F455550

General Info

Members Datasets Scaffolds Average Seq Length
500 306 474 247

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10030218|Ga0207700_100302185
Length 274
Sequence VNASSISQKPDIRYNSTLSTIPGINQLTLQAVVFDAYGTLYDIQSVAEITEEAFPGYGDLITQIWRIKQLEYSWLRSLMRRYQDFSFVTRDSLAYTLRTLGLRYDDETFGRIIDKYLHLDLYPDALGALSALRDRTLAILSNGSPDMLNALVANSGLDRILTATLSVDAHKAFKPSPEAYSLIEEKLGVKPANVLFVSSNPWDACGAKAFGLNVAWLERVTPEAMALACVENDLLAPLTLFKALRTQMDALGVEVDHRIRSLSELADIVAFHES

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
5 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
6 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
10 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
11 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
12 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
13 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
14 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
15 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
16 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
17 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
18 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
19 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
283 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
284 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
285 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
288 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
289 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
293 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
296 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
297 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
300 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
301 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
302 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
303 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
304 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
305 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
306 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.99
Metatranscriptomes 0
Isolates 5.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 3.8
Rhizoplane 7.4
Rhizosphere 71.4
Stem 0
Stem Tuber 0
Unclassified 7.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000371 3300003215 Bacteria 30777
2 Ga0070676_10070124 3300005328 Bacteria 2102
3 Ga0070676_10216912 3300005328 Bacteria 1262
4 Ga0070683_100003434 3300005329 Bacteria 12861
5 Ga0070683_100125746 3300005329 Bacteria 2424
6 Ga0070670_100203033 3300005331 Bacteria 1723
7 Ga0068869_100103714 3300005334 Bacteria 2155
8 Ga0070680_100179591 3300005336 Bacteria 1783
9 Ga0070680_100353003 3300005336 Bacteria 1250
10 Ga0070682_100030922 3300005337 Bacteria 3235
11 Ga0070682_100116743 3300005337 Bacteria 1786
12 Ga0068868_100085990 3300005338 Bacteria 2527
13 Ga0070660_100333375 3300005339 Bacteria 1248
14 Ga0070689_100233874 3300005340 Bacteria 1511
15 Ga0070691_10079547 3300005341 Bacteria 1603
16 Ga0070668_100027647 3300005347 Bacteria 4306
17 Ga0070668_100044624 3300005347 Bacteria 3400
18 Ga0070668_100379986 3300005347 Bacteria 1202
19 Ga0070669_100314843 3300005353 Bacteria 1262
20 Ga0070674_100119052 3300005356 Bacteria 1952
21 Ga0070688_100164938 3300005365 Bacteria 1525
22 Ga0070667_100220150 3300005367 Bacteria 1689
23 Ga0070709_10086101 3300005434 Bacteria 2062
24 Ga0070709_10115621 3300005434 Bacteria 1810
25 Ga0070714_100044149 3300005435 Bacteria 3773
26 Ga0070714_100248501 3300005435 Bacteria 1644
27 Ga0070713_100005334 3300005436 Bacteria 8772
28 Ga0070713_100028331 3300005436 Bacteria 4422
29 Ga0070713_100544532 3300005436 Bacteria 1098
30 Ga0070710_10010883 3300005437 Bacteria 4480
31 Ga0070701_10204181 3300005438 Bacteria 1170
32 Ga0070711_100006314 3300005439 Bacteria 7135
33 Ga0070711_100027834 3300005439 Bacteria 3714
34 Ga0070711_100186816 3300005439 Bacteria 1590
35 Ga0070700_100154288 3300005441 Bacteria 1574
36 Ga0070663_100009946 3300005455 Bacteria 5912
37 Ga0070663_100041847 3300005455 Bacteria 3216
38 Ga0070663_100189560 3300005455 Bacteria 1599
39 Ga0070663_100242256 3300005455 Bacteria 1424
40 Ga0070678_100014130 3300005456 Bacteria 5028
41 Ga0070678_100067232 3300005456 Bacteria 2666
42 Ga0070678_100340869 3300005456 Bacteria 1286
43 Ga0070662_100038959 3300005457 Bacteria 3379
44 Ga0070662_100150407 3300005457 Bacteria 1812
45 Ga0070662_100239147 3300005457 Bacteria 1456
46 Ga0070681_10036493 3300005458 Bacteria 4936
47 Ga0070681_10036669 3300005458 Bacteria 4923
48 Ga0070681_10063863 3300005458 Bacteria 3655
49 Ga0070681_10066319 3300005458 Bacteria 3578
50 Ga0068867_100118992 3300005459 Bacteria 2039
51 Ga0070685_10091281 3300005466 Bacteria 1844
52 Ga0070707_100287136 3300005468 Bacteria 1599
53 Ga0070698_100197354 3300005471 Bacteria 1949
54 Ga0070679_100020155 3300005530 Bacteria 6498
55 Ga0070679_100044206 3300005530 Bacteria 4438
56 Ga0070679_100200146 3300005530 Bacteria 1964
57 Ga0070684_100010514 3300005535 Bacteria 7333
58 Ga0070684_100010579 3300005535 Bacteria 7315
59 Ga0070697_100271391 3300005536 Bacteria 1454
60 Ga0070697_100407254 3300005536 Bacteria 1181
61 Ga0068853_100385356 3300005539 Bacteria 1310
62 Ga0070672_100213802 3300005543 Bacteria 1615
63 Ga0070696_100340016 3300005546 Bacteria 1160
64 Ga0070665_100082915 3300005548 Bacteria 3211
65 Ga0070665_100298902 3300005548 Bacteria 1612
66 Ga0068855_100117899 3300005563 Bacteria 3041
67 Ga0068855_100244621 3300005563 Bacteria 2003
68 Ga0068855_100353404 3300005563 Bacteria 1618
69 Ga0070664_100158597 3300005564 Bacteria 2000
70 Ga0070664_100482562 3300005564 Bacteria 1141
71 Ga0068857_100131062 3300005577 Bacteria 2261
72 Ga0068857_100300780 3300005577 Bacteria 1479
73 Ga0068852_100112957 3300005616 Bacteria 2473
74 Ga0068852_100219604 3300005616 Bacteria 1807
75 Ga0068852_100324664 3300005616 Bacteria 1496
76 Ga0068852_100676606 3300005616 Bacteria 1041
77 Ga0068864_100030394 3300005618 Bacteria 4578
78 Ga0068861_100089955 3300005719 Bacteria 2420
79 Ga0068861_100127997 3300005719 Bacteria 2058
80 Ga0068863_100225733 3300005841 Bacteria 1805
81 Ga0068858_100021643 3300005842 Bacteria 6010
82 Ga0068860_100200531 3300005843 Bacteria 1933
83 Ga0068860_100380379 3300005843 Bacteria 1393
84 Ga0068862_100172610 3300005844 Bacteria 1936
85 Ga0068862_100243072 3300005844 Bacteria 1637
86 Ga0081455_10001281 3300005937 Bacteria 31263
87 Ga0081455_10038108 3300005937 Bacteria 4259
88 Ga0081538_10085961 3300005981 Bacteria 1649
89 Ga0081540_1008353 3300005983 Bacteria 7236
90 Ga0081540_1020858 3300005983 Bacteria 3925
91 Ga0081540_1089061 3300005983 Bacteria 1363
92 Ga0081539_10001606 3300005985 Bacteria 37203
93 Ga0081539_10033579 3300005985 Bacteria 3121
94 Ga0070717_10025976 3300006028 Bacteria 4668
95 Ga0075365_10079992 3300006038 Bacteria 2212
96 Ga0075365_10104682 3300006038 Bacteria 1940
97 Ga0075365_10300075 3300006038 Bacteria 1130
98 Ga0075363_100092193 3300006048 Bacteria 1668
99 Ga0075364_10134586 3300006051 Bacteria 1660
100 Ga0075432_10043244 3300006058 Bacteria 1578
