484 | 243 |
| 353 | 3300044842 | Ga0466957_0067477 | Ga0466957_0067477_847_1593 | 243 |
| 354 | 3300045976 | Ga0466967_0185436 | Ga0466967_0185436_845_1591 | 243 |
| 355 | 3300045976 | Ga0466967_0205963 | Ga0466967_0205963_268_1014 | 243 |
| 356 | 3300046452 | Ga0495617_111194 | Ga0495617_111194_105_851 | 243 |
| 357 | 3300046454 | Ga0495592_0094256 | Ga0495592_0094256_761_1501 | 243 |
| 358 | 3300046455 | Ga0495603_0036150 | Ga0495603_0036150_1699_2445 | 243 |
| 359 | 3300046459 | Ga0495629_0077186 | Ga0495629_0077186_659_1405 | 243 |
| 360 | 3300046460 | Ga0495638_0085725 | Ga0495638_0085725_916_1662 | 243 |
| 361 | 3300046460 | Ga0495638_0303857 | Ga0495638_0303857_62_808 | 243 |
| 362 | 3300046462 | Ga0495651_0078144 | Ga0495651_0078144_823_1563 | 243 |
| 363 | 3300046463 | Ga0495653_0123959 | Ga0495653_0123959_439_1179 | 243 |
| 364 | 3300046472 | Ga0495580_0067166 | Ga0495580_0067166_818_1564 | 243 |
| 365 | 3300046472 | Ga0495580_0195897 | Ga0495580_0195897_538_1287 | 243 |
| 366 | 3300046473 | Ga0495582_0226958 | Ga0495582_0226958_141_887 | 243 |
| 367 | 3300046475 | Ga0495639_0062634 | Ga0495639_0062634_358_1104 | 243 |
| 368 | 3300046477 | Ga0495664_0020079 | Ga0495664_0020079_1989_2735 | 243 |
| 369 | 3300046491 | Ga0495584_0085821 | Ga0495584_0085821_69_806 | 243 |
| 370 | 3300046492 | Ga0495585_0045567 | Ga0495585_0045567_297_1043 | 243 |
| 371 | 3300046492 | Ga0495585_0057859 | Ga0495585_0057859_1289_2026 | 243 |
| 372 | 3300046492 | Ga0495585_0179308 | Ga0495585_0179308_81_827 | 243 |
| 373 | 3300046499 | Ga0495594_0068385 | Ga0495594_0068385_65_811 | 243 |
| 374 | 3300046501 | Ga0495607_0201123 | Ga0495607_0201123_141_878 | 243 |
| 375 | 3300046513 | Ga0495616_0150494 | Ga0495616_0150494_111_857 | 243 |
| 376 | 3300046514 | Ga0495618_0028066 | Ga0495618_0028066_695_1435 | 243 |
| 377 | 3300046514 | Ga0495618_0142079 | Ga0495618_0142079_18_764 | 243 |
| 378 | 3300046516 | Ga0495628_0115008 | Ga0495628_0115008_1065_1805 | 243 |
| 379 | 3300046517 | Ga0495630_0136812 | Ga0495630_0136812_972_1718 | 243 |
| 380 | 3300046517 | Ga0495630_0245800 | Ga0495630_0245800_313_1053 | 243 |
| 381 | 3300046519 | Ga0495632_0092402 | Ga0495632_0092402_82_828 | 243 |
| 382 | 3300046529 | Ga0495652_0107270 | Ga0495652_0107270_921_1661 | 243 |
| 383 | 3300046529 | Ga0495652_0278139 | Ga0495652_0278139_297_1043 | 243 |
| 384 | 3300046531 | Ga0495665_0114325 | Ga0495665_0114325_16_762 | 243 |
| 385 | 3300046533 | Ga0495640_0067602 | Ga0495640_0067602_666_1406 | 243 |
| 386 | 3300046533 | Ga0495640_0340791 | Ga0495640_0340791_103_849 | 243 |
| 387 | 3300046536 | Ga0495587_0054034 | Ga0495587_0054034_1105_1845 | 243 |
| 388 | 3300046537 | Ga0495598_0006756 | Ga0495598_0006756_1834_2580 | 243 |
| 389 | 3300046543 | Ga0495645_0001274 | Ga0495645_0001274_9890_10636 | 243 |
| 390 | 3300046543 | Ga0495645_0023733 | Ga0495645_0023733_1148_1888 | 243 |
| 391 | 3300046559 | Ga0495667_0173186 | Ga0495667_0173186_494_1240 | 243 |
| 392 | 3300046615 | Ga0495656_0103100 | Ga0495656_0103100_112_849 | 243 |
| 393 | 3300046616 | Ga0495668_0033297 | Ga0495668_0033297_106_843 | 243 |
| 394 | 3300046642 | Ga0495634_0036105 | Ga0495634_0036105_2060_2800 | 243 |
| 395 | 3300046642 | Ga0495634_0350942 | Ga0495634_0350942_19_765 | 243 |
| 396 | 3300046663 | Ga0495635_0075709 | Ga0495635_0075709_1144_1884 | 243 |
| 397 | 3300046664 | Ga0495659_0022420 | Ga0495659_0022420_1194_1940 | 243 |
| 398 | 3300046675 | Ga0495657_0060651 | Ga0495657_0060651_25_765 | 243 |
| 399 | 3300046678 | Ga0495599_0038423 | Ga0495599_0038423_569_1309 | 243 |
| 400 | 3300046679 | Ga0495623_0276356 | Ga0495623_0276356_19_765 | 243 |
| 401 | 3300046680 | Ga0495646_0065296 | Ga0495646_0065296_25_765 | 243 |
| 402 | 3300046680 | Ga0495646_0096640 | Ga0495646_0096640_872_1618 | 243 |
| 403 | 3300046683 | Ga0495658_0148364 | Ga0495658_0148364_346_1092 | 243 |
| 404 | 3300046683 | Ga0495658_0206613 | Ga0495658_0206613_383_1129 | 243 |
| 405 | 3300046683 | Ga0495658_0229371 | Ga0495658_0229371_400_1146 | 243 |
| 406 | 3300046690 | Ga0495624_0051282 | Ga0495624_0051282_1682_2428 | 243 |
| 407 | 3300046691 | Ga0495670_0054823 | Ga0495670_0054823_412_1158 | 243 |
| 408 | 3300046809 | Ga0495600_0059009 | Ga0495600_0059009_650_1390 | 243 |
| 409 | 3300047319 | Ga0495674_0038132 | Ga0495674_0038132_2491_3231 | 243 |
| 410 | 3300047319 | Ga0495674_0598817 | Ga0495674_0598817_25_771 | 243 |
| 411 | 3300047322 | Ga0495680_0048580 | Ga0495680_0048580_1741_2481 | 243 |
| 412 | 3300047322 | Ga0495680_0433762 | Ga0495680_0433762_63_809 | 243 |
| 413 | 3300047444 | Ga0495675_0107764 | Ga0495675_0107764_544_1284 | 243 |
| 414 | 3300047471 | Ga0495684_0136518 | Ga0495684_0136518_96_842 | 243 |
| 415 | 3300047673 | Ga0495593_0013126 | Ga0495593_0013126_3652_4398 | 243 |
| 416 | 3300048088 | Ga0495602_0028167 | Ga0495602_0028167_3139_3879 | 243 |
| 417 | 3300048903 | Ga0496100_0344624 | Ga0496100_0344624_22_762 | 243 |
| 418 | 3300048903 | Ga0496100_0453652 | Ga0496100_0453652_175_921 | 243 |
| 419 | 3300048905 | Ga0496102_0033820 | Ga0496102_0033820_1988_2734 | 243 |
| 420 | 3300048905 | Ga0496102_0157264 | Ga0496102_0157264_1112_1858 | 243 |
| 421 | 3300048907 | Ga0496104_0713798 | Ga0496104_0713798_84_830 | 243 |
| 422 | 3300048909 | Ga0496106_0010776 | Ga0496106_0010776_5675_6427 | 243 |
| 423 | 3300048909 | Ga0496106_0015830 | Ga0496106_0015830_3924_4670 | 243 |
| 424 | 3300048909 | Ga0496106_0064750 | Ga0496106_0064750_291_1037 | 243 |
| 425 | 3300048910 | Ga0496107_0038067 | Ga0496107_0038067_1157_1903 | 243 |
| 426 | 3300048910 | Ga0496107_0348436 | Ga0496107_0348436_130_876 | 243 |
| 427 | 3300048911 | Ga0496108_0000392 | Ga0496108_0000392_14403_15149 | 243 |
| 428 | 3300048911 | Ga0496108_0173613 | Ga0496108_0173613_765_1511 | 243 |
| 429 | 3300048912 | Ga0496109_0000509 | Ga0496109_0000509_9134_9880 | 243 |
| 430 | 3300048913 | Ga0496110_0002823 | Ga0496110_0002823_4596_5342 | 243 |
| 431 | 3300048913 | Ga0496110_0164285 | Ga0496110_0164285_784_1530 | 243 |
| 432 | 3300048915 | Ga0496112_0001604 | Ga0496112_0001604_16729_17475 | 243 |
| 433 | 3300048915 | Ga0496112_0022947 | Ga0496112_0022947_3167_3913 | 243 |
| 434 | 3300048915 | Ga0496112_0120193 | Ga0496112_0120193_1627_2373 | 243 |
| 435 | 3300048916 | Ga0496113_0057085 | Ga0496113_0057085_1614_2360 | 243 |
| 436 | 3300048916 | Ga0496113_0088782 | Ga0496113_0088782_75_821 | 243 |