101 Ga0070716_100055960 3300006173 Bacteria 2260
102 Ga0070712_100036260 3300006175 Bacteria 3354
103 Ga0075362_10025287 3300006177 Bacteria 2526
104 Ga0075367_10017544 3300006178 Bacteria 3931
105 Ga0075367_10075768 3300006178 Bacteria 2029
106 Ga0097621_100054611 3300006237 Bacteria 3259
107 Ga0097621_100529196 3300006237 Bacteria 1071
108 Ga0075370_10074220 3300006353 Bacteria 1949
109 Ga0075370_10289413 3300006353 Bacteria 973
110 Ga0068871_100132069 3300006358 Bacteria 2118
111 Ga0068871_100238078 3300006358 Bacteria 1581
112 Ga0075434_100292971 3300006871 Bacteria 1647
113 Ga0068865_100043769 3300006881 Bacteria 3061
114 Ga0075436_100416412 3300006914 Bacteria 975
115 Ga0099795_10031402 3300007788 Bacteria 1828
116 Ga0105250_10165453 3300009092 Bacteria 924
117 Ga0105240_10113119 3300009093 Bacteria 3280
118 Ga0105240_10223865 3300009093 Bacteria 2190
119 Ga0111539_10216329 3300009094 Bacteria 2232
120 Ga0105247_10168258 3300009101 Bacteria 1456
121 Ga0105243_10062938 3300009148 Bacteria 2972
122 Ga0105243_10106362 3300009148 Bacteria 2339
123 Ga0105241_10040357 3300009174 Bacteria 3524
124 Ga0105241_10042226 3300009174 Bacteria 3448
125 Ga0105241_10318789 3300009174 Bacteria 1340
126 Ga0105237_10053078 3300009545 Bacteria 4066
127 Ga0105237_10117705 3300009545 Bacteria 2650
128 Ga0105237_10168732 3300009545 Bacteria 2188
129 Ga0105237_10289773 3300009545 Bacteria 1640
130 Ga0105237_11043791 3300009545 Bacteria 824
131 Ga0105238_10349255 3300009551 Bacteria 1468
132 Ga0105238_10517482 3300009551 Bacteria 1196
133 Ga0105239_10088717 3300010375 Bacteria 3410
134 Ga0105239_10101560 3300010375 Bacteria 3182
135 Ga0105239_10228164 3300010375 Bacteria 2089
136 Ga0105239_10325840 3300010375 Bacteria 1733
137 Ga0105246_10006526 3300011119 Bacteria 7122
138 Ga0105246_10114529 3300011119 Bacteria 1987
139 Ga0105246_10136335 3300011119 Bacteria 1840
140 Ga0157370_10031235 3300013104 Bacteria 5212
141 Ga0157370_10303380 3300013104 Bacteria 1474
142 Ga0157369_10016172 3300013105 Bacteria 8398
143 Ga0157369_10047280 3300013105 Bacteria 4673
144 Ga0157369_10267371 3300013105 Bacteria 1783
145 Ga0157369_10354879 3300013105 Bacteria 1523
146 Ga0157374_10007199 3300013296 Bacteria 9475
147 Ga0157374_10021300 3300013296 Bacteria 5766
148 Ga0157374_10328196 3300013296 Bacteria 1517
149 Ga0157378_10126165 3300013297 Bacteria 2364
150 Ga0157378_10402826 3300013297 Bacteria 1348
151 Ga0163162_10025470 3300013306 Bacteria 5845
152 Ga0163162_10039746 3300013306 Bacteria 4702
153 Ga0163162_10279493 3300013306 Bacteria 1801
154 Ga0157372_10389211 3300013307 Bacteria 1624
155 Ga0157372_10449992 3300013307 Bacteria 1501
156 Ga0157375_10022464 3300013308 Bacteria 5806
157 Ga0157375_10215594 3300013308 Bacteria 2077
158 Ga0163163_10007524 3300014325 Bacteria 9616
159 Ga0163163_10084192 3300014325 Bacteria 3186
160 Ga0157376_10004438 3300014969 Bacteria 9773
161 Ga0157376_10145245 3300014969 Bacteria 2133
162 Ga0163161_10051367 3300017792 Bacteria 2986
163 Ga0213876_10122996 3300021384 Bacteria 1378
164 Ga0209677_102393 3300025253 Bacteria 7140
165 Ga0209455_1013177 3300025272 Bacteria 1934
166 Ga0209673_1036294 3300025273 Bacteria 1464
167 Ga0209564_1002696 3300025295 Bacteria 13416
168 Ga0209758_1000344 3300025297 Bacteria 85133
169 Ga0209758_1000903 3300025297 Bacteria 40307
170 Ga0209758_1047140 3300025297 Bacteria 1546
171 Ga0209256_1016642 3300025299 Bacteria 2492
172 Ga0207697_10055493 3300025315 Bacteria 1643
173 Ga0207653_10082344 3300025885 Bacteria 1116
174 Ga0207692_10005012 3300025898 Bacteria 5273
175 Ga0207692_10014618 3300025898 Bacteria 3434
176 Ga0207692_10135202 3300025898 Bacteria 1397
177 Ga0207710_10095714 3300025900 Bacteria 1395
178 Ga0207688_10027549 3300025901 Bacteria 3126
179 Ga0207688_10039338 3300025901 Bacteria 2626
180 Ga0207688_10177719 3300025901 Bacteria 1268
181 Ga0207647_10027067 3300025904 Bacteria 3742
182 Ga0207699_10009424 3300025906 Bacteria 4861
183 Ga0207699_10072846 3300025906 Bacteria 2105
184 Ga0207699_10101322 3300025906 Bacteria 1828
185 Ga0207645_10059587 3300025907 Bacteria 2438
186 Ga0207645_10141037 3300025907 Bacteria 1570
187 Ga0207705_10346623 3300025909 Bacteria 1144
188 Ga0207654_10003986 3300025911 Bacteria 7435
189 Ga0207654_10269532 3300025911 Bacteria 1148
190 Ga0207707_10004597 3300025912 Bacteria 12121
191 Ga0207707_10038675 3300025912 Bacteria 4169
192 Ga0207695_10099471 3300025913 Bacteria 2906
193 Ga0207695_10177171 3300025913 Bacteria 2054
194 Ga0207695_10338930 3300025913 Bacteria 1391
195 Ga0207671_10193821 3300025914 Bacteria 1585
196 Ga0207671_10382193 3300025914 Bacteria 1119
197 Ga0207693_10049103 3300025915 Bacteria 3313
198 Ga0207693_10077073 3300025915 Bacteria 2611
199 Ga0207663_10020332 3300025916 Bacteria 3757
200 Ga0207660_10058097 3300025917 Bacteria 2772
201 Ga0207660_10128339 3300025917 Bacteria 1928
202 Ga0207660_10461130 3300025917 Bacteria 1028
203 Ga0207652_10007612 3300025921 Bacteria 8718
204 Ga0207652_10477590 3300025921 Bacteria 1123
205 Ga0207681_10095627 3300025923 Bacteria 2131
206 Ga0207694_10069430 3300025924 Bacteria 2752
207 Ga0207659_10207274 3300025926 Bacteria 1569
208 Ga0207687_10025558 3300025927 Bacteria 3952
209 Ga0207687_10216951 3300025927 Bacteria 1504
210 Ga0207700_10030218 3300025928 Bacteria 3834
211 Ga0207700_10031283 3300025928 Bacteria 3779
212 Ga0207700_10108714 3300025928 Bacteria 2227
213 Ga0207700_10470486 3300025928 Bacteria 1110
214 Ga0207664_10239096 3300025929 Bacteria 1581
215 Ga0207706_10056205 3300025933 Bacteria 3471
216 Ga0207706_10089008 3300025933 Bacteria 2714
217 Ga0207686_10060338 3300025934 Bacteria 2400
218 Ga0207709_10021655 3300025935 Bacteria 3640
219 Ga0207670_10323480 3300025936 Bacteria 1214
220 Ga0207665_10028573 3300025939 Bacteria 3684
221 Ga0207691_10036011 3300025940 Bacteria 4587
222 Ga0207711_10051590 3300025941 Bacteria 3523
223 Ga0207689_10014451 3300025942 Bacteria 6716
224 Ga0207689_10125921 3300025942 Bacteria 2107
225 Ga0207689_10179042 3300025942 Bacteria 1748
226 Ga0207661_10002953 3300025944 Bacteria 11757
227 Ga0207661_10017444 3300025944 Bacteria 5314
228 Ga0207679_10030648 3300025945 Bacteria 3758
229 Ga0207679_10090369 3300025945 Bacteria 2367
230 Ga0207667_10400785 3300025949 Bacteria 1397
231 Ga0207667_10657285 3300025949 Bacteria 1053
232 Ga0207712_10321024 3300025961 Bacteria 1278
233 Ga0207712_10434823 3300025961 Bacteria 1110
234 Ga0207668_10010865 3300025972 Bacteria 5516
235 Ga0207668_10030991 3300025972 Bacteria 3518
236 Ga0207668_10157913 3300025972 Bacteria 1763
237 Ga0207668_10268115 3300025972 Bacteria 1394
238 Ga0207677_10321347 3300026023 Bacteria 1286
239 Ga0207703_10344667 3300026035 Bacteria 1370
240 Ga0207639_10138060 3300026041 Bacteria 2028
241 Ga0207639_10319733 3300026041 Bacteria 1378
242 Ga0207639_10666430 3300026041 Bacteria 963
243 Ga0207678_10003472 3300026067 Bacteria 14191
244 Ga0207678_10068008 3300026067 Bacteria 3057
245 Ga0207678_10077553 3300026067 Bacteria 2846
246 Ga0207678_10149884 3300026067 Bacteria 1991
247 Ga0207708_10059862 3300026075 Bacteria 2907
248 Ga0207702_10477171 3300026078 Bacteria 1213
249 Ga0207702_10559703 3300026078 Bacteria 1119
250 Ga0207702_10695437 3300026078 Bacteria 1002
251 Ga0207641_10235857 3300026088 Bacteria 1702
252 Ga0207648_10048143 3300026089 Bacteria 3733
253 Ga0207648_10117006 3300026089 Bacteria 2343
254 Ga0207676_10011441 3300026095 Bacteria 6342
255 Ga0207674_10079911 3300026116 Bacteria 3273
256 Ga0207674_10314745 3300026116 Bacteria 1514
257 Ga0207674_10359564 3300026116 Bacteria 1407
258 Ga0207675_100111738 3300026118 Bacteria 2578
259 Ga0207675_100934028 3300026118 Bacteria 884
260 Ga0207683_10022563 3300026121 Bacteria 5404
261 Ga0207683_10046736 3300026121 Bacteria 3790
262 Ga0207683_10101208 3300026121 Bacteria 2573
263 Ga0207683_10282112 3300026121 Bacteria 1518
264 Ga0207698_10066539 3300026142 Bacteria 2837
265 Ga0207698_10121028 3300026142 Bacteria 2215
266 Ga0207698_10158514 3300026142 Bacteria 1976
267 Ga0207698_10732742 3300026142 Bacteria 986
268 Ga0209179_1011233 3300027512 Bacteria 1581
269 Ga0268266_10002572 3300028379 Bacteria 19242
270 Ga0268266_10195150 3300028379 Bacteria 1850
271 Ga0268265_10534334 3300028380 Bacteria 1110
272 Ga0268264_10110307 3300028381 Bacteria 2409
273 Ga0307515_10075181 3300028794 Bacteria 4505
274 Ga0307511_10091980 3300030521 Bacteria 2049
275 Ga0307511_10152124 3300030521 Bacteria 1325
276 Ga0307508_10334222 3300031616 Bacteria 1106
277 Ga0307516_10003967 3300031730 Bacteria 18582
278 Ga0307411_10121359 3300032005 Bacteria 1892
279 Ga0307507_10051491 3300033179 Bacteria 3962
280 Ga0373944_0043662 3300035089 Bacteria 1394
281 Ga0373953_0028328 3300035117 Bacteria 2159
282 Ga0373953_0053292 3300035117 Bacteria 1639
283 Ga0373954_0143745 3300035118 Bacteria 1164
284 Ga0373957_0044174 3300035120 Bacteria 1685
285 Ga0373943_0063377 3300035170 Bacteria 1853
286 Ga0373943_0065661 3300035170 Bacteria 1825
287 Ga0373955_0043381 3300035172 Bacteria 2419
288 Ga0373935_0096142 3300035692 Bacteria 1946
289 Ga0373935_0158079 3300035692 Bacteria 1543
290 Ga0373927_0053987 3300035695 Bacteria 2599
291 Ga0373927_0345049 3300035695 Bacteria 981
292 Ga0373933_0072653 3300035724 Bacteria 2095
293 Ga0373933_0085124 3300035724 Bacteria 1944
294 Ga0373947_0078468 3300035725 Bacteria 2038
295 Ga0373925_0089046 3300037068 Bacteria 2357
296 Ga0373925_0737087 3300037068 Bacteria 812
297 Ga0395900_0144447 3300037418 Bacteria 2434
298 Ga0395900_0430804 3300037418 Bacteria 1278
299 Ga0395898_0061962 3300037466 Bacteria 3634
300 Ga0395898_0110483 3300037466 Bacteria 2635
301 Ga0395905_0391002 3300037471 Bacteria 1285
302 Ga0436364_0819459 3300037853 Bacteria 2481
303 Ga0395901_0280812 3300038443 Bacteria 1730
304 Ga0436365_0307257 3300039437 Bacteria 1066
305 Ga0436365_0322079 3300039437 Bacteria 2069
306 Ga0436365_0386501 3300039437 Bacteria 1603
307 Ga0436365_1476851 3300039437 Bacteria 2337
308 Ga0466966_0251201 3300044684 Bacteria 1065
309 Ga0466964_0015910 3300044706 Bacteria 2866
310 Ga0466957_0067477 3300044842 Bacteria 2207
311 Ga0466967_0185436 3300045976 Bacteria 1965
312 Ga0466967_0205963 3300045976 Bacteria 1864
313 Ga0495617_111194 3300046452 Bacteria 886
314 Ga0495592_0094256 3300046454 Bacteria 2143
315 Ga0495603_0036150 3300046455 Bacteria 2965
316 Ga0495629_0077186 3300046459 Bacteria 2325
317 Ga0495638_0085725 3300046460 Bacteria 1904
318 Ga0495638_0303857 3300046460 Bacteria 858
319 Ga0495651_0078144 3300046462 Bacteria 2503
320 Ga0495653_0123959 3300046463 Bacteria 1837
321 Ga0495580_0067166 3300046472 Bacteria 2509
322 Ga0495580_0195897 3300046472 Bacteria 1393
323 Ga0495582_0226958 3300046473 Bacteria 1069
324 Ga0495639_0062634 3300046475 Bacteria 1706
325 Ga0495664_0020079 3300046477 Bacteria 3849
326 Ga0495584_0085821 3300046491 Bacteria 1586
327 Ga0495585_0045567 3300046492 Bacteria 2447
328 Ga0495585_0057859 3300046492 Bacteria 2139
329 Ga0495585_0179308 3300046492 Bacteria 1090
330 Ga0495594_0068385 3300046499 Bacteria 1973
331 Ga0495607_0201123 3300046501 Bacteria 986
332 Ga0495616_0150494 3300046513 Bacteria 1053
333 Ga0495618_0028066 3300046514 Bacteria 3507
334 Ga0495618_0142079 3300046514 Bacteria 1535
335 Ga0495628_0115008 3300046516 Bacteria 2066
336 Ga0495630_0136812 3300046517 Bacteria 1861
337 Ga0495630_0245800 3300046517 Bacteria 1367
338 Ga0495632_0092402 3300046519 Bacteria 1433
339 Ga0495652_0107270 3300046529 Bacteria 2253
340 Ga0495652_0278139 3300046529 Bacteria 1227
341 Ga0495665_0114325 3300046531 Bacteria 1414
342 Ga0495640_0067602 3300046533 Bacteria 2406
343 Ga0495640_0340791 3300046533 Bacteria 926
344 Ga0495587_0054034 3300046536 Bacteria 2367
345 Ga0495598_0006756 3300046537 Bacteria 2602
346 Ga0495645_0001274 3300046543 Bacteria 17169
347 Ga0495645_0023733 3300046543 Bacteria 4444
348 Ga0495667_0173186 3300046559 Bacteria 1386
349 Ga0495656_0103100 3300046615 Bacteria 1322
350 Ga0495668_0033297 3300046616 Bacteria 2896
351 Ga0495634_0036105 3300046642 Bacteria 3381
352 Ga0495634_0350942 3300046642 Bacteria 883
353 Ga0495635_0075709 3300046663 Bacteria 2306
354 Ga0495659_0022420 3300046664 Bacteria 2137
355 Ga0495657_0060651 3300046675 Bacteria 2505
356 Ga0495599_0038423 3300046678 Bacteria 3008
357 Ga0495623_0276356 3300046679 Bacteria 936
358 Ga0495646_0065296 3300046680 Bacteria 2155
359 Ga0495646_0096640 3300046680 Bacteria 1698
360 Ga0495658_0148364 3300046683 Bacteria 1439
361 Ga0495658_0206613 3300046683 Bacteria 1226
362 Ga0495658_0229371 3300046683 Bacteria 1164
363 Ga0495624_0051282 3300046690 Bacteria 2612
364 Ga0495670_0054823 3300046691 Bacteria 1998
365 Ga0495589_0188519 3300046794 Bacteria 976
366 Ga0495600_0059009 3300046809 Bacteria 2506
367 Ga0495674_0038132 3300047319 Bacteria 4315
368 Ga0495674_0598817 3300047319 Bacteria 873
369 Ga0495680_0048580 3300047322 Bacteria 3331
370 Ga0495680_0433762 3300047322 Bacteria 902
371 Ga0495675_0107764 3300047444 Bacteria 1740
372 Ga0495684_0136518 3300047471 Bacteria 1840
373 Ga0495593_0013126 3300047673 Bacteria 4730
374 Ga0495602_0028167 3300048088 Bacteria 5381
375 Ga0496100_0019580 3300048903 Bacteria 4041
376 Ga0496100_0344624 3300048903 Bacteria 1124
377 Ga0496100_0453652 3300048903 Bacteria 983
378 Ga0496102_0009105 3300048905 Bacteria 8521
379 Ga0496102_0033820 3300048905 Bacteria 4596
380 Ga0496102_0157264 3300048905 Bacteria 2137
381 Ga0496103_0085439 3300048906 Bacteria 1988
382 Ga0496104_0009104 3300048907 Bacteria 8832
383 Ga0496104_0713798 3300048907 Bacteria 910
384 Ga0496105_0033056 3300048908 Bacteria 4246
385 Ga0496106_0010522 3300048909 Bacteria 6833
386 Ga0496106_0010776 3300048909 Bacteria 6755
387 Ga0496106_0015830 3300048909 Bacteria 5578
388 Ga0496106_0064750 3300048909 Bacteria 2782
389 Ga0496106_0362157 3300048909 Bacteria 1165
390 Ga0496107_0004840 3300048910 Bacteria 9144
391 Ga0496107_0038067 3300048910 Bacteria 3452
392 Ga0496107_0348436 3300048910 Bacteria 1102
393 Ga0496108_0000392 3300048911 Bacteria 36249
394 Ga0496108_0033055 3300048911 Bacteria 4298
395 Ga0496108_0173613 3300048911 Bacteria 1865
396 Ga0496109_0000509 3300048912 Bacteria 33001
397 Ga0496109_0021973 3300048912 Bacteria 5648
398 Ga0496110_0002823 3300048913 Bacteria 13112
399 Ga0496110_0024278 3300048913 Bacteria 5165
400 Ga0496110_0164285 3300048913 Bacteria 2013
401 Ga0496111_0022655 3300048914 Bacteria 4400
402 Ga0496112_0001604 3300048915 Bacteria 17489
403 Ga0496112_0022947 3300048915 Bacteria 5955
404 Ga0496112_0120193 3300048915 Bacteria 2597
405 Ga0496112_0149898 3300048915 Bacteria 2299
406 Ga0496113_0057085 3300048916 Bacteria 2932
407 Ga0496113_0088782 3300048916 Bacteria 2378
408 Ga0496114_0037785 3300048917 Bacteria 3994
409 Ga0496114_0143888 3300048917 Bacteria 2066
410 Ga0496114_0184522 3300048917 Bacteria 1823
411 Ga0496115_0056345 3300048918 Bacteria 3159
412 Ga0496117_0009803 3300048920 Bacteria 8831
413 Ga0496117_0047849 3300048920 Bacteria 3062
414 Ga0496118_0004079 3300048921 Bacteria 17718
415 Ga0496118_0018456 3300048921 Bacteria 6294
416 Ga0496121_0003552 3300048924 Bacteria 22075
417 Ga0496121_0038816 3300048924 Bacteria 4208
418 Ga0496121_0150823 3300048924 Bacteria 1711
419 Ga0496121_0175073 3300048924 Bacteria 1554
420 Ga0496122_0017207 3300048925 Bacteria 6776
421 Ga0496123_0022865 3300048926 Bacteria 4803
422 Ga0496124_0002443 3300048927 Bacteria 24353
423 Ga0496125_0054251 3300048928 Bacteria 3278
424 Ga0496125_0350524 3300048928 Bacteria 882
425 Ga0496126_0004189 3300048929 Bacteria 17378
426 Ga0496126_0030836 3300048929 Bacteria 5075
427 Ga0496126_0127895 3300048929 Bacteria 2197
428 Ga0496126_0196569 3300048929 Bacteria 1705
429 Ga0501043_0289831 3300049579 Bacteria 1253
430 Ga0501046_0419835 3300049580 Bacteria 964
431 Ga0501047_0156403 3300049581 Bacteria 2153
432 Ga0501070_0092604 3300049586 Bacteria 2501
433 Ga0501073_0088663 3300049589 Bacteria 2151
434 Ga0501074_0224799 3300049590 Bacteria 1336
435 Ga0501080_0032454 3300049742 Bacteria 4871
436 Ga0501035_0626307 3300049822 Bacteria 874
437 Ga0501044_0181780 3300049823 Bacteria 2069
438 nmdc:mga03n38_448_c1 3300050490 Bacteria 10279
439 nmdc:mga06z11_22234_c1 3300050494 Bacteria 2959
440 nmdc:mga06z11_71132_c1 3300050494 Bacteria 1841
441 nmdc:mga07m45_253951_c1 3300050496 Bacteria 1023
442 nmdc:mga07m45_36235_c1 3300050496 Bacteria 2747
443 nmdc:mga07m45_80104_c1 3300050496 Bacteria 1865
444 nmdc:mga08y16_205945_c1 3300050511 Bacteria 2038
445 nmdc:mga0rr50_113206_c1 3300050513 Bacteria 2150
446 Ga0495601_0081104 3300053077 Bacteria 2082
447 Ga0495612_0052841 3300053078 Bacteria 1672
448 Ga0495612_0137972 3300053078 Bacteria 1056
449 Ga0500635_0001844 3300053080 Bacteria 5177
450 Ga0500635_0024536 3300053080 Bacteria 1892
451 Ga0500566_0005672 3300053094 Bacteria 7420
452 Ga0500566_0065901 3300053094 Bacteria 2042
453 Ga0500640_000168 3300053095 Bacteria 13302
454 Ga0500572_028802 3300053111 Bacteria 1531
455 Ga0500591_032578 3300053115 Bacteria 2509
456 Ga0500595_043822 3300053119 Bacteria 1422
457 Ga0500608_078351 3300053122 Bacteria 1563
458 Ga0500614_014938 3300053123 Bacteria 1726
459 Ga0500642_0121538 3300053130 Bacteria 1222
460 Ga0500559_0013716 3300053136 Bacteria 3427
461 Ga0500568_0006530 3300053139 Bacteria 5843
462 Ga0500573_0138422 3300053140 Bacteria 1342
463 Ga0500577_0170588 3300053142 Bacteria 930
464 Ga0500590_081771 3300053148 Bacteria 1585
465 Ga0500590_121511 3300053148 Bacteria 1223
466 Ga0500590_139346 3300053148 Bacteria 1111
467 Ga0500603_013725 3300053150 Bacteria 1882
468 Ga0500603_038176 3300053150 Bacteria 1270
469 Ga0500638_081804 3300053162 Bacteria 1532
470 Ga0500639_000125 3300053163 Bacteria 36885
471 Ga0500639_058918 3300053163 Bacteria 1983
472 Ga0500636_0007829 3300053177 Bacteria 6179
473 Ga0500552_001226 3300053733 Bacteria 2432
474 Ga0500601_004601 3300053737 Bacteria 1505

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0737087 Ga0373925_0737087_22_711 224
2 3300046794 Ga0495589_0188519 Ga0495589_0188519_282_962 224
3 iso_pu_bacteria 2513237101 2513698857 224
4 3300025927 Ga0207687_10216951 Ga0207687_102169512 235
5 3300026142 Ga0207698_10066539 Ga0207698_100665392 235
6 3300005616 Ga0068852_100676606 Ga0068852_1006766062 237
7 3300009545 Ga0105237_10168732 Ga0105237_101687323 237
8 3300013296 Ga0157374_10021300 Ga0157374_100213004 237
9 3300048909 Ga0496106_0362157 Ga0496106_0362157_413_1132 237
10 3300050494 nmdc:mga06z11_22234_c1 nmdc:mga06z11_22234_c1_1811_2539 237
11 3300050496 nmdc:mga07m45_253951_c1 nmdc:mga07m45_253951_c1_181_909 237
12 iso_pu_bacteria 2513237098 2513677189 239
13 iso_pu_bacteria 2513237141 2513887891 239
14 iso_pu_bacteria 2517093001 2517104501 239
15 iso_pu_bacteria 2524023210 2524466327 239
16 iso_pu_bacteria 2721755755 2723842657 239
17 iso_pu_bacteria 2728368998 2728749060 239
18 iso_pu_bacteria 2791355199 2793080472 239
19 iso_pu_bacteria 2874604998 2874606668 239
20 iso_pu_bacteria 2874620515 2874625173 239
21 iso_pu_bacteria 2876808645 2876808733 239
22 iso_pu_bacteria 2879110137 2879111997 239
23 iso_pu_bacteria 2889033259 2889034047 239
24 iso_pu_bacteria 2903768456 2903772519 239
25 iso_pu_bacteria 2904666416 2904668727 239
26 iso_pu_bacteria 2904690495 2904697645 239
27 iso_pu_bacteria 2908756301 2908757752 239
28 iso_pu_bacteria 2922361189 2922367448 239
29 iso_pu_bacteria 2922386360 2922389856 239
30 iso_pu_bacteria 3005474847 3005476255 239
31 iso_pu_bacteria 8006964411 8006965964 239
32 iso_pu_bacteria 8006984368 8006989908 239
33 iso_pu_bacteria 8006994254 8006998264 239
34 iso_pu_bacteria 8056673599 8056677887 239
35 iso_pu_bacteria 8056681323 8056686057 239
36 iso_pu_bacteria 8056689827 8056695360 239
37 3300005329 Ga0070683_100125746 Ga0070683_1001257463 241
38 3300005334 Ga0068869_100103714 Ga0068869_1001037143 241
39 3300005337 Ga0070682_100116743 Ga0070682_1001167432 241
40 3300005455 Ga0070663_100009946 Ga0070663_1000099462 241
41 3300005456 Ga0070678_100014130 Ga0070678_1000141305 241
42 3300005616 Ga0068852_100219604 Ga0068852_1002196042 241
43 3300005618 Ga0068864_100030394 Ga0068864_1000303944 241
44 3300006237 Ga0097621_100054611 Ga0097621_1000546113 241
45 3300006358 Ga0068871_100132069 Ga0068871_1001320693 241
46 3300010375 Ga0105239_10101560 Ga0105239_101015603 241
47 3300011119 Ga0105246_10006526 Ga0105246_100065266 241
48 3300013296 Ga0157374_10007199 Ga0157374_100071993 241
49 3300013297 Ga0157378_10126165 Ga0157378_101261653 241
50 3300013306 Ga0163162_10025470 Ga0163162_100254702 241
51 3300013308 Ga0157375_10022464 Ga0157375_100224646 241
52 3300014325 Ga0163163_10007524 Ga0163163_1000752410 241
53 3300014969 Ga0157376_10004438 Ga0157376_100044383 241
54 3300025901 Ga0207688_10027549 Ga0207688_100275492 241
55 3300025909 Ga0207705_10346623 Ga0207705_103466232 241
56 3300026067 Ga0207678_10003472 Ga0207678_1000347214 241
57 3300026118 Ga0207675_100934028 Ga0207675_1009340281 241
58 3300026121 Ga0207683_10022563 Ga0207683_100225635 241
59 3300048903 Ga0496100_0019580 Ga0496100_0019580_2254_3018 241
60 3300048905 Ga0496102_0009105 Ga0496102_0009105_5402_6166 241
61 3300048906 Ga0496103_0085439 Ga0496103_0085439_966_1730 241
62 3300048907 Ga0496104_0009104 Ga0496104_0009104_4370_5134 241
63 3300048908 Ga0496105_0033056 Ga0496105_0033056_2400_3164 241
64 3300048909 Ga0496106_0010522 Ga0496106_0010522_2761_3525 241
65 3300048910 Ga0496107_0004840 Ga0496107_0004840_1061_1825 241
66 3300048911 Ga0496108_0033055 Ga0496108_0033055_904_1668 241
67 3300048912 Ga0496109_0021973 Ga0496109_0021973_3831_4595 241
68 3300048913 Ga0496110_0024278 Ga0496110_0024278_845_1609 241
69 3300048914 Ga0496111_0022655 Ga0496111_0022655_2623_3387 241
70 3300048915 Ga0496112_0149898 Ga0496112_0149898_979_1743 241
71 3300048917 Ga0496114_0037785 Ga0496114_0037785_1287_2051 241
72 3300005441 Ga0070700_100154288 Ga0070700_1001542882 242
73 3300003215 JGI25153J46596_10000371 JGI25153J46596_1000037122 243
74 3300005328 Ga0070676_10070124 Ga0070676_100701242 243
75 3300005328 Ga0070676_10216912 Ga0070676_102169121 243
76 3300005329 Ga0070683_100003434 Ga0070683_1000034343 243
77 3300005331 Ga0070670_100203033 Ga0070670_1002030331 243
78 3300005336 Ga0070680_100179591 Ga0070680_1001795912 243
79 3300005336 Ga0070680_100353003 Ga0070680_1003530032 243
80 3300005337 Ga0070682_100030922 Ga0070682_1000309224 243
81 3300005338 Ga0068868_100085990 Ga0068868_1000859903 243
82 3300005339 Ga0070660_100333375 Ga0070660_1003333752 243
83 3300005340 Ga0070689_100233874 Ga0070689_1002338742 243
84 3300005341 Ga0070691_10079547 Ga0070691_100795472 243
85 3300005347 Ga0070668_100027647 Ga0070668_1000276475 243
86 3300005347 Ga0070668_100044624 Ga0070668_1000446243 243
87 3300005347 Ga0070668_100379986 Ga0070668_1003799861 243
88 3300005353 Ga0070669_100314843 Ga0070669_1003148432 243
89 3300005356 Ga0070674_100119052 Ga0070674_1001190523 243
90 3300005365 Ga0070688_100164938 Ga0070688_1001649382 243
91 3300005367 Ga0070667_100220150 Ga0070667_1002201502 243
92 3300005434 Ga0070709_10086101 Ga0070709_100861012 243
93 3300005434 Ga0070709_10115621 Ga0070709_101156213 243
94 3300005435 Ga0070714_100044149 Ga0070714_1000441494 243
95 3300005435 Ga0070714_100248501 Ga0070714_1002485012 243
96 3300005436 Ga0070713_100005334 Ga0070713_1000053343 243
97 3300005436 Ga0070713_100028331 Ga0070713_1000283313 243
98 3300005436 Ga0070713_100544532 Ga0070713_1005445321 243
99 3300005437 Ga0070710_10010883 Ga0070710_100108833 243
100 3300005438 Ga0070701_10204181 Ga0070701_102041811 243
101 3300005439 Ga0070711_100006314 Ga0070711_1000063143 243
102 3300005439 Ga0070711_100027834 Ga0070711_1000278341 243
103 3300005439 Ga0070711_100186816 Ga0070711_1001868162 243
104 3300005455 Ga0070663_100041847 Ga0070663_1000418474 243
105 3300005455 Ga0070663_100189560 Ga0070663_1001895602 243
106 3300005455 Ga0070663_100242256 Ga0070663_1002422562 243
107 3300005456 Ga0070678_100067232 Ga0070678_1000672322 243
108 3300005456 Ga0070678_100340869 Ga0070678_1003408691 243
109 3300005457 Ga0070662_100038959 Ga0070662_1000389594 243
110 3300005457 Ga0070662_100150407 Ga0070662_1001504072 243
111 3300005457 Ga0070662_100239147 Ga0070662_1002391471 243
112 3300005458 Ga0070681_10036493 Ga0070681_100364933 243
113 3300005458 Ga0070681_10036669 Ga0070681_100366694 243
114 3300005458 Ga0070681_10063863 Ga0070681_100638633 243
115 3300005458 Ga0070681_10066319 Ga0070681_100663191 243
116 3300005459 Ga0068867_100118992 Ga0068867_1001189922 243
117 3300005466 Ga0070685_10091281 Ga0070685_100912813 243
118 3300005468 Ga0070707_100287136 Ga0070707_1002871361 243
119 3300005471 Ga0070698_100197354 Ga0070698_1001973543 243
120 3300005530 Ga0070679_100020155 Ga0070679_1000201553 243
121 3300005530 Ga0070679_100044206 Ga0070679_1000442063 243
122 3300005530 Ga0070679_100200146 Ga0070679_1002001463 243
123 3300005535 Ga0070684_100010514 Ga0070684_1000105148 243
124 3300005535 Ga0070684_100010579 Ga0070684_1000105798 243
125 3300005536 Ga0070697_100271391 Ga0070697_1002713912 243
126 3300005536 Ga0070697_100407254 Ga0070697_1004072541 243
127 3300005539 Ga0068853_100385356 Ga0068853_1003853562 243
128 3300005543 Ga0070672_100213802 Ga0070672_1002138022 243
129 3300005546 Ga0070696_100340016 Ga0070696_1003400162 243
130 3300005548 Ga0070665_100082915 Ga0070665_1000829153 243
131 3300005548 Ga0070665_100298902 Ga0070665_1002989022 243
132 3300005563 Ga0068855_100117899 Ga0068855_1001178992 243
133 3300005563 Ga0068855_100244621 Ga0068855_1002446214 243
134 3300005563 Ga0068855_100353404 Ga0068855_1003534042 243
135 3300005564 Ga0070664_100158597 Ga0070664_1001585973 243
136 3300005564 Ga0070664_100482562 Ga0070664_1004825622 243
137 3300005577 Ga0068857_100131062 Ga0068857_1001310622 243
138 3300005577 Ga0068857_100300780 Ga0068857_1003007802 243
139 3300005616 Ga0068852_100112957 Ga0068852_1001129573 243
140 3300005616 Ga0068852_100324664 Ga0068852_1003246642 243
141 3300005719 Ga0068861_100089955 Ga0068861_1000899553 243
142 3300005719 Ga0068861_100127997 Ga0068861_1001279972 243
143 3300005841 Ga0068863_100225733 Ga0068863_1002257332 243
144 3300005842 Ga0068858_100021643 Ga0068858_1000216437 243
145 3300005843 Ga0068860_100200531 Ga0068860_1002005313 243
146 3300005843 Ga0068860_100380379 Ga0068860_1003803792 243
147 3300005844 Ga0068862_100172610 Ga0068862_1001726102 243
148 3300005844 Ga0068862_100243072 Ga0068862_1002430721 243
149 3300005937 Ga0081455_10001281 Ga0081455_1000128131 243
150 3300005937 Ga0081455_10038108 Ga0081455_100381084 243
151 3300005981 Ga0081538_10085961 Ga0081538_100859612 243
152 3300005983 Ga0081540_1008353 Ga0081540_10083533 243
153 3300005983 Ga0081540_1020858 Ga0081540_10208584 243
154 3300005983 Ga0081540_1089061 Ga0081540_10890612 243
155 3300005985 Ga0081539_10001606 Ga0081539_100016062 243
156 3300005985 Ga0081539_10033579 Ga0081539_100335792 243
157 3300006028 Ga0070717_10025976 Ga0070717_100259766 243
158 3300006038 Ga0075365_10079992 Ga0075365_100799923 243
159 3300006038 Ga0075365_10104682 Ga0075365_101046822 243
160 3300006038 Ga0075365_10300075 Ga0075365_103000752 243
161 3300006048 Ga0075363_100092193 Ga0075363_1000921932 243
162 3300006051 Ga0075364_10134586 Ga0075364_101345863 243
163 3300006058 Ga0075432_10043244 Ga0075432_100432442 243
164 3300006173 Ga0070716_100055960 Ga0070716_1000559603 243
165 3300006175 Ga0070712_100036260 Ga0070712_1000362603 243
166 3300006177 Ga0075362_10025287 Ga0075362_100252876 243
167 3300006178 Ga0075367_10017544 Ga0075367_100175443 243
168 3300006178 Ga0075367_10075768 Ga0075367_100757682 243
169 3300006237 Ga0097621_100529196 Ga0097621_1005291962 243
170 3300006353 Ga0075370_10074220 Ga0075370_100742202 243
171 3300006353 Ga0075370_10289413 Ga0075370_102894132 243
172 3300006358 Ga0068871_100238078 Ga0068871_1002380781 243
173 3300006871 Ga0075434_100292971 Ga0075434_1002929712 243
174 3300006881 Ga0068865_100043769 Ga0068865_1000437694 243
175 3300006914 Ga0075436_100416412 Ga0075436_1004164121 243
176 3300007788 Ga0099795_10031402 Ga0099795_100314022 243
177 3300009092 Ga0105250_10165453 Ga0105250_101654531 243
178 3300009093 Ga0105240_10113119 Ga0105240_101131192 243
179 3300009093 Ga0105240_10223865 Ga0105240_102238653 243
180 3300009094 Ga0111539_10216329 Ga0111539_102163292 243
181 3300009101 Ga0105247_10168258 Ga0105247_101682582 243
182 3300009148 Ga0105243_10062938 Ga0105243_100629383 243
183 3300009148 Ga0105243_10106362 Ga0105243_101063622 243
184 3300009174 Ga0105241_10040357 Ga0105241_100403572 243
185 3300009174 Ga0105241_10042226 Ga0105241_100422265 243
186 3300009174 Ga0105241_10318789 Ga0105241_103187892 243
187 3300009545 Ga0105237_10053078 Ga0105237_100530782 243
188 3300009545 Ga0105237_10117705 Ga0105237_101177052 243
189 3300009545 Ga0105237_10289773 Ga0105237_102897732 243
190 3300009545 Ga0105237_11043791 Ga0105237_110437911 243
191 3300009551 Ga0105238_10349255 Ga0105238_103492552 243
192 3300009551 Ga0105238_10517482 Ga0105238_105174822 243
193 3300010375 Ga0105239_10088717 Ga0105239_100887174 243
194 3300010375 Ga0105239_10228164 Ga0105239_102281642 243
195 3300010375 Ga0105239_10325840 Ga0105239_103258402 243
196 3300011119 Ga0105246_10114529 Ga0105246_101145292 243
197 3300011119 Ga0105246_10136335 Ga0105246_101363351 243
198 3300013104 Ga0157370_10031235 Ga0157370_100312357 243
199 3300013104 Ga0157370_10303380 Ga0157370_103033802 243
200 3300013105 Ga0157369_10016172 Ga0157369_100161724 243
201 3300013105 Ga0157369_10047280 Ga0157369_100472804 243
202 3300013105 Ga0157369_10267371 Ga0157369_102673713 243
203 3300013105 Ga0157369_10354879 Ga0157369_103548792 243
204 3300013296 Ga0157374_10328196 Ga0157374_103281962 243
205 3300013297 Ga0157378_10402826 Ga0157378_104028261 243
206 3300013306 Ga0163162_10039746 Ga0163162_100397464 243
207 3300013306 Ga0163162_10279493 Ga0163162_102794933 243
208 3300013307 Ga0157372_10389211 Ga0157372_103892112 243
209 3300013307 Ga0157372_10449992 Ga0157372_104499922 243
210 3300013308 Ga0157375_10215594 Ga0157375_102155944 243
211 3300014325 Ga0163163_10084192 Ga0163163_100841924 243
212 3300014969 Ga0157376_10145245 Ga0157376_101452452 243
213 3300017792 Ga0163161_10051367 Ga0163161_100513672 243
214 3300021384 Ga0213876_10122996 Ga0213876_101229962 243
215 3300025253 Ga0209677_102393 Ga0209677_1023933 243
216 3300025272 Ga0209455_1013177 Ga0209455_10131772 243
217 3300025273 Ga0209673_1036294 Ga0209673_10362942 243
218 3300025295 Ga0209564_1002696 Ga0209564_100269611 243
219 3300025297 Ga0209758_1000344 Ga0209758_100034425 243
220 3300025297 Ga0209758_1000903 Ga0209758_100090321 243
221 3300025297 Ga0209758_1047140 Ga0209758_10471401 243
222 3300025299 Ga0209256_1016642 Ga0209256_10166423 243
223 3300025315 Ga0207697_10055493 Ga0207697_100554932 243
224 3300025885 Ga0207653_10082344 Ga0207653_100823442 243
225 3300025898 Ga0207692_10005012 Ga0207692_100050121 243
226 3300025898 Ga0207692_10014618 Ga0207692_100146183 243
227 3300025898 Ga0207692_10135202 Ga0207692_101352021 243
228 3300025900 Ga0207710_10095714 Ga0207710_100957142 243
229 3300025901 Ga0207688_10039338 Ga0207688_100393382 243
230 3300025901 Ga0207688_10177719 Ga0207688_101777191 243
231 3300025904 Ga0207647_10027067 Ga0207647_100270674 243
232 3300025906 Ga0207699_10009424 Ga0207699_100094243 243
233 3300025906 Ga0207699_10072846 Ga0207699_100728462 243
234 3300025906 Ga0207699_10101322 Ga0207699_101013223 243
235 3300025907 Ga0207645_10059587 Ga0207645_100595872 243
236 3300025907 Ga0207645_10141037 Ga0207645_101410372 243
237 3300025911 Ga0207654_10003986 Ga0207654_100039865 243
238 3300025911 Ga0207654_10269532 Ga0207654_102695321 243
239 3300025912 Ga0207707_10004597 Ga0207707_100045978 243
240 3300025912 Ga0207707_10038675 Ga0207707_100386754 243
241 3300025913 Ga0207695_10099471 Ga0207695_100994714 243
242 3300025913 Ga0207695_10177171 Ga0207695_101771713 243
243 3300025913 Ga0207695_10338930 Ga0207695_103389302 243
244 3300025914 Ga0207671_10193821 Ga0207671_101938212 243
245 3300025914 Ga0207671_10382193 Ga0207671_103821932 243
246 3300025915 Ga0207693_10049103 Ga0207693_100491033 243
247 3300025915 Ga0207693_10077073 Ga0207693_100770731 243
248 3300025916 Ga0207663_10020332 Ga0207663_100203321 243
249 3300025917 Ga0207660_10058097 Ga0207660_100580974 243
250 3300025917 Ga0207660_10128339 Ga0207660_101283393 243
251 3300025917 Ga0207660_10461130 Ga0207660_104611302 243
252 3300025921 Ga0207652_10007612 Ga0207652_100076123 243
253 3300025921 Ga0207652_10477590 Ga0207652_104775901 243
254 3300025923 Ga0207681_10095627 Ga0207681_100956272 243
255 3300025924 Ga0207694_10069430 Ga0207694_100694302 243
256 3300025926 Ga0207659_10207274 Ga0207659_102072743 243
257 3300025927 Ga0207687_10025558 Ga0207687_100255585 243
258 3300025928 Ga0207700_10030218 Ga0207700_100302185 243
259 3300025928 Ga0207700_10031283 Ga0207700_100312834 243
260 3300025928 Ga0207700_10108714 Ga0207700_101087142 243
261 3300025928 Ga0207700_10470486 Ga0207700_104704861 243
262 3300025929 Ga0207664_10239096 Ga0207664_102390962 243
263 3300025933 Ga0207706_10056205 Ga0207706_100562053 243
264 3300025933 Ga0207706_10089008 Ga0207706_100890083 243
265 3300025934 Ga0207686_10060338 Ga0207686_100603383 243
266 3300025935 Ga0207709_10021655 Ga0207709_100216552 243
267 3300025936 Ga0207670_10323480 Ga0207670_103234802 243
268 3300025939 Ga0207665_10028573 Ga0207665_100285732 243
269 3300025940 Ga0207691_10036011 Ga0207691_100360114 243
270 3300025941 Ga0207711_10051590 Ga0207711_100515903 243
271 3300025942 Ga0207689_10014451 Ga0207689_100144517 243
272 3300025942 Ga0207689_10125921 Ga0207689_101259214 243
273 3300025942 Ga0207689_10179042 Ga0207689_101790422 243
274 3300025944 Ga0207661_10002953 Ga0207661_100029533 243
275 3300025944 Ga0207661_10017444 Ga0207661_100174445 243
276 3300025945 Ga0207679_10030648 Ga0207679_100306486 243
277 3300025945 Ga0207679_10090369 Ga0207679_100903692 243
278 3300025949 Ga0207667_10400785 Ga0207667_104007852 243
279 3300025949 Ga0207667_10657285 Ga0207667_106572852 243
280 3300025961 Ga0207712_10321024 Ga0207712_103210242 243
281 3300025961 Ga0207712_10434823 Ga0207712_104348232 243
282 3300025972 Ga0207668_10010865 Ga0207668_100108656 243
283 3300025972 Ga0207668_10030991 Ga0207668_100309916 243
284 3300025972 Ga0207668_10157913 Ga0207668_101579132 243
285 3300025972 Ga0207668_10268115 Ga0207668_102681152 243
286 3300026023 Ga0207677_10321347 Ga0207677_103213472 243
287 3300026035 Ga0207703_10344667 Ga0207703_103446672 243
288 3300026041 Ga0207639_10138060 Ga0207639_101380602 243
289 3300026041 Ga0207639_10319733 Ga0207639_103197332 243
290 3300026041 Ga0207639_10666430 Ga0207639_106664302 243
291 3300026067 Ga0207678_10068008 Ga0207678_100680083 243
292 3300026067 Ga0207678_10077553 Ga0207678_100775532 243
293 3300026067 Ga0207678_10149884 Ga0207678_101498842 243
294 3300026075 Ga0207708_10059862 Ga0207708_100598622 243
295 3300026078 Ga0207702_10477171 Ga0207702_104771711 243
296 3300026078 Ga0207702_10559703 Ga0207702_105597032 243
297 3300026078 Ga0207702_10695437 Ga0207702_106954371 243
298 3300026088 Ga0207641_10235857 Ga0207641_102358572 243
299 3300026089 Ga0207648_10048143 Ga0207648_100481434 243
300 3300026089 Ga0207648_10117006 Ga0207648_101170062 243
301 3300026095 Ga0207676_10011441 Ga0207676_100114413 243
302 3300026116 Ga0207674_10079911 Ga0207674_100799115 243
303 3300026116 Ga0207674_10314745 Ga0207674_103147453 243
304 3300026116 Ga0207674_10359564 Ga0207674_103595642 243
305 3300026118 Ga0207675_100111738 Ga0207675_1001117385 243
306 3300026121 Ga0207683_10046736 Ga0207683_100467365 243
307 3300026121 Ga0207683_10101208 Ga0207683_101012083 243
308 3300026121 Ga0207683_10282112 Ga0207683_102821122 243
309 3300026142 Ga0207698_10121028 Ga0207698_101210282 243
310 3300026142 Ga0207698_10158514 Ga0207698_101585142 243
311 3300026142 Ga0207698_10732742 Ga0207698_107327421 243
312 3300027512 Ga0209179_1011233 Ga0209179_10112331 243
313 3300028379 Ga0268266_10002572 Ga0268266_1000257222 243
314 3300028379 Ga0268266_10195150 Ga0268266_101951501 243
315 3300028380 Ga0268265_10534334 Ga0268265_105343342 243
316 3300028381 Ga0268264_10110307 Ga0268264_101103073 243
317 3300028794 Ga0307515_10075181 Ga0307515_100751815 243
318 3300030521 Ga0307511_10091980 Ga0307511_100919802 243
319 3300030521 Ga0307511_10152124 Ga0307511_101521242 243
320 3300031616 Ga0307508_10334222 Ga0307508_103342222 243
321 3300031730 Ga0307516_10003967 Ga0307516_100039672 243
322 3300032005 Ga0307411_10121359 Ga0307411_101213593 243
323 3300033179 Ga0307507_10051491 Ga0307507_100514912 243
324 3300035089 Ga0373944_0043662 Ga0373944_0043662_439_1182 243
325 3300035117 Ga0373953_0028328 Ga0373953_0028328_281_1027 243
326 3300035117 Ga0373953_0053292 Ga0373953_0053292_804_1544 243
327 3300035118 Ga0373954_0143745 Ga0373954_0143745_139_879 243
328 3300035120 Ga0373957_0044174 Ga0373957_0044174_318_1058 243
329 3300035170 Ga0373943_0063377 Ga0373943_0063377_867_1613 243
330 3300035170 Ga0373943_0065661 Ga0373943_0065661_823_1569 243
331 3300035172 Ga0373955_0043381 Ga0373955_0043381_180_920 243
332 3300035692 Ga0373935_0096142 Ga0373935_0096142_282_1028 243
333 3300035692 Ga0373935_0158079 Ga0373935_0158079_733_1473 243
334 3300035695 Ga0373927_0053987 Ga0373927_0053987_1418_2164 243
335 3300035695 Ga0373927_0345049 Ga0373927_0345049_65_811 243
336 3300035724 Ga0373933_0072653 Ga0373933_0072653_723_1463 243
337 3300035724 Ga0373933_0085124 Ga0373933_0085124_1107_1841 243
338 3300035725 Ga0373947_0078468 Ga0373947_0078468_135_881 243
339 3300037068 Ga0373925_0089046 Ga0373925_0089046_397_1143 243
340 3300037418 Ga0395900_0144447 Ga0395900_0144447_624_1370 243
341 3300037418 Ga0395900_0430804 Ga0395900_0430804_150_899 243
342 3300037466 Ga0395898_0061962 Ga0395898_0061962_981_1730 243
343 3300037466 Ga0395898_0110483 Ga0395898_0110483_307_1053 243
344 3300037471 Ga0395905_0391002 Ga0395905_0391002_49_795 243
345 3300037853 Ga0436364_0819459 Ga0436364_0819459_329_1075 243
346 3300038443 Ga0395901_0280812 Ga0395901_0280812_149_895 243
347 3300039437 Ga0436365_0307257 Ga0436365_0307257_256_996 243
348 3300039437 Ga0436365_0322079 Ga0436365_0322079_1219_1965 243
349 3300039437 Ga0436365_0386501 Ga0436365_0386501_427_1173 243
350 3300039437 Ga0436365_1476851 Ga0436365_1476851_1059_1805 243
351 3300044684 Ga0466966_0251201 Ga0466966_0251201_150_896 243
352 3300044706 Ga0466964_0015910 Ga0466964_0015910_1738_2484 243
353 3300044842 Ga0466957_0067477 Ga0466957_0067477_847_1593 243
354 3300045976 Ga0466967_0185436 Ga0466967_0185436_845_1591 243
355 3300045976 Ga0466967_0205963 Ga0466967_0205963_268_1014 243
356 3300046452 Ga0495617_111194 Ga0495617_111194_105_851 243
357 3300046454 Ga0495592_0094256 Ga0495592_0094256_761_1501 243
358 3300046455 Ga0495603_0036150 Ga0495603_0036150_1699_2445 243
359 3300046459 Ga0495629_0077186 Ga0495629_0077186_659_1405 243
360 3300046460 Ga0495638_0085725 Ga0495638_0085725_916_1662 243
361 3300046460 Ga0495638_0303857 Ga0495638_0303857_62_808 243
362 3300046462 Ga0495651_0078144 Ga0495651_0078144_823_1563 243
363 3300046463 Ga0495653_0123959 Ga0495653_0123959_439_1179 243
364 3300046472 Ga0495580_0067166 Ga0495580_0067166_818_1564 243
365 3300046472 Ga0495580_0195897 Ga0495580_0195897_538_1287 243
366 3300046473 Ga0495582_0226958 Ga0495582_0226958_141_887 243
367 3300046475 Ga0495639_0062634 Ga0495639_0062634_358_1104 243
368 3300046477 Ga0495664_0020079 Ga0495664_0020079_1989_2735 243
369 3300046491 Ga0495584_0085821 Ga0495584_0085821_69_806 243
370 3300046492 Ga0495585_0045567 Ga0495585_0045567_297_1043 243
371 3300046492 Ga0495585_0057859 Ga0495585_0057859_1289_2026 243
372 3300046492 Ga0495585_0179308 Ga0495585_0179308_81_827 243
373 3300046499 Ga0495594_0068385 Ga0495594_0068385_65_811 243
374 3300046501 Ga0495607_0201123 Ga0495607_0201123_141_878 243
375 3300046513 Ga0495616_0150494 Ga0495616_0150494_111_857 243
376 3300046514 Ga0495618_0028066 Ga0495618_0028066_695_1435 243
377 3300046514 Ga0495618_0142079 Ga0495618_0142079_18_764 243
378 3300046516 Ga0495628_0115008 Ga0495628_0115008_1065_1805 243
379 3300046517 Ga0495630_0136812 Ga0495630_0136812_972_1718 243
380 3300046517 Ga0495630_0245800 Ga0495630_0245800_313_1053 243
381 3300046519 Ga0495632_0092402 Ga0495632_0092402_82_828 243
382 3300046529 Ga0495652_0107270 Ga0495652_0107270_921_1661 243
383 3300046529 Ga0495652_0278139 Ga0495652_0278139_297_1043 243
384 3300046531 Ga0495665_0114325 Ga0495665_0114325_16_762 243
385 3300046533 Ga0495640_0067602 Ga0495640_0067602_666_1406 243
386 3300046533 Ga0495640_0340791 Ga0495640_0340791_103_849 243
387 3300046536 Ga0495587_0054034 Ga0495587_0054034_1105_1845 243
388 3300046537 Ga0495598_0006756 Ga0495598_0006756_1834_2580 243
389 3300046543 Ga0495645_0001274 Ga0495645_0001274_9890_10636 243
390 3300046543 Ga0495645_0023733 Ga0495645_0023733_1148_1888 243
391 3300046559 Ga0495667_0173186 Ga0495667_0173186_494_1240 243
392 3300046615 Ga0495656_0103100 Ga0495656_0103100_112_849 243
393 3300046616 Ga0495668_0033297 Ga0495668_0033297_106_843 243
394 3300046642 Ga0495634_0036105 Ga0495634_0036105_2060_2800 243
395 3300046642 Ga0495634_0350942 Ga0495634_0350942_19_765 243
396 3300046663 Ga0495635_0075709 Ga0495635_0075709_1144_1884 243
397 3300046664 Ga0495659_0022420 Ga0495659_0022420_1194_1940 243
398 3300046675 Ga0495657_0060651 Ga0495657_0060651_25_765 243
399 3300046678 Ga0495599_0038423 Ga0495599_0038423_569_1309 243
400 3300046679 Ga0495623_0276356 Ga0495623_0276356_19_765 243
401 3300046680 Ga0495646_0065296 Ga0495646_0065296_25_765 243
402 3300046680 Ga0495646_0096640 Ga0495646_0096640_872_1618 243
403 3300046683 Ga0495658_0148364 Ga0495658_0148364_346_1092 243
404 3300046683 Ga0495658_0206613 Ga0495658_0206613_383_1129 243
405 3300046683 Ga0495658_0229371 Ga0495658_0229371_400_1146 243
406 3300046690 Ga0495624_0051282 Ga0495624_0051282_1682_2428 243
407 3300046691 Ga0495670_0054823 Ga0495670_0054823_412_1158 243
408 3300046809 Ga0495600_0059009 Ga0495600_0059009_650_1390 243
409 3300047319 Ga0495674_0038132 Ga0495674_0038132_2491_3231 243
410 3300047319 Ga0495674_0598817 Ga0495674_0598817_25_771 243
411 3300047322 Ga0495680_0048580 Ga0495680_0048580_1741_2481 243
412 3300047322 Ga0495680_0433762 Ga0495680_0433762_63_809 243
413 3300047444 Ga0495675_0107764 Ga0495675_0107764_544_1284 243
414 3300047471 Ga0495684_0136518 Ga0495684_0136518_96_842 243
415 3300047673 Ga0495593_0013126 Ga0495593_0013126_3652_4398 243
416 3300048088 Ga0495602_0028167 Ga0495602_0028167_3139_3879 243
417 3300048903 Ga0496100_0344624 Ga0496100_0344624_22_762 243
418 3300048903 Ga0496100_0453652 Ga0496100_0453652_175_921 243
419 3300048905 Ga0496102_0033820 Ga0496102_0033820_1988_2734 243
420 3300048905 Ga0496102_0157264 Ga0496102_0157264_1112_1858 243
421 3300048907 Ga0496104_0713798 Ga0496104_0713798_84_830 243
422 3300048909 Ga0496106_0010776 Ga0496106_0010776_5675_6427 243
423 3300048909 Ga0496106_0015830 Ga0496106_0015830_3924_4670 243
424 3300048909 Ga0496106_0064750 Ga0496106_0064750_291_1037 243
425 3300048910 Ga0496107_0038067 Ga0496107_0038067_1157_1903 243
426 3300048910 Ga0496107_0348436 Ga0496107_0348436_130_876 243
427 3300048911 Ga0496108_0000392 Ga0496108_0000392_14403_15149 243
428 3300048911 Ga0496108_0173613 Ga0496108_0173613_765_1511 243
429 3300048912 Ga0496109_0000509 Ga0496109_0000509_9134_9880 243
430 3300048913 Ga0496110_0002823 Ga0496110_0002823_4596_5342 243
431 3300048913 Ga0496110_0164285 Ga0496110_0164285_784_1530 243
432 3300048915 Ga0496112_0001604 Ga0496112_0001604_16729_17475 243
433 3300048915 Ga0496112_0022947 Ga0496112_0022947_3167_3913 243
434 3300048915 Ga0496112_0120193 Ga0496112_0120193_1627_2373 243
435 3300048916 Ga0496113_0057085 Ga0496113_0057085_1614_2360 243
436 3300048916 Ga0496113_0088782 Ga0496113_0088782_75_821 243
437 3300048917 Ga0496114_0143888 Ga0496114_0143888_1000_1746 243
438 3300048917 Ga0496114_0184522 Ga0496114_0184522_341_1087 243
439 3300048918 Ga0496115_0056345 Ga0496115_0056345_2094_2840 243
440 3300048920 Ga0496117_0009803 Ga0496117_0009803_97_849 243
441 3300048920 Ga0496117_0047849 Ga0496117_0047849_2191_2931 243
442 3300048921 Ga0496118_0004079 Ga0496118_0004079_11657_12409 243
443 3300048921 Ga0496118_0018456 Ga0496118_0018456_2773_3513 243
444 3300048924 Ga0496121_0003552 Ga0496121_0003552_15699_16451 243
445 3300048924 Ga0496121_0038816 Ga0496121_0038816_2063_2803 243
446 3300048924 Ga0496121_0150823 Ga0496121_0150823_340_1086 243
447 3300048924 Ga0496121_0175073 Ga0496121_0175073_389_1135 243
448 3300048925 Ga0496122_0017207 Ga0496122_0017207_1191_1937 243
449 3300048926 Ga0496123_0022865 Ga0496123_0022865_1545_2291 243
450 3300048927 Ga0496124_0002443 Ga0496124_0002443_7060_7812 243
451 3300048928 Ga0496125_0054251 Ga0496125_0054251_836_1576 243
452 3300048928 Ga0496125_0350524 Ga0496125_0350524_20_766 243
453 3300048929 Ga0496126_0004189 Ga0496126_0004189_962_1708 243
454 3300048929 Ga0496126_0030836 Ga0496126_0030836_3189_3941 243
455 3300048929 Ga0496126_0127895 Ga0496126_0127895_377_1123 243
456 3300048929 Ga0496126_0196569 Ga0496126_0196569_283_1035 243
457 3300049579 Ga0501043_0289831 Ga0501043_0289831_388_1128 243
458 3300049580 Ga0501046_0419835 Ga0501046_0419835_199_945 243
459 3300049581 Ga0501047_0156403 Ga0501047_0156403_1372_2118 243
460 3300049586 Ga0501070_0092604 Ga0501070_0092604_1313_2059 243
461 3300049589 Ga0501073_0088663 Ga0501073_0088663_652_1398 243
462 3300049590 Ga0501074_0224799 Ga0501074_0224799_539_1285 243
463 3300049742 Ga0501080_0032454 Ga0501080_0032454_333_1079 243
464 3300049822 Ga0501035_0626307 Ga0501035_0626307_102_848 243
465 3300049823 Ga0501044_0181780 Ga0501044_0181780_1206_1952 243
466 3300050490 nmdc:mga03n38_448_c1 nmdc:mga03n38_448_c1_2110_2856 243
467 3300050494 nmdc:mga06z11_71132_c1 nmdc:mga06z11_71132_c1_885_1631 243
468 3300050496 nmdc:mga07m45_36235_c1 nmdc:mga07m45_36235_c1_1734_2480 243
469 3300050496 nmdc:mga07m45_80104_c1 nmdc:mga07m45_80104_c1_235_981 243
470 3300050511 nmdc:mga08y16_205945_c1 nmdc:mga08y16_205945_c1_323_1069 243
471 3300050513 nmdc:mga0rr50_113206_c1 nmdc:mga0rr50_113206_c1_323_1069 243
472 3300053077 Ga0495601_0081104 Ga0495601_0081104_1224_1970 243
473 3300053078 Ga0495612_0052841 Ga0495612_0052841_29_769 243
474 3300053078 Ga0495612_0137972 Ga0495612_0137972_165_905 243
475 3300053080 Ga0500635_0001844 Ga0500635_0001844_4067_4813 243
476 3300053080 Ga0500635_0024536 Ga0500635_0024536_869_1615 243
477 3300053094 Ga0500566_0005672 Ga0500566_0005672_6328_7074 243
478 3300053094 Ga0500566_0065901 Ga0500566_0065901_832_1578 243
479 3300053095 Ga0500640_000168 Ga0500640_000168_583_1329 243
480 3300053111 Ga0500572_028802 Ga0500572_028802_208_954 243
481 3300053115 Ga0500591_032578 Ga0500591_032578_559_1305 243
482 3300053119 Ga0500595_043822 Ga0500595_043822_448_1194 243
483 3300053122 Ga0500608_078351 Ga0500608_078351_610_1356 243
484 3300053123 Ga0500614_014938 Ga0500614_014938_317_1063 243
485 3300053130 Ga0500642_0121538 Ga0500642_0121538_466_1212 243
486 3300053136 Ga0500559_0013716 Ga0500559_0013716_630_1376 243
487 3300053139 Ga0500568_0006530 Ga0500568_0006530_1113_1850 243
488 3300053140 Ga0500573_0138422 Ga0500573_0138422_481_1227 243
489 3300053142 Ga0500577_0170588 Ga0500577_0170588_57_803 243
490 3300053148 Ga0500590_081771 Ga0500590_081771_806_1552 243
491 3300053148 Ga0500590_121511 Ga0500590_121511_265_1011 243
492 3300053148 Ga0500590_139346 Ga0500590_139346_32_778 243
493 3300053150 Ga0500603_013725 Ga0500603_013725_685_1431 243
494 3300053150 Ga0500603_038176 Ga0500603_038176_177_917 243
495 3300053162 Ga0500638_081804 Ga0500638_081804_198_944 243
496 3300053163 Ga0500639_000125 Ga0500639_000125_6418_7164 243
497 3300053163 Ga0500639_058918 Ga0500639_058918_766_1512 243
498 3300053177 Ga0500636_0007829 Ga0500636_0007829_4124_4864 243
499 3300053733 Ga0500552_001226 Ga0500552_001226_947_1693 243
500 3300053737 Ga0500601_004601 Ga0500601_004601_393_1133 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

29

211

0.83

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

32

217

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9359 3 243
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.9277 3 243
3um9-assembly1.cif.gz_B crystal structure of the defluorinating l-2-haloacid dehalogenase bpro0530 0.9227 2 242
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.9221 3 243
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.9141 3 243
ID Description Score Start End Superfamily
1judA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9655 19 90 1.10.150.240
1qh9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9643 18 90 1.10.150.240
1zrnA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9642 19 90 1.10.150.240
1zrmA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9569 19 90 1.10.150.240
3um9A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9502 18 90 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A3S1EH65-F1-model_v4 Haloacid dehalogenase type II 0.9786 14 148
AF-A0A3S0IDG5-F1-model_v4 deleted 0.9781 1 157
AF-A0A401U062-F1-model_v4 Haloacid dehalogenase, type II 0.9759 1 180 GO:0019120
AF-A0A3S0IDG5-F1-model_v4 deleted 0.972 1 157
AF-A0A3S1EH65-F1-model_v4 Haloacid dehalogenase type II 0.9715 14 148

Feature Viewer

pLDDT pTM Quality
89.56 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map