| 437 | 3300048917 | Ga0496114_0143888 | Ga0496114_0143888_1000_1746 | 243 |
| 438 | 3300048917 | Ga0496114_0184522 | Ga0496114_0184522_341_1087 | 243 |
| 439 | 3300048918 | Ga0496115_0056345 | Ga0496115_0056345_2094_2840 | 243 |
| 440 | 3300048920 | Ga0496117_0009803 | Ga0496117_0009803_97_849 | 243 |
| 441 | 3300048920 | Ga0496117_0047849 | Ga0496117_0047849_2191_2931 | 243 |
| 442 | 3300048921 | Ga0496118_0004079 | Ga0496118_0004079_11657_12409 | 243 |
| 443 | 3300048921 | Ga0496118_0018456 | Ga0496118_0018456_2773_3513 | 243 |
| 444 | 3300048924 | Ga0496121_0003552 | Ga0496121_0003552_15699_16451 | 243 |
| 445 | 3300048924 | Ga0496121_0038816 | Ga0496121_0038816_2063_2803 | 243 |
| 446 | 3300048924 | Ga0496121_0150823 | Ga0496121_0150823_340_1086 | 243 |
| 447 | 3300048924 | Ga0496121_0175073 | Ga0496121_0175073_389_1135 | 243 |
| 448 | 3300048925 | Ga0496122_0017207 | Ga0496122_0017207_1191_1937 | 243 |
| 449 | 3300048926 | Ga0496123_0022865 | Ga0496123_0022865_1545_2291 | 243 |
| 450 | 3300048927 | Ga0496124_0002443 | Ga0496124_0002443_7060_7812 | 243 |
| 451 | 3300048928 | Ga0496125_0054251 | Ga0496125_0054251_836_1576 | 243 |
| 452 | 3300048928 | Ga0496125_0350524 | Ga0496125_0350524_20_766 | 243 |
| 453 | 3300048929 | Ga0496126_0004189 | Ga0496126_0004189_962_1708 | 243 |
| 454 | 3300048929 | Ga0496126_0030836 | Ga0496126_0030836_3189_3941 | 243 |
| 455 | 3300048929 | Ga0496126_0127895 | Ga0496126_0127895_377_1123 | 243 |
| 456 | 3300048929 | Ga0496126_0196569 | Ga0496126_0196569_283_1035 | 243 |
| 457 | 3300049579 | Ga0501043_0289831 | Ga0501043_0289831_388_1128 | 243 |
| 458 | 3300049580 | Ga0501046_0419835 | Ga0501046_0419835_199_945 | 243 |
| 459 | 3300049581 | Ga0501047_0156403 | Ga0501047_0156403_1372_2118 | 243 |
| 460 | 3300049586 | Ga0501070_0092604 | Ga0501070_0092604_1313_2059 | 243 |
| 461 | 3300049589 | Ga0501073_0088663 | Ga0501073_0088663_652_1398 | 243 |
| 462 | 3300049590 | Ga0501074_0224799 | Ga0501074_0224799_539_1285 | 243 |
| 463 | 3300049742 | Ga0501080_0032454 | Ga0501080_0032454_333_1079 | 243 |
| 464 | 3300049822 | Ga0501035_0626307 | Ga0501035_0626307_102_848 | 243 |
| 465 | 3300049823 | Ga0501044_0181780 | Ga0501044_0181780_1206_1952 | 243 |
| 466 | 3300050490 | nmdc:mga03n38_448_c1 | nmdc:mga03n38_448_c1_2110_2856 | 243 |
| 467 | 3300050494 | nmdc:mga06z11_71132_c1 | nmdc:mga06z11_71132_c1_885_1631 | 243 |
| 468 | 3300050496 | nmdc:mga07m45_36235_c1 | nmdc:mga07m45_36235_c1_1734_2480 | 243 |
| 469 | 3300050496 | nmdc:mga07m45_80104_c1 | nmdc:mga07m45_80104_c1_235_981 | 243 |
| 470 | 3300050511 | nmdc:mga08y16_205945_c1 | nmdc:mga08y16_205945_c1_323_1069 | 243 |
| 471 | 3300050513 | nmdc:mga0rr50_113206_c1 | nmdc:mga0rr50_113206_c1_323_1069 | 243 |
| 472 | 3300053077 | Ga0495601_0081104 | Ga0495601_0081104_1224_1970 | 243 |
| 473 | 3300053078 | Ga0495612_0052841 | Ga0495612_0052841_29_769 | 243 |
| 474 | 3300053078 | Ga0495612_0137972 | Ga0495612_0137972_165_905 | 243 |
| 475 | 3300053080 | Ga0500635_0001844 | Ga0500635_0001844_4067_4813 | 243 |
| 476 | 3300053080 | Ga0500635_0024536 | Ga0500635_0024536_869_1615 | 243 |
| 477 | 3300053094 | Ga0500566_0005672 | Ga0500566_0005672_6328_7074 | 243 |
| 478 | 3300053094 | Ga0500566_0065901 | Ga0500566_0065901_832_1578 | 243 |
| 479 | 3300053095 | Ga0500640_000168 | Ga0500640_000168_583_1329 | 243 |
| 480 | 3300053111 | Ga0500572_028802 | Ga0500572_028802_208_954 | 243 |
| 481 | 3300053115 | Ga0500591_032578 | Ga0500591_032578_559_1305 | 243 |
| 482 | 3300053119 | Ga0500595_043822 | Ga0500595_043822_448_1194 | 243 |
| 483 | 3300053122 | Ga0500608_078351 | Ga0500608_078351_610_1356 | 243 |
| 484 | 3300053123 | Ga0500614_014938 | Ga0500614_014938_317_1063 | 243 |
| 485 | 3300053130 | Ga0500642_0121538 | Ga0500642_0121538_466_1212 | 243 |
| 486 | 3300053136 | Ga0500559_0013716 | Ga0500559_0013716_630_1376 | 243 |
| 487 | 3300053139 | Ga0500568_0006530 | Ga0500568_0006530_1113_1850 | 243 |
| 488 | 3300053140 | Ga0500573_0138422 | Ga0500573_0138422_481_1227 | 243 |
| 489 | 3300053142 | Ga0500577_0170588 | Ga0500577_0170588_57_803 | 243 |
| 490 | 3300053148 | Ga0500590_081771 | Ga0500590_081771_806_1552 | 243 |
| 491 | 3300053148 | Ga0500590_121511 | Ga0500590_121511_265_1011 | 243 |
| 492 | 3300053148 | Ga0500590_139346 | Ga0500590_139346_32_778 | 243 |
| 493 | 3300053150 | Ga0500603_013725 | Ga0500603_013725_685_1431 | 243 |
| 494 | 3300053150 | Ga0500603_038176 | Ga0500603_038176_177_917 | 243 |
| 495 | 3300053162 | Ga0500638_081804 | Ga0500638_081804_198_944 | 243 |
| 496 | 3300053163 | Ga0500639_000125 | Ga0500639_000125_6418_7164 | 243 |
| 497 | 3300053163 | Ga0500639_058918 | Ga0500639_058918_766_1512 | 243 |
| 498 | 3300053177 | Ga0500636_0007829 | Ga0500636_0007829_4124_4864 | 243 |
| 499 | 3300053733 | Ga0500552_001226 | Ga0500552_001226_947_1693 | 243 |
| 500 | 3300053737 | Ga0500601_004601 | Ga0500601_004601_393_1133 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zrm-assembly1.cif.gz_A | crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate | 0.9359 | 3 | 243 |
| 1zrm-assembly1.cif.gz_A | crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate | 0.9277 | 3 | 243 |
| 3um9-assembly1.cif.gz_B | crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 | 0.9227 | 2 | 242 |
| 1jud-assembly1.cif.gz_A | l-2-haloacid dehalogenase | 0.9221 | 3 | 243 |
| 1jud-assembly1.cif.gz_A | l-2-haloacid dehalogenase | 0.9141 | 3 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1judA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9655 | 19 | 90 | 1.10.150.240 |
| 1qh9A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9643 | 18 | 90 | 1.10.150.240 |
| 1zrnA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9642 | 19 | 90 | 1.10.150.240 |
| 1zrmA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9569 | 19 | 90 | 1.10.150.240 |
| 3um9A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 | 0.9502 | 18 | 90 | 1.10.150.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S1EH65-F1-model_v4 | Haloacid dehalogenase type II | 0.9786 | 14 | 148 |
|
| AF-A0A3S0IDG5-F1-model_v4 | deleted | 0.9781 | 1 | 157 |
|
| AF-A0A401U062-F1-model_v4 | Haloacid dehalogenase, type II | 0.9759 | 1 | 180 |
GO:0019120
|
| AF-A0A3S0IDG5-F1-model_v4 | deleted | 0.972 | 1 | 157 |
|
| AF-A0A3S1EH65-F1-model_v4 | Haloacid dehalogenase type II | 0.9715 | 14 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar