F455556

General Info

Members Datasets Scaffolds Average Seq Length
500 282 473 137

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_101343623|Ga0207675_1013436232
Length 158
Sequence VAERGYRVGPCGEPVRAYRGDVSYSWQDPEAVRFMLDDCTTWAIVGLSGKLDRTAYRIAAMLQQRGKRIVPVHPNAPVVHGEQGYPTLADIPFPIDVVDVFRRSSAAGEVADQAVAVGAKAVWFQLGVIDEAAFARTVGAGVPMVMDTCPAIEWRRRG

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221561 Nocardioides sp. Root151 Isolate Unclassified
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
8 2643221696 Nocardioides sp. Root140 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
11 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
12 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
13 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
14 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
15 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
16 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
17 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
18 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
19 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
20 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
21 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
22 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
267 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
268 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
269 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
277 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
278 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
279 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
280 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
281 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
282 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.6
Metatranscriptomes 1
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 0
Rhizoplane 7.8
Rhizosphere 79
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008654 3300001977 Bacteria 1533
2 JGI24743J22301_10001488 3300001991 Bacteria 3254
3 JGI24744J21845_10010984 3300002077 Bacteria 1854
4 rootH1_10100417 3300003316 Bacteria 1413
5 Ga0070658_10103539 3300005327 Bacteria 2354
6 Ga0070658_10665228 3300005327 Bacteria 904
7 Ga0070658_10820518 3300005327 Bacteria 808
8 Ga0070683_100012981 3300005329 Bacteria 7250
9 Ga0070683_100364625 3300005329 Bacteria 1376
10 Ga0070683_101048832 3300005329 Bacteria 783
11 Ga0070683_101311889 3300005329 Bacteria 696
12 Ga0070690_100132259 3300005330 Bacteria 1686
13 Ga0070670_100399184 3300005331 Bacteria 1214
14 Ga0068869_100264594 3300005334 Bacteria 1378
15 Ga0070680_100743494 3300005336 Bacteria 844
16 Ga0070682_100093992 3300005337 Bacteria 1967
17 Ga0070682_100548870 3300005337 Bacteria 904
18 Ga0068868_100020600 3300005338 Bacteria 4958
19 Ga0068868_101540853 3300005338 Bacteria 623
20 Ga0070660_100093040 3300005339 Bacteria 2380
21 Ga0070660_100614612 3300005339 Bacteria 909
22 Ga0070691_10047047 3300005341 Bacteria 2051
23 Ga0070691_10444396 3300005341 Bacteria 739
24 Ga0070687_100319175 3300005343 Bacteria 992
25 Ga0070692_10588839 3300005345 Bacteria 734
26 Ga0070692_10849985 3300005345 Bacteria 627
27 Ga0070674_100997388 3300005356 Bacteria 735
28 Ga0070674_101558537 3300005356 Bacteria 595
29 Ga0070673_100018597 3300005364 Bacteria 4969
30 Ga0070659_100148050 3300005366 Bacteria 1914
31 Ga0070667_100085762 3300005367 Bacteria 2701
32 Ga0070701_10037878 3300005438 Bacteria 2437
33 Ga0070700_100041645 3300005441 Bacteria 2816
34 Ga0070663_101198339 3300005455 Bacteria 667
35 Ga0070678_100935992 3300005456 Bacteria 794
36 Ga0070681_10001906 3300005458 Bacteria 18811
37 Ga0068867_100001433 3300005459 Bacteria 16515
38 Ga0070684_100012876 3300005535 Bacteria 6722
39 Ga0070684_100116132 3300005535 Bacteria 2404
40 Ga0070672_100008193 3300005543 Bacteria 7142
41 Ga0070672_101066986 3300005543 Bacteria 717
42 Ga0070665_101484390 3300005548 Bacteria 686
43 Ga0068855_101134487 3300005563 Bacteria 816
44 Ga0070664_101282654 3300005564 Bacteria 692
45 Ga0068854_100496883 3300005578 Bacteria 1027
46 Ga0068852_100002562 3300005616 Bacteria 12523
47 Ga0068852_101486893 3300005616 Bacteria 700
48 Ga0068852_101806673 3300005616 Bacteria 634
49 Ga0068864_100166378 3300005618 Bacteria 2008
50 Ga0068864_100755502 3300005618 Bacteria 953
51 Ga0068866_10032465 3300005718 Bacteria 2525
52 Ga0068866_10769153 3300005718 Bacteria 667
53 Ga0068861_100013685 3300005719 Bacteria 5681
54 Ga0068861_100510836 3300005719 Bacteria 1088
55 Ga0068861_101397249 3300005719 Bacteria 684
56 Ga0068870_10025533 3300005840 Bacteria 2934
57 Ga0068870_10816992 3300005840 Bacteria 653
58 Ga0068863_100499934 3300005841 Bacteria 1197
59 Ga0068860_100276835 3300005843 Bacteria 1639
60 Ga0068860_101989158 3300005843 Bacteria 603
61 Ga0068862_101205310 3300005844 Bacteria 756
62 Ga0075365_10013449 3300006038 Bacteria 4896
63 Ga0075365_10083767 3300006038 Bacteria 2163
64 Ga0075365_10145593 3300006038 Bacteria 1646
65 Ga0075365_10318297 3300006038 Bacteria 1096
66 Ga0075365_10523374 3300006038 Bacteria 839
67 Ga0075364_10003064 3300006051 Bacteria 9442
68 Ga0075364_10062813 3300006051 Bacteria 2437
69 Ga0075364_10110297 3300006051 Bacteria 1835
70 Ga0075362_10051601 3300006177 Bacteria 1841
71 Ga0075362_10362643 3300006177 Bacteria 727
72 Ga0075370_10120119 3300006353 Bacteria 1529
73 Ga0075370_10269805 3300006353 Bacteria 1010
74 Ga0075370_10433647 3300006353 Bacteria 790
75 Ga0075428_100047762 3300006844 Bacteria 4700
76 Ga0068865_100045356 3300006881 Bacteria 3013
77 Ga0068865_100358646 3300006881 Bacteria 1183
78 Ga0068865_101026368 3300006881 Bacteria 723
79 Ga0111539_10022230 3300009094 Bacteria 7797
80 Ga0111539_10339388 3300009094 Bacteria 1749
81 Ga0105245_10016577 3300009098 Bacteria 6429
82 Ga0105245_10078238 3300009098 Bacteria 3018
83 Ga0105245_10378591 3300009098 Bacteria 1409
84 Ga0105245_11251203 3300009098 Bacteria 790
85 Ga0105245_12300953 3300009098 Bacteria 593
86 Ga0105245_12779332 3300009098 Bacteria 542
87 Ga0105243_10024765 3300009148 Bacteria 4581
88 Ga0105242_10021730 3300009176 Bacteria 5041
89 Ga0105242_10647015 3300009176 Bacteria 1027
90 Ga0105242_10825015 3300009176 Bacteria 920
91 Ga0105248_10130478 3300009177 Bacteria 2835
92 Ga0105238_10437704 3300009551 Bacteria 1303
93 Ga0105238_11158379 3300009551 Bacteria 797
94 Ga0105249_10523279 3300009553 Bacteria 1234
95 Ga0105246_10138886 3300011119 Bacteria 1825
96 Ga0157343_1041372 3300012488 Bacteria 503
97 Ga0157371_10093677 3300013102 Bacteria 2128
98 Ga0157370_11403723 3300013104 Bacteria 628
99 Ga0163162_10728726 3300013306 Bacteria 1112
100 Ga0157372_10067551 3300013307 Bacteria 4017
101 Ga0157372_10673579 3300013307 Bacteria 1204
102 Ga0157375_10009306 3300013308 Bacteria 8624
103 Ga0157375_10017256 3300013308 Bacteria 6509
104 Ga0157375_11091491 3300013308 Bacteria 934
105 Ga0157375_11700657 3300013308 Bacteria 747
106 Ga0163163_10049546 3300014325 Bacteria 4134
107 Ga0163163_10435565 3300014325 Bacteria 1370
108 Ga0163163_10543075 3300014325 Bacteria 1225
109 Ga0163163_11495422 3300014325 Bacteria 737
110 Ga0157380_10065693 3300014326 Bacteria 2917
111 Ga0157380_10873608 3300014326 Bacteria 923
112 Ga0157380_11288464 3300014326 Bacteria 777
113 Ga0182008_10250772 3300014497 Bacteria 913
114 Ga0157377_10231968 3300014745 Bacteria 1187
115 Ga0163161_10233019 3300017792 Bacteria 1429
116 Ga0197907_11123623 3300020069 Bacteria 788
117 Ga0206354_10323978 3300020081 Bacteria 3279
118 Ga0206353_10208278 3300020082 Bacteria 14312
119 Ga0154015_1275191 3300020610 Bacteria 532
120 Ga0213874_10089622 3300021377 Bacteria 1008
121 Ga0213871_10059555 3300021441 Unclassified 1061
122 Ga0224712_10018275 3300022467 Bacteria 2341
123 Ga0207692_10000047 3300025898 Bacteria 36334
124 Ga0207642_10497866 3300025899 Bacteria 746
125 Ga0207688_10024984 3300025901 Bacteria 3278
126 Ga0207647_10250445 3300025904 Bacteria 1016
127 Ga0207643_10003070 3300025908 Bacteria 8978
128 Ga0207643_10216913 3300025908 Bacteria 1170
129 Ga0207643_10769345 3300025908 Bacteria 623
130 Ga0207705_10023055 3300025909 Bacteria 4439
131 Ga0207707_10001154 3300025912 Bacteria 25064
132 Ga0207660_10002400 3300025917 Bacteria 12308
133 Ga0207660_10548636 3300025917 Bacteria 940
134 Ga0207660_11697705 3300025917 Bacteria 508
135 Ga0207657_10198641 3300025919 Bacteria 1614
136 Ga0207657_10474337 3300025919 Bacteria 981
137 Ga0207652_10003418 3300025921 Bacteria 13100
138 Ga0207681_10729598 3300025923 Bacteria 825
139 Ga0207694_10253073 3300025924 Bacteria 1442
140 Ga0207650_10576462 3300025925 Bacteria 945
141 Ga0207687_10252035 3300025927 Bacteria 1404
142 Ga0207687_10472226 3300025927 Bacteria 1043
143 Ga0207644_10347551 3300025931 Bacteria 1204
144 Ga0207706_10197533 3300025933 Bacteria 1764
145 Ga0207686_10416392 3300025934 Bacteria 1027
146 Ga0207709_10125218 3300025935 Bacteria 1742
147 Ga0207709_10456517 3300025935 Bacteria 989
148 Ga0207670_10660934 3300025936 Bacteria 862
149 Ga0207669_10402275 3300025937 Bacteria 1073
150 Ga0207704_10073340 3300025938 Bacteria 2179
151 Ga0207704_10328920 3300025938 Bacteria 1182
152 Ga0207691_10029408 3300025940 Bacteria 5140
153 Ga0207691_10077632 3300025940 Bacteria 2991
154 Ga0207691_10233719 3300025940 Bacteria 1591
155 Ga0207689_10036305 3300025942 Bacteria 4092
156 Ga0207689_10946768 3300025942 Bacteria 727
157 Ga0207661_10063976 3300025944 Bacteria 2981
158 Ga0207661_10138849 3300025944 Bacteria 2090
159 Ga0207667_10940863 3300025949 Bacteria 854
160 Ga0207667_11139574 3300025949 Bacteria 762
161 Ga0207651_10021112 3300025960 Bacteria 3949
162 Ga0207640_10509749 3300025981 Bacteria 1003
163 Ga0207677_10113053 3300026023 Bacteria 2026
164 Ga0207677_10571519 3300026023 Bacteria 988
165 Ga0207677_11085566 3300026023 Bacteria 729
166 Ga0207678_10956055 3300026067 Bacteria 758
167 Ga0207708_10000918 3300026075 Bacteria 22067
168 Ga0207702_11245709 3300026078 Bacteria 738
169 Ga0207648_10003123 3300026089 Bacteria 17493
170 Ga0207675_100004758 3300026118 Bacteria 13078
171 Ga0207675_101343623 3300026118 Bacteria 735
172 Ga0207683_10142053 3300026121 Bacteria 2164
173 Ga0207698_10171337 3300026142 Bacteria 1912
174 Ga0207698_10243313 3300026142 Bacteria 1641
175 Ga0207698_10984247 3300026142 Bacteria 854
176 Ga0207428_10114319 3300027907 Bacteria 2074
177 Ga0207428_10964652 3300027907 Bacteria 600
178 Ga0268265_10302982 3300028380 Bacteria 1440
179 Ga0307509_10159747 3300031507 Bacteria 2154
180 Ga0307413_10085197 3300031824 Bacteria 2040
181 Ga0307413_11358120 3300031824 Bacteria 624
182 Ga0307410_10171950 3300031852 Bacteria 1633
183 Ga0307406_10239269 3300031901 Bacteria 1361
184 Ga0307407_10332828 3300031903 Bacteria 1069
185 Ga0307412_10086107 3300031911 Bacteria 2186
186 Ga0307412_10516895 3300031911 Bacteria 997
187 Ga0307409_100011894 3300031995 Bacteria 5514
188 Ga0307409_100336238 3300031995 Bacteria 1419
189 Ga0307409_100903342 3300031995 Bacteria 897
190 Ga0307416_100096313 3300032002 Bacteria 2559
191 Ga0307416_100242469 3300032002 Bacteria 1748
192 Ga0307416_100249521 3300032002 Bacteria 1726
193 Ga0307416_101025438 3300032002 Bacteria 929
194 Ga0307414_11987146 3300032004 Bacteria 543
195 Ga0307411_10026736 3300032005 Bacteria 3479
196 Ga0307415_100051193 3300032126 Bacteria 2801
197 Ga0307415_100472228 3300032126 Bacteria 1090
198 Ga0307507_10010414 3300033179 Bacteria 12022
199 Ga0307507_10039627 3300033179 Bacteria 4751
200 Ga0307510_10014205 3300033180 Bacteria 9430
201 Ga0373940_0002279 3300035088 Bacteria 3700
202 Ga0373941_0001635 3300035115 Bacteria 4778
203 Ga0395901_0037633 3300038443 Bacteria 5004
204 Ga0436365_0740111 3300039437 Bacteria 1981
205 Ga0436360_0254876 3300039438 Unclassified 1139
206 Ga0436360_0550774 3300039438 Bacteria 603
207 Ga0436360_1030568 3300039438 Bacteria 2721
208 Ga0436363_0167705 3300039450 Bacteria 7820
209 Ga0451789_1121712 3300041443 Bacteria 512
210 Ga0451791_0529575 3300041451 Bacteria 1015
211 Ga0451802_0262372 3300041460 Bacteria 736
212 Ga0451837_0125350 3300041494 Bacteria 1311
213 Ga0451847_0696383 3300041503 Bacteria 758
214 Ga0451847_0714626 3300041503 Bacteria 615
215 Ga0451851_0511835 3300041507 Bacteria 1323
216 Ga0451853_0403610 3300041512 Bacteria 10540
217 Ga0451853_0510551 3300041512 Bacteria 565
218 Ga0451853_2049372 3300041512 Bacteria 1088
219 Ga0451853_2734357 3300041512 Bacteria 506
220 Ga0451853_3185146 3300041512 Bacteria 1223
221 Ga0439442_153171 3300042002 Bacteria 513
222 Ga0466969_0000872 3300044656 Bacteria 16346
223 Ga0466969_0028069 3300044656 Bacteria 2878
224 Ga0466972_0005115 3300044658 Bacteria 6567
225 Ga0466972_0009388 3300044658 Bacteria 4915
226 Ga0466972_0027353 3300044658 Bacteria 2822
227 Ga0466972_0202171 3300044658 Bacteria 930
228 Ga0466972_0292177 3300044658 Bacteria 761
229 Ga0466965_0000773 3300044683 Bacteria 12049
230 Ga0466965_0000942 3300044683 Bacteria 11200
231 Ga0466965_0009901 3300044683 Bacteria 4434
232 Ga0466965_0012391 3300044683 Bacteria 4009
233 Ga0466965_0078271 3300044683 Bacteria 1670
234 Ga0466965_0116166 3300044683 Bacteria 1379
235 Ga0466966_0003724 3300044684 Bacteria 10051
236 Ga0466966_0033096 3300044684 Bacteria 3347
237 Ga0466961_0010683 3300044693 Bacteria 5863
238 Ga0466961_0019699 3300044693 Bacteria 4341
239 Ga0466961_0032093 3300044693 Bacteria 3375
240 Ga0466961_0440916 3300044693 Bacteria 788
241 Ga0466963_0124283 3300044694 Bacteria 1778
242 Ga0466963_0127162 3300044694 Bacteria 1757
243 Ga0466963_0281753 3300044694 Bacteria 1168
244 Ga0466963_0420419 3300044694 Bacteria 943
245 Ga0466963_0500084 3300044694 Bacteria 858
246 Ga0466964_0012053 3300044706 Bacteria 3270
247 Ga0466964_0029943 3300044706 Bacteria 2152
248 Ga0466964_0527821 3300044706 Bacteria 638
249 Ga0466971_0059913 3300044719 Bacteria 1720
250 Ga0466971_0522227 3300044719 Bacteria 587
251 Ga0466968_0050271 3300044735 Bacteria 1778
252 Ga0466968_0117448 3300044735 Bacteria 1201
253 Ga0466968_0267439 3300044735 Bacteria 815
254 Ga0466970_0013313 3300044765 Bacteria 4216
255 Ga0466970_0035852 3300044765 Bacteria 2627
256 Ga0466970_0463905 3300044765 Bacteria 727
257 Ga0466970_0600461 3300044765 Bacteria 638
258 Ga0466957_0012427 3300044842 Bacteria 4927
259 Ga0466957_0025939 3300044842 Bacteria 3475
260 Ga0466957_0098662 3300044842 Bacteria 1838
261 Ga0466957_0113423 3300044842 Bacteria 1721
262 Ga0466957_0491265 3300044842 Bacteria 850
263 Ga0466960_0000365 3300044901 Bacteria 15436
264 Ga0466960_0002221 3300044901 Bacteria 7248
265 Ga0466960_0003282 3300044901 Bacteria 6202
266 Ga0466960_0025710 3300044901 Bacteria 2666
267 Ga0466960_0036389 3300044901 Bacteria 2305
268 Ga0466960_0039654 3300044901 Bacteria 2223
269 Ga0466960_0048336 3300044901 Bacteria 2044
270 Ga0466960_0203928 3300044901 Bacteria 1082
271 Ga0466960_0741374 3300044901 Bacteria 591
272 Ga0466959_0004975 3300045049 Bacteria 9009
273 Ga0466958_0290105 3300045836 Bacteria 1049
274 Ga0466958_0473483 3300045836 Bacteria 812
275 Ga0466958_0534731 3300045836 Bacteria 761
276 Ga0466967_0028989 3300045976 Bacteria 4628
277 Ga0466967_0120915 3300045976 Bacteria 2419
278 Ga0466967_0243586 3300045976 Bacteria 1716
279 Ga0466967_0287015 3300045976 Bacteria 1580
280 Ga0466967_1225546 3300045976 Bacteria 747
281 Ga0495592_0021257 3300046454 Bacteria 4934
282 Ga0495603_0010569 3300046455 Bacteria 5591
283 Ga0495629_0000508 3300046459 Bacteria 32662
284 Ga0495629_0008165 3300046459 Bacteria 7700
285 Ga0495629_0054875 3300046459 Bacteria 2786
286 Ga0495629_0619538 3300046459 Bacteria 723
287 Ga0495641_0396029 3300046461 Bacteria 626
288 Ga0495582_0107262 3300046473 Bacteria 1567
289 Ga0495662_0001262 3300046476 Bacteria 12499
290 Ga0495664_0001168 3300046477 Bacteria 13677
291 Ga0495664_0007735 3300046477 Bacteria 5981
292 Ga0495585_0155509 3300046492 Bacteria 1190
293 Ga0495585_0371733 3300046492 Bacteria 692
294 Ga0495585_0442513 3300046492 Bacteria 622
295 Ga0495594_0001365 3300046499 Bacteria 12664
296 Ga0495594_0011686 3300046499 Bacteria 4565
297 Ga0495594_0031824 3300046499 Bacteria 2862
298 Ga0495596_0436968 3300046500 Bacteria 510
299 Ga0495606_0644715 3300046507 Bacteria 513
300 Ga0495618_0037371 3300046514 Bacteria 3049
301 Ga0495628_0084066 3300046516 Bacteria 2470
302 Ga0495630_0011944 3300046517 Bacteria 6297
303 Ga0495666_0103593 3300046526 Bacteria 1340
304 Ga0495640_0024987 3300046533 Bacteria 4340
305 Ga0495586_0918210 3300046535 Bacteria 504
306 Ga0495587_0000857 3300046536 Bacteria 20096
307 Ga0495587_0248495 3300046536 Bacteria 1000
308 Ga0495645_0074440 3300046543 Bacteria 2445
309 Ga0495622_0005936 3300046557 Bacteria 5675
310 Ga0495622_0050439 3300046557 Bacteria 1931
311 Ga0495634_0002136 3300046642 Bacteria 16643
312 Ga0495611_0088317 3300046648 Bacteria 1431
313 Ga0495625_0387393 3300046660 Bacteria 876
314 Ga0495635_0002723 3300046663 Bacteria 12108
315 Ga0495588_0144674 3300046674 Bacteria 1256
316 Ga0495588_0156123 3300046674 Bacteria 1206
317 Ga0495588_0255066 3300046674 Bacteria 924
318 Ga0495657_0001375 3300046675 Bacteria 21109
319 Ga0495599_0101009 3300046678 Bacteria 1798
320 Ga0495623_0100314 3300046679 Bacteria 1765
321 Ga0495646_0000152 3300046680 Bacteria 34958
322 Ga0495658_0640317 3300046683 Bacteria 681
323 Ga0495613_0000703 3300046689 Bacteria 26347
324 Ga0495613_0010824 3300046689 Bacteria 6767
325 Ga0495624_0344345 3300046690 Bacteria 897
326 Ga0495624_0857880 3300046690 Bacteria 535
327 Ga0495589_0158954 3300046794 Bacteria 1077
328 Ga0495600_0013929 3300046809 Bacteria 5067
329 Ga0495581_0016090 3300047315 Bacteria 4347
330 Ga0495581_0221871 3300047315 Bacteria 1105
331 Ga0495604_0005722 3300047317 Bacteria 9856
332 Ga0495636_0287340 3300047318 Bacteria 767
333 Ga0495674_0070060 3300047319 Bacteria 3031
334 Ga0495674_0768547 3300047319 Bacteria 751
335 Ga0495676_0004017 3300047321 Bacteria 13390
336 Ga0495676_0005372 3300047321 Bacteria 11737
337 Ga0495676_0024789 3300047321 Bacteria 5184
338 Ga0495675_0230283 3300047444 Bacteria 1118
339 Ga0495684_0467048 3300047471 Bacteria 874
340 Ga0495614_0000215 3300048089 Bacteria 22330
341 Ga0495614_0001114 3300048089 Bacteria 11512
342 Ga0495614_0076398 3300048089 Bacteria 1448
343 Ga0496100_0449355 3300048903 Bacteria 988
344 Ga0496100_0735009 3300048903 Bacteria 771
345 Ga0496101_0356383 3300048904 Bacteria 1150
346 Ga0496101_0362417 3300048904 Bacteria 1140
347 Ga0496102_0540736 3300048905 Bacteria 1088
348 Ga0496102_0653149 3300048905 Bacteria 975
349 Ga0496104_0687721 3300048907 Bacteria 931
350 Ga0496105_0100544 3300048908 Bacteria 2388
351 Ga0496106_0177865 3300048909 Bacteria 1688
352 Ga0496106_0845235 3300048909 Bacteria 725
353 Ga0496107_0061215 3300048910 Bacteria 2725
354 Ga0496107_0464892 3300048910 Bacteria 939
355 Ga0496107_0865460 3300048910 Bacteria 660
356 Ga0496108_0006766 3300048911 Bacteria 9281
357 Ga0496108_0307347 3300048911 Bacteria 1382
358 Ga0496108_0339480 3300048911 Bacteria 1310
359 Ga0496108_0571600 3300048911 Bacteria 986
360 Ga0496109_0018760 3300048912 Bacteria 6083
361 Ga0496109_0080271 3300048912 Bacteria 3005
362 Ga0496109_0083592 3300048912 Bacteria 2944
363 Ga0496109_0421081 3300048912 Bacteria 1262
364 Ga0496109_0896656 3300048912 Bacteria 825
365 Ga0496110_0288041 3300048913 Bacteria 1496
366 Ga0496110_0366121 3300048913 Bacteria 1313
367 Ga0496111_0058071 3300048914 Bacteria 2801
368 Ga0496111_0799493 3300048914 Bacteria 683
369 Ga0496112_0081257 3300048915 Bacteria 3205
370 Ga0496112_1814417 3300048915 Bacteria 522
371 Ga0496113_0423935 3300048916 Bacteria 1069
372 Ga0496113_1394308 3300048916 Bacteria 543
373 Ga0496114_0022013 3300048917 Bacteria 5189
374 Ga0496114_0266832 3300048917 Bacteria 1508
375 Ga0496114_0331837 3300048917 Bacteria 1345
376 Ga0496114_0472974 3300048917 Bacteria 1109
377 Ga0496114_0534055 3300048917 Bacteria 1037
378 Ga0496114_1158171 3300048917 Bacteria 659
379 Ga0496124_0080427 3300048927 Bacteria 2682
380 Ga0501031_0112987 3300049568 Bacteria 1774
381 Ga0501031_0400948 3300049568 Bacteria 887
382 Ga0501033_0249896 3300049570 Bacteria 1257
383 Ga0501034_0880963 3300049571 Bacteria 784
384 Ga0501036_0078170 3300049572 Bacteria 2799
385 Ga0501036_0264865 3300049572 Bacteria 1439
386 Ga0501036_0275292 3300049572 Bacteria 1409
387 Ga0501036_0545522 3300049572 Bacteria 964
388 Ga0501038_0082775 3300049574 Bacteria 2702
389 Ga0501038_0184617 3300049574 Bacteria 1681
390 Ga0501039_0010140 3300049575 Bacteria 7177
391 Ga0501039_0011566 3300049575 Bacteria 6720
392 Ga0501039_0206430 3300049575 Bacteria 1545
393 Ga0501040_0011249 3300049576 Bacteria 5858
394 Ga0501040_0021180 3300049576 Bacteria 4337
395 Ga0501040_0141693 3300049576 Bacteria 1694
396 Ga0501041_0030380 3300049577 Bacteria 3260
397 Ga0501041_0104805 3300049577 Bacteria 1752
398 Ga0501042_0143669 3300049578 Bacteria 1721
399 Ga0501042_0192375 3300049578 Bacteria 1471
400 Ga0501042_0653428 3300049578 Bacteria 764
401 Ga0501043_0051538 3300049579 Bacteria 3234
402 Ga0501046_0157924 3300049580 Bacteria 1707
403 Ga0501046_0598311 3300049580 Bacteria 783
404 Ga0501048_0035908 3300049582 Bacteria 3565
405 Ga0501067_0011318 3300049583 Bacteria 4940
406 Ga0501067_0094574 3300049583 Bacteria 1659
407 Ga0501069_0016349 3300049585 Bacteria 3985
408 Ga0501070_0072615 3300049586 Bacteria 2848
409 Ga0501070_0220417 3300049586 Bacteria 1556
410 Ga0501071_0006946 3300049587 Bacteria 7387
411 Ga0501071_0045686 3300049587 Bacteria 3144
412 Ga0501073_0884683 3300049589 Bacteria 615
413 Ga0501074_0141911 3300049590 Bacteria 1718
414 Ga0501074_0440526 3300049590 Bacteria 924
415 Ga0501075_0188379 3300049591 Bacteria 1573
416 Ga0501075_0325573 3300049591 Bacteria 1171
417 Ga0501075_1532625 3300049591 Bacteria 504
418 Ga0501076_0027192 3300049592 Bacteria 4437
419 Ga0501076_0052582 3300049592 Bacteria 3227
420 Ga0501077_0028978 3300049593 Bacteria 3519
421 Ga0501080_0469885 3300049742 Bacteria 1126
422 Ga0501080_1286182 3300049742 Bacteria 627
423 Ga0501081_1114081 3300049743 Bacteria 597
424 Ga0501280_022630 3300049776 Bacteria 945
425 Ga0501035_0355151 3300049822 Bacteria 1226
426 Ga0501035_0919370 3300049822 Bacteria 692
427 Ga0501035_0975721 3300049822 Bacteria 667
428 Ga0501044_0388185 3300049823 Bacteria 1310
429 Ga0501044_1558428 3300049823 Bacteria 526
430 Ga0501045_0005556 3300049824 Bacteria 8723
431 Ga0501045_0094940 3300049824 Bacteria 2206
432 Ga0501045_0185549 3300049824 Bacteria 1550
433 Ga0501045_0663387 3300049824 Bacteria 770
434 Ga0501045_0716631 3300049824 Bacteria 738
435 Ga0501212_097074 3300049851 Bacteria 550
436 nmdc:mga03683_643749_c1 3300050489 Bacteria 521
437 nmdc:mga00v17_204022_c1 3300050491 Bacteria 1278
438 nmdc:mga00v17_237406_c1 3300050491 Bacteria 1181
439 nmdc:mga00v17_286762_c1 3300050491 Bacteria 1069
440 nmdc:mga00v17_497841_c1 3300050491 Bacteria 790
441 nmdc:mga00v17_5750_c1 3300050491 Bacteria 6551
442 nmdc:mga0yw44_1112484_c1 3300050492 Bacteria 534
443 nmdc:mga0yw44_140428_c1 3300050492 Bacteria 1569
444 nmdc:mga0yw44_232408_c1 3300050492 Bacteria 1224
445 nmdc:mga0yw44_51774_c1 3300050492 Bacteria 2487
446 nmdc:mga0yw44_628732_c1 3300050492 Bacteria 730
447 nmdc:mga0yw44_718681_c1 3300050492 Bacteria 678
448 nmdc:mga06z11_728293_c1 3300050494 Bacteria 604
449 nmdc:mga07m45_226831_c1 3300050496 Bacteria 1087
450 nmdc:mga07m45_407331_c1 3300050496 Bacteria 789
451 nmdc:mga08y16_24595_c1 3300050511 Bacteria 6356
452 nmdc:mga0rr50_1845421_c1 3300050513 Bacteria 508
453 Ga0495601_0030352 3300053077 Bacteria 3356
454 Ga0495612_0041310 3300053078 Bacteria 1881
455 Ga0495612_0111137 3300053078 Bacteria 1173
456 Ga0500644_0018950 3300053088 Bacteria 2024
457 Ga0500553_024575 3300053101 Bacteria 3038
458 Ga0500556_0069883 3300053104 Bacteria 1309
459 Ga0500626_206935 3300053128 Bacteria 768
460 Ga0500573_0094719 3300053140 Bacteria 1684
461 Ga0500573_0315870 3300053140 Bacteria 774
462 Ga0500634_0167913 3300053161 Bacteria 1004
463 Ga0501084_0004527 3300054114 Bacteria 11369
464 Ga0501084_0214905 3300054114 Bacteria 1622
465 Ga0501082_0056615 3300060353 Bacteria 3378
466 Ga0501082_0158353 3300060353 Bacteria 1967
467 Ga0501082_1170327 3300060353 Bacteria 672
468 Ga0466962_0037529 3300061719 Bacteria 2320
469 Ga0466962_0474191 3300061719 Bacteria 632
470 Ga0530510_0037891 3300061734 Bacteria 3478
471 Ga0530510_0227511 3300061734 Bacteria 1387
472 Ga0530510_0416540 3300061734 Bacteria 1014
473 Ga0530510_0428764 3300061734 Bacteria 998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10083767 Ga0075365_100837673 123
2 3300006038 Ga0075365_10145593 Ga0075365_101455932 123
3 3300039438 Ga0436360_0254876 Ga0436360_0254876_457_885 123
4 3300044694 Ga0466963_0500084 Ga0466963_0500084_333_725 123
5 3300044706 Ga0466964_0527821 Ga0466964_0527821_35_427 123
6 3300044765 Ga0466970_0035852 Ga0466970_0035852_1036_1428 123
7 3300045976 Ga0466967_0287015 Ga0466967_0287015_248_640 123
8 3300050492 nmdc:mga0yw44_51774_c1 nmdc:mga0yw44_51774_c1_1683_2069 123
9 3300050492 nmdc:mga0yw44_628732_c1 nmdc:mga0yw44_628732_c1_56_442 123
10 3300050496 nmdc:mga07m45_226831_c1 nmdc:mga07m45_226831_c1_302_688 123
11 3300006038 Ga0075365_10013449 Ga0075365_100134493 126
12 3300006038 Ga0075365_10318297 Ga0075365_103182972 126
13 3300006038 Ga0075365_10523374 Ga0075365_105233742 126
14 3300006051 Ga0075364_10062813 Ga0075364_100628133 126
15 3300006353 Ga0075370_10120119 Ga0075370_101201192 126
16 3300006353 Ga0075370_10269805 Ga0075370_102698051 126
17 3300012488 Ga0157343_1041372 Ga0157343_10413721 127
18 3300005327 Ga0070658_10820518 Ga0070658_108205182 129
19 3300005337 Ga0070682_100548870 Ga0070682_1005488701 129
20 3300005618 Ga0068864_100755502 Ga0068864_1007555022 129
21 3300005718 Ga0068866_10769153 Ga0068866_107691532 129
22 3300006881 Ga0068865_100358646 Ga0068865_1003586462 129
23 3300009098 Ga0105245_10078238 Ga0105245_100782382 129
24 3300009176 Ga0105242_10647015 Ga0105242_106470152 129
25 3300009553 Ga0105249_10523279 Ga0105249_105232792 129
26 3300013308 Ga0157375_10009306 Ga0157375_100093064 129
27 3300025898 Ga0207692_10000047 Ga0207692_1000004714 129
28 3300025934 Ga0207686_10416392 Ga0207686_104163922 129
29 3300025938 Ga0207704_10328920 Ga0207704_103289202 129
30 3300025944 Ga0207661_10138849 Ga0207661_101388493 129
31 3300026142 Ga0207698_10171337 Ga0207698_101713372 129
32 3300031507 Ga0307509_10159747 Ga0307509_101597472 129
33 3300042002 Ga0439442_153171 Ga0439442_153171_101_493 129
34 3300044658 Ga0466972_0005115 Ga0466972_0005115_813_1205 129
35 3300044683 Ga0466965_0000773 Ga0466965_0000773_5862_6254 129
36 3300044683 Ga0466965_0000942 Ga0466965_0000942_4650_5042 129
37 3300044683 Ga0466965_0009901 Ga0466965_0009901_3399_3791 129
38 3300044735 Ga0466968_0267439 Ga0466968_0267439_149_541 129
39 3300044901 Ga0466960_0025710 Ga0466960_0025710_1810_2202 129
40 3300048905 Ga0496102_0540736 Ga0496102_0540736_345_740 129
41 3300048909 Ga0496106_0845235 Ga0496106_0845235_276_671 129
42 3300048910 Ga0496107_0865460 Ga0496107_0865460_187_582 129
43 3300048911 Ga0496108_0339480 Ga0496108_0339480_283_678 129
44 3300048912 Ga0496109_0018760 Ga0496109_0018760_2403_2798 129
45 3300048914 Ga0496111_0058071 Ga0496111_0058071_2124_2519 129
46 3300048915 Ga0496112_0081257 Ga0496112_0081257_895_1290 129
47 3300048917 Ga0496114_0022013 Ga0496114_0022013_1024_1419 129
48 iso_pu_bacteria 2582581314 2585315974 129
49 iso_pu_bacteria 2643221548 2643764481 129
50 iso_pu_bacteria 2643221682 2644458460 129
51 iso_pu_bacteria 2643221714 2644630013 129
52 iso_pu_bacteria 2784746763 2785345953 129
53 iso_pu_bacteria 2862290372 2862296573 129
54 iso_pu_bacteria 2862705112 2862706035 129
55 iso_pu_bacteria 2912723979 2912726382 129
56 iso_pu_bacteria 2935390628 2935394099 129
57 iso_pu_bacteria 2946072368 2946073725 129
58 iso_pu_bacteria 2966598605 2966604610 129
59 iso_pu_bacteria 8008485437 8008486978 129
60 iso_pu_bacteria 8025478263 8025484725 129
61 iso_pu_bacteria 8025524527 8025526234 129
62 iso_pu_bacteria 8048406513 8048409860 129
63 iso_pu_bacteria 8056447290 8056451723 129
64 3300005327 Ga0070658_10665228 Ga0070658_106652281 130
65 3300005338 Ga0068868_101540853 Ga0068868_1015408531 130
66 3300005343 Ga0070687_100319175 Ga0070687_1003191751 130
67 3300005356 Ga0070674_100997388 Ga0070674_1009973881 130
68 3300005456 Ga0070678_100935992 Ga0070678_1009359922 130
69 3300005548 Ga0070665_101484390 Ga0070665_1014843902 130
70 3300005564 Ga0070664_101282654 Ga0070664_1012826542 130
71 3300005578 Ga0068854_100496883 Ga0068854_1004968832 130
72 3300005719 Ga0068861_101397249 Ga0068861_1013972492 130
73 3300005840 Ga0068870_10816992 Ga0068870_108169922 130
74 3300005843 Ga0068860_101989158 Ga0068860_1019891581 130
75 3300005844 Ga0068862_101205310 Ga0068862_1012053101 130
76 3300009098 Ga0105245_11251203 Ga0105245_112512032 130
77 3300013104 Ga0157370_11403723 Ga0157370_114037232 130
78 3300013306 Ga0163162_10728726 Ga0163162_107287261 130
79 3300013307 Ga0157372_10673579 Ga0157372_106735793 130
80 3300013308 Ga0157375_11091491 Ga0157375_110914912 130
81 3300014325 Ga0163163_10435565 Ga0163163_104355652 130
82 3300021377 Ga0213874_10089622 Ga0213874_100896222 130
83 3300025904 Ga0207647_10250445 Ga0207647_102504451 130
84 3300025908 Ga0207643_10216913 Ga0207643_102169132 130
85 3300025937 Ga0207669_10402275 Ga0207669_104022752 130
86 3300025942 Ga0207689_10036305 Ga0207689_100363052 130
87 3300025981 Ga0207640_10509749 Ga0207640_105097492 130
88 3300026023 Ga0207677_10571519 Ga0207677_105715191 130
89 3300026023 Ga0207677_11085566 Ga0207677_110855662 130
90 3300026067 Ga0207678_10956055 Ga0207678_109560551 130
91 3300026078 Ga0207702_11245709 Ga0207702_112457091 130
92 3300026121 Ga0207683_10142053 Ga0207683_101420532 130
93 3300027907 Ga0207428_10964652 Ga0207428_109646521 130
94 3300028380 Ga0268265_10302982 Ga0268265_103029822 130
95 3300039438 Ga0436360_0550774 Ga0436360_0550774_135_557 130
96 3300039450 Ga0436363_0167705 Ga0436363_0167705_5926_6345 130
97 3300048907 Ga0496104_0687721 Ga0496104_0687721_441_839 130
98 3300048908 Ga0496105_0100544 Ga0496105_0100544_401_799 130
99 3300048912 Ga0496109_0421081 Ga0496109_0421081_501_899 130
100 3300048913 Ga0496110_0366121 Ga0496110_0366121_566_964 130
101 3300050513 nmdc:mga0rr50_1845421_c1 nmdc:mga0rr50_1845421_c1_20_418 130
102 3300005336 Ga0070680_100743494 Ga0070680_1007434941 131
103 3300005563 Ga0068855_101134487 Ga0068855_1011344872 131
104 3300009094 Ga0111539_10339388 Ga0111539_103393882 131
105 3300021441 Ga0213871_10059555 Ga0213871_100595552 131
106 3300025917 Ga0207660_10548636 Ga0207660_105486362 131
107 3300025949 Ga0207667_11139574 Ga0207667_111395741 131
108 3300035088 Ga0373940_0002279 Ga0373940_0002279_1980_2402 131
109 3300035115 Ga0373941_0001635 Ga0373941_0001635_1106_1528 131
110 3300039438 Ga0436360_1030568 Ga0436360_1030568_562_984 131
111 3300048903 Ga0496100_0449355 Ga0496100_0449355_286_684 131
112 3300048904 Ga0496101_0362417 Ga0496101_0362417_292_690 131
113 3300048905 Ga0496102_0653149 Ga0496102_0653149_119_517 131
114 iso_pu_bacteria 2643221561 2643824076 131
115 iso_pu_bacteria 2643221696 2644533383 131
116 iso_pu_bacteria 2799112218 2799184817 131
117 iso_pu_bacteria 2857481737 2857485945 131
118 3300005327 Ga0070658_10103539 Ga0070658_101035392 132
119 3300005339 Ga0070660_100614612 Ga0070660_1006146122 132
120 3300005341 Ga0070691_10444396 Ga0070691_104443961 132
121 3300005345 Ga0070692_10588839 Ga0070692_105888391 132
122 3300005455 Ga0070663_101198339 Ga0070663_1011983391 132
123 3300005458 Ga0070681_10001906 Ga0070681_100019065 132
124 3300020069 Ga0197907_11123623 Ga0197907_111236231 132
125 3300020081 Ga0206354_10323978 Ga0206354_103239783 132
126 3300020082 Ga0206353_10208278 Ga0206353_102082785 132
127 3300020610 Ga0154015_1275191 Ga0154015_12751911 132
128 3300022467 Ga0224712_10018275 Ga0224712_100182753 132
129 3300025909 Ga0207705_10023055 Ga0207705_100230554 132
130 3300025912 Ga0207707_10001154 Ga0207707_100011544 132
131 3300025917 Ga0207660_10002400 Ga0207660_100024004 132
132 3300025919 Ga0207657_10474337 Ga0207657_104743372 132
133 3300025921 Ga0207652_10003418 Ga0207652_100034182 132
134 3300025949 Ga0207667_10940863 Ga0207667_109408632 132
135 3300031901 Ga0307406_10239269 Ga0307406_102392692 132
136 3300032002 Ga0307416_100096313 Ga0307416_1000963133 132
137 3300033179 Ga0307507_10039627 Ga0307507_100396273 132
138 3300045836 Ga0466958_0534731 Ga0466958_0534731_283_693 132
139 3300049851 Ga0501212_097074 Ga0501212_097074_51_512 132
140 iso_pu_bacteria 2802429296 2804843546 132
141 iso_pu_bacteria 8025413630 8025418700 132
142 3300009098 Ga0105245_12300953 Ga0105245_123009531 133
143 3300013308 Ga0157375_11700657 Ga0157375_117006572 133
144 3300014497 Ga0182008_10250772 Ga0182008_102507722 133
145 3300025917 Ga0207660_11697705 Ga0207660_116977051 133
146 3300025935 Ga0207709_10456517 Ga0207709_104565172 133
147 3300031824 Ga0307413_10085197 Ga0307413_100851972 133
148 3300031852 Ga0307410_10171950 Ga0307410_101719502 133
149 3300031903 Ga0307407_10332828 Ga0307407_103328282 133
150 3300031911 Ga0307412_10086107 Ga0307412_100861072 133
151 3300031995 Ga0307409_100011894 Ga0307409_1000118942 133
152 3300032002 Ga0307416_100249521 Ga0307416_1002495212 133
153 3300032126 Ga0307415_100051193 Ga0307415_1000511932 133
154 3300033179 Ga0307507_10010414 Ga0307507_100104141 133
155 3300033180 Ga0307510_10014205 Ga0307510_100142056 133
156 3300041512 Ga0451853_2734357 Ga0451853_2734357_60_467 133
157 3300044656 Ga0466969_0000872 Ga0466969_0000872_10699_11106 133
158 3300044656 Ga0466969_0028069 Ga0466969_0028069_1292_1702 133
159 3300044658 Ga0466972_0009388 Ga0466972_0009388_2141_2548 133
160 3300044658 Ga0466972_0027353 Ga0466972_0027353_1237_1662 133
161 3300044658 Ga0466972_0202171 Ga0466972_0202171_486_902 133
162 3300044658 Ga0466972_0292177 Ga0466972_0292177_220_630 133
163 3300044683 Ga0466965_0012391 Ga0466965_0012391_1945_2361 133
164 3300044683 Ga0466965_0078271 Ga0466965_0078271_306_731 133
165 3300044684 Ga0466966_0003724 Ga0466966_0003724_4449_4856 133
166 3300044684 Ga0466966_0033096 Ga0466966_0033096_845_1255 133
167 3300044693 Ga0466961_0010683 Ga0466961_0010683_394_810 133
168 3300044693 Ga0466961_0019699 Ga0466961_0019699_1435_1842 133
169 3300044694 Ga0466963_0124283 Ga0466963_0124283_267_683 133
170 3300044694 Ga0466963_0127162 Ga0466963_0127162_314_721 133
171 3300044706 Ga0466964_0029943 Ga0466964_0029943_1713_2123 133
172 3300044719 Ga0466971_0059913 Ga0466971_0059913_1209_1625 133
173 3300044735 Ga0466968_0050271 Ga0466968_0050271_150_560 133
174 3300044765 Ga0466970_0600461 Ga0466970_0600461_71_553 133
175 3300044842 Ga0466957_0012427 Ga0466957_0012427_1746_2162 133
176 3300044901 Ga0466960_0002221 Ga0466960_0002221_5518_5946 133
177 3300044901 Ga0466960_0003282 Ga0466960_0003282_3927_4355 133
178 3300044901 Ga0466960_0036389 Ga0466960_0036389_1232_1714 133
179 3300044901 Ga0466960_0048336 Ga0466960_0048336_194_610 133
180 3300044901 Ga0466960_0203928 Ga0466960_0203928_132_575 133
181 3300045049 Ga0466959_0004975 Ga0466959_0004975_5983_6390 133
182 3300045976 Ga0466967_0028989 Ga0466967_0028989_779_1195 133
183 3300045976 Ga0466967_0120915 Ga0466967_0120915_86_493 133
184 3300045976 Ga0466967_0243586 Ga0466967_0243586_177_602 133
185 3300046454 Ga0495592_0021257 Ga0495592_0021257_2678_3097 133
186 3300046459 Ga0495629_0008165 Ga0495629_0008165_242_664 133
187 3300046459 Ga0495629_0054875 Ga0495629_0054875_529_948 133
188 3300046461 Ga0495641_0396029 Ga0495641_0396029_77_496 133
189 3300046473 Ga0495582_0107262 Ga0495582_0107262_566_985 133
190 3300046476 Ga0495662_0001262 Ga0495662_0001262_1208_1627 133
191 3300046477 Ga0495664_0001168 Ga0495664_0001168_163_582 133
192 3300046499 Ga0495594_0001365 Ga0495594_0001365_11978_12400 133
193 3300046500 Ga0495596_0436968 Ga0495596_0436968_23_448 133
194 3300046514 Ga0495618_0037371 Ga0495618_0037371_2278_2697 133
195 3300046516 Ga0495628_0084066 Ga0495628_0084066_1196_1615 133
196 3300046517 Ga0495630_0011944 Ga0495630_0011944_1546_1965 133
197 3300046526 Ga0495666_0103593 Ga0495666_0103593_706_1125 133
198 3300046533 Ga0495640_0024987 Ga0495640_0024987_637_1056 133
199 3300046535 Ga0495586_0918210 Ga0495586_0918210_13_432 133
200 3300046536 Ga0495587_0000857 Ga0495587_0000857_2511_2930 133
201 3300046536 Ga0495587_0248495 Ga0495587_0248495_484_900 133
202 3300046543 Ga0495645_0074440 Ga0495645_0074440_1360_1779 133
203 3300046557 Ga0495622_0005936 Ga0495622_0005936_2460_2882 133
204 3300046642 Ga0495634_0002136 Ga0495634_0002136_12792_13211 133
205 3300046663 Ga0495635_0002723 Ga0495635_0002723_5862_6281 133
206 3300046674 Ga0495588_0144674 Ga0495588_0144674_513_932 133
207 3300046674 Ga0495588_0156123 Ga0495588_0156123_552_974 133
208 3300046675 Ga0495657_0001375 Ga0495657_0001375_4245_4664 133
209 3300046678 Ga0495599_0101009 Ga0495599_0101009_519_938 133
210 3300046679 Ga0495623_0100314 Ga0495623_0100314_1278_1697 133
211 3300046680 Ga0495646_0000152 Ga0495646_0000152_18984_19403 133
212 3300046689 Ga0495613_0000703 Ga0495613_0000703_6699_7118 133
213 3300046690 Ga0495624_0344345 Ga0495624_0344345_172_591 133
214 3300046809 Ga0495600_0013929 Ga0495600_0013929_1059_1478 133
215 3300047315 Ga0495581_0016090 Ga0495581_0016090_2546_2965 133
216 3300047317 Ga0495604_0005722 Ga0495604_0005722_468_887 133
217 3300047319 Ga0495674_0070060 Ga0495674_0070060_1016_1435 133
218 3300047321 Ga0495676_0004017 Ga0495676_0004017_10111_10530 133
219 3300047321 Ga0495676_0005372 Ga0495676_0005372_242_664 133
220 3300047444 Ga0495675_0230283 Ga0495675_0230283_100_519 133
221 3300047471 Ga0495684_0467048 Ga0495684_0467048_52_471 133
222 3300048089 Ga0495614_0001114 Ga0495614_0001114_10041_10460 133
223 3300048089 Ga0495614_0076398 Ga0495614_0076398_104_526 133
224 3300048917 Ga0496114_0266832 Ga0496114_0266832_792_1214 133
225 3300049776 Ga0501280_022630 Ga0501280_022630_34_504 133
226 3300053078 Ga0495612_0041310 Ga0495612_0041310_1183_1602 133
227 3300053088 Ga0500644_0018950 Ga0500644_0018950_1538_1957 133
228 3300053101 Ga0500553_024575 Ga0500553_024575_1194_1613 133
229 3300053128 Ga0500626_206935 Ga0500626_206935_96_515 133
230 3300053140 Ga0500573_0315870 Ga0500573_0315870_52_471 133
231 3300053161 Ga0500634_0167913 Ga0500634_0167913_161_580 133
232 3300061719 Ga0466962_0474191 Ga0466962_0474191_70_480 133
233 iso_pu_bacteria 8054160619 8054164308 133
234 3300001977 JGI24746J21847_1008654 JGI24746J21847_10086542 134
235 3300001991 JGI24743J22301_10001488 JGI24743J22301_100014882 134
236 3300002077 JGI24744J21845_10010984 JGI24744J21845_100109842 134
237 3300003316 rootH1_10100417 rootH1_101004172 134
238 3300005329 Ga0070683_100012981 Ga0070683_1000129816 134
239 3300005329 Ga0070683_100364625 Ga0070683_1003646253 134
240 3300005329 Ga0070683_101048832 Ga0070683_1010488322 134
241 3300005329 Ga0070683_101311889 Ga0070683_1013118891 134
242 3300005330 Ga0070690_100132259 Ga0070690_1001322592 134
243 3300005331 Ga0070670_100399184 Ga0070670_1003991842 134
244 3300005334 Ga0068869_100264594 Ga0068869_1002645942 134
245 3300005337 Ga0070682_100093992 Ga0070682_1000939923 134
246 3300005338 Ga0068868_100020600 Ga0068868_1000206005 134
247 3300005339 Ga0070660_100093040 Ga0070660_1000930402 134
248 3300005341 Ga0070691_10047047 Ga0070691_100470472 134
249 3300005345 Ga0070692_10849985 Ga0070692_108499851 134
250 3300005356 Ga0070674_101558537 Ga0070674_1015585371 134
251 3300005364 Ga0070673_100018597 Ga0070673_1000185974 134
252 3300005366 Ga0070659_100148050 Ga0070659_1001480503 134
253 3300005367 Ga0070667_100085762 Ga0070667_1000857622 134
254 3300005438 Ga0070701_10037878 Ga0070701_100378782 134
255 3300005441 Ga0070700_100041645 Ga0070700_1000416452 134
256 3300005459 Ga0068867_100001433 Ga0068867_1000014339 134
257 3300005535 Ga0070684_100012876 Ga0070684_1000128763 134
258 3300005535 Ga0070684_100116132 Ga0070684_1001161323 134
259 3300005543 Ga0070672_100008193 Ga0070672_1000081935 134
260 3300005543 Ga0070672_101066986 Ga0070672_1010669862 134
261 3300005616 Ga0068852_100002562 Ga0068852_1000025627 134
262 3300005616 Ga0068852_101486893 Ga0068852_1014868932 134
263 3300005616 Ga0068852_101806673 Ga0068852_1018066732 134
264 3300005618 Ga0068864_100166378 Ga0068864_1001663783 134
265 3300005718 Ga0068866_10032465 Ga0068866_100324652 134
266 3300005719 Ga0068861_100013685 Ga0068861_1000136853 134
267 3300005719 Ga0068861_100510836 Ga0068861_1005108361 134
268 3300005840 Ga0068870_10025533 Ga0068870_100255332 134
269 3300005841 Ga0068863_100499934 Ga0068863_1004999342 134
270 3300005843 Ga0068860_100276835 Ga0068860_1002768352 134
271 3300006051 Ga0075364_10003064 Ga0075364_100030647 134
272 3300006051 Ga0075364_10110297 Ga0075364_101102973 134
273 3300006177 Ga0075362_10051601 Ga0075362_100516012 134
274 3300006177 Ga0075362_10362643 Ga0075362_103626432 134
275 3300006353 Ga0075370_10433647 Ga0075370_104336472 134
276 3300006844 Ga0075428_100047762 Ga0075428_1000477623 134
277 3300006881 Ga0068865_100045356 Ga0068865_1000453562 134
278 3300006881 Ga0068865_101026368 Ga0068865_1010263682 134
279 3300009094 Ga0111539_10022230 Ga0111539_100222305 134
280 3300009098 Ga0105245_10016577 Ga0105245_100165775 134
281 3300009098 Ga0105245_10378591 Ga0105245_103785911 134
282 3300009098 Ga0105245_12779332 Ga0105245_127793321 134
283 3300009148 Ga0105243_10024765 Ga0105243_100247654 134
284 3300009176 Ga0105242_10021730 Ga0105242_100217303 134
285 3300009176 Ga0105242_10825015 Ga0105242_108250152 134
286 3300009177 Ga0105248_10130478 Ga0105248_101304784 134
287 3300009551 Ga0105238_10437704 Ga0105238_104377043 134
288 3300009551 Ga0105238_11158379 Ga0105238_111583792 134
289 3300011119 Ga0105246_10138886 Ga0105246_101388862 134
290 3300013102 Ga0157371_10093677 Ga0157371_100936772 134
291 3300013307 Ga0157372_10067551 Ga0157372_100675516 134
292 3300013308 Ga0157375_10017256 Ga0157375_100172567 134
293 3300014325 Ga0163163_10049546 Ga0163163_100495463 134
294 3300014325 Ga0163163_10543075 Ga0163163_105430752 134
295 3300014325 Ga0163163_11495422 Ga0163163_114954221 134
296 3300014326 Ga0157380_10065693 Ga0157380_100656934 134
297 3300014326 Ga0157380_10873608 Ga0157380_108736082 134
298 3300014326 Ga0157380_11288464 Ga0157380_112884642 134
299 3300014745 Ga0157377_10231968 Ga0157377_102319682 134
300 3300017792 Ga0163161_10233019 Ga0163161_102330192 134
301 3300025899 Ga0207642_10497866 Ga0207642_104978661 134
302 3300025901 Ga0207688_10024984 Ga0207688_100249842 134
303 3300025908 Ga0207643_10003070 Ga0207643_100030709 134
304 3300025908 Ga0207643_10769345 Ga0207643_107693451 134
305 3300025919 Ga0207657_10198641 Ga0207657_101986412 134
306 3300025923 Ga0207681_10729598 Ga0207681_107295981 134
307 3300025924 Ga0207694_10253073 Ga0207694_102530732 134
308 3300025925 Ga0207650_10576462 Ga0207650_105764622 134
309 3300025927 Ga0207687_10252035 Ga0207687_102520352 134
310 3300025927 Ga0207687_10472226 Ga0207687_104722261 134
311 3300025931 Ga0207644_10347551 Ga0207644_103475512 134
312 3300025933 Ga0207706_10197533 Ga0207706_101975332 134
313 3300025935 Ga0207709_10125218 Ga0207709_101252182 134
314 3300025936 Ga0207670_10660934 Ga0207670_106609342 134
315 3300025938 Ga0207704_10073340 Ga0207704_100733404 134
316 3300025940 Ga0207691_10029408 Ga0207691_100294084 134
317 3300025940 Ga0207691_10077632 Ga0207691_100776324 134
318 3300025940 Ga0207691_10233719 Ga0207691_102337193 134
319 3300025942 Ga0207689_10946768 Ga0207689_109467682 134
320 3300025944 Ga0207661_10063976 Ga0207661_100639762 134
321 3300025960 Ga0207651_10021112 Ga0207651_100211124 134
322 3300026023 Ga0207677_10113053 Ga0207677_101130532 134
323 3300026075 Ga0207708_10000918 Ga0207708_1000091813 134
324 3300026089 Ga0207648_10003123 Ga0207648_1000312314 134
325 3300026118 Ga0207675_100004758 Ga0207675_1000047589 134
326 3300026118 Ga0207675_101343623 Ga0207675_1013436232 134
327 3300026142 Ga0207698_10243313 Ga0207698_102433132 134
328 3300026142 Ga0207698_10984247 Ga0207698_109842472 134
329 3300027907 Ga0207428_10114319 Ga0207428_101143193 134
330 3300031824 Ga0307413_11358120 Ga0307413_113581202 134
331 3300031911 Ga0307412_10516895 Ga0307412_105168952 134
332 3300031995 Ga0307409_100336238 Ga0307409_1003362382 134
333 3300031995 Ga0307409_100903342 Ga0307409_1009033422 134
334 3300032002 Ga0307416_100242469 Ga0307416_1002424692 134
335 3300032002 Ga0307416_101025438 Ga0307416_1010254382 134
336 3300032004 Ga0307414_11987146 Ga0307414_119871462 134
337 3300032005 Ga0307411_10026736 Ga0307411_100267363 134
338 3300032126 Ga0307415_100472228 Ga0307415_1004722282 134
339 3300038443 Ga0395901_0037633 Ga0395901_0037633_2647_3069 134
340 3300039437 Ga0436365_0740111 Ga0436365_0740111_757_1170 134
341 3300041443 Ga0451789_1121712 Ga0451789_1121712_87_494 134
342 3300041451 Ga0451791_0529575 Ga0451791_0529575_559_1002 134
343 3300041460 Ga0451802_0262372 Ga0451802_0262372_122_538 134
344 3300041494 Ga0451837_0125350 Ga0451837_0125350_144_560 134
345 3300041503 Ga0451847_0696383 Ga0451847_0696383_182_601 134
346 3300041503 Ga0451847_0714626 Ga0451847_0714626_110_517 134
347 3300041507 Ga0451851_0511835 Ga0451851_0511835_827_1270 134
348 3300041512 Ga0451853_0403610 Ga0451853_0403610_4232_4648 134
349 3300041512 Ga0451853_0510551 Ga0451853_0510551_76_483 134
350 3300041512 Ga0451853_2049372 Ga0451853_2049372_255_668 134
351 3300041512 Ga0451853_3185146 Ga0451853_3185146_673_1089 134
352 3300044683 Ga0466965_0116166 Ga0466965_0116166_470_892 134
353 3300044693 Ga0466961_0032093 Ga0466961_0032093_2360_2782 134
354 3300044693 Ga0466961_0440916 Ga0466961_0440916_283_723 134
355 3300044694 Ga0466963_0281753 Ga0466963_0281753_626_1060 134
356 3300044694 Ga0466963_0420419 Ga0466963_0420419_80_526 134
357 3300044706 Ga0466964_0012053 Ga0466964_0012053_2262_2702 134
358 3300044719 Ga0466971_0522227 Ga0466971_0522227_137_577 134
359 3300044735 Ga0466968_0117448 Ga0466968_0117448_148_588 134
360 3300044765 Ga0466970_0013313 Ga0466970_0013313_2072_2494 134
361 3300044765 Ga0466970_0463905 Ga0466970_0463905_134_556 134
362 3300044842 Ga0466957_0025939 Ga0466957_0025939_1659_2117 134
363 3300044842 Ga0466957_0098662 Ga0466957_0098662_1225_1665 134
364 3300044842 Ga0466957_0113423 Ga0466957_0113423_28_450 134
365 3300044842 Ga0466957_0491265 Ga0466957_0491265_71_493 134
366 3300044901 Ga0466960_0000365 Ga0466960_0000365_7524_7931 134
367 3300044901 Ga0466960_0039654 Ga0466960_0039654_1627_2067 134
368 3300044901 Ga0466960_0741374 Ga0466960_0741374_140_580 134
369 3300045836 Ga0466958_0290105 Ga0466958_0290105_595_1035 134
370 3300045836 Ga0466958_0473483 Ga0466958_0473483_88_528 134
371 3300045976 Ga0466967_1225546 Ga0466967_1225546_69_509 134
372 3300046455 Ga0495603_0010569 Ga0495603_0010569_872_1297 134
373 3300046459 Ga0495629_0000508 Ga0495629_0000508_19783_20208 134
374 3300046459 Ga0495629_0619538 Ga0495629_0619538_14_418 134
375 3300046477 Ga0495664_0007735 Ga0495664_0007735_4138_4578 134
376 3300046492 Ga0495585_0155509 Ga0495585_0155509_673_1098 134
377 3300046492 Ga0495585_0371733 Ga0495585_0371733_256_675 134
378 3300046492 Ga0495585_0442513 Ga0495585_0442513_182_601 134
379 3300046499 Ga0495594_0011686 Ga0495594_0011686_2067_2486 134
380 3300046499 Ga0495594_0031824 Ga0495594_0031824_1536_1961 134
381 3300046507 Ga0495606_0644715 Ga0495606_0644715_44_463 134
382 3300046557 Ga0495622_0050439 Ga0495622_0050439_486_905 134
383 3300046648 Ga0495611_0088317 Ga0495611_0088317_179_604 134
384 3300046660 Ga0495625_0387393 Ga0495625_0387393_163_588 134
385 3300046674 Ga0495588_0255066 Ga0495588_0255066_172_591 134
386 3300046683 Ga0495658_0640317 Ga0495658_0640317_114_527 134
387 3300046689 Ga0495613_0010824 Ga0495613_0010824_4486_4911 134
388 3300046690 Ga0495624_0857880 Ga0495624_0857880_36_476 134
389 3300046794 Ga0495589_0158954 Ga0495589_0158954_567_992 134
390 3300047315 Ga0495581_0221871 Ga0495581_0221871_238_663 134
391 3300047318 Ga0495636_0287340 Ga0495636_0287340_42_467 134
392 3300047319 Ga0495674_0768547 Ga0495674_0768547_178_618 134
393 3300047321 Ga0495676_0024789 Ga0495676_0024789_2973_3392 134
394 3300048089 Ga0495614_0000215 Ga0495614_0000215_1054_1479 134
395 3300048903 Ga0496100_0735009 Ga0496100_0735009_261_665 134
396 3300048904 Ga0496101_0356383 Ga0496101_0356383_736_1140 134
397 3300048909 Ga0496106_0177865 Ga0496106_0177865_747_1151 134
398 3300048910 Ga0496107_0061215 Ga0496107_0061215_1912_2316 134
399 3300048910 Ga0496107_0464892 Ga0496107_0464892_203_634 134
400 3300048911 Ga0496108_0006766 Ga0496108_0006766_8311_8715 134
401 3300048911 Ga0496108_0307347 Ga0496108_0307347_294_725 134
402 3300048911 Ga0496108_0571600 Ga0496108_0571600_512_955 134
403 3300048912 Ga0496109_0080271 Ga0496109_0080271_1221_1646 134
404 3300048912 Ga0496109_0083592 Ga0496109_0083592_310_714 134
405 3300048912 Ga0496109_0896656 Ga0496109_0896656_52_495 134
406 3300048913 Ga0496110_0288041 Ga0496110_0288041_434_865 134
407 3300048914 Ga0496111_0799493 Ga0496111_0799493_252_656 134
408 3300048915 Ga0496112_1814417 Ga0496112_1814417_71_496 134
409 3300048916 Ga0496113_0423935 Ga0496113_0423935_636_1040 134
410 3300048916 Ga0496113_1394308 Ga0496113_1394308_41_481 134
411 3300048917 Ga0496114_0331837 Ga0496114_0331837_682_1086 134
412 3300048917 Ga0496114_0472974 Ga0496114_0472974_629_1072 134
413 3300048917 Ga0496114_0534055 Ga0496114_0534055_594_1025 134
414 3300048917 Ga0496114_1158171 Ga0496114_1158171_63_488 134
415 3300048927 Ga0496124_0080427 Ga0496124_0080427_389_808 134
416 3300049568 Ga0501031_0112987 Ga0501031_0112987_166_585 134
417 3300049568 Ga0501031_0400948 Ga0501031_0400948_246_665 134
418 3300049570 Ga0501033_0249896 Ga0501033_0249896_189_608 134
419 3300049571 Ga0501034_0880963 Ga0501034_0880963_244_663 134
420 3300049572 Ga0501036_0078170 Ga0501036_0078170_550_969 134
421 3300049572 Ga0501036_0264865 Ga0501036_0264865_993_1412 134
422 3300049572 Ga0501036_0275292 Ga0501036_0275292_929_1366 134
423 3300049572 Ga0501036_0545522 Ga0501036_0545522_269_682 134
424 3300049574 Ga0501038_0082775 Ga0501038_0082775_2188_2607 134
425 3300049574 Ga0501038_0184617 Ga0501038_0184617_915_1334 134
426 3300049575 Ga0501039_0010140 Ga0501039_0010140_212_631 134
427 3300049575 Ga0501039_0011566 Ga0501039_0011566_1494_1913 134
428 3300049575 Ga0501039_0206430 Ga0501039_0206430_878_1327 134
429 3300049576 Ga0501040_0011249 Ga0501040_0011249_2056_2475 134
430 3300049576 Ga0501040_0021180 Ga0501040_0021180_3806_4225 134
431 3300049576 Ga0501040_0141693 Ga0501040_0141693_580_1026 134
432 3300049577 Ga0501041_0030380 Ga0501041_0030380_2595_3014 134
433 3300049577 Ga0501041_0104805 Ga0501041_0104805_76_495 134
434 3300049578 Ga0501042_0143669 Ga0501042_0143669_1165_1602 134
435 3300049578 Ga0501042_0192375 Ga0501042_0192375_172_591 134
436 3300049578 Ga0501042_0653428 Ga0501042_0653428_311_730 134
437 3300049579 Ga0501043_0051538 Ga0501043_0051538_122_541 134
438 3300049580 Ga0501046_0157924 Ga0501046_0157924_1233_1652 134
439 3300049580 Ga0501046_0598311 Ga0501046_0598311_258_677 134
440 3300049582 Ga0501048_0035908 Ga0501048_0035908_1958_2377 134
441 3300049583 Ga0501067_0011318 Ga0501067_0011318_2471_2875 134
442 3300049583 Ga0501067_0094574 Ga0501067_0094574_547_984 134
443 3300049585 Ga0501069_0016349 Ga0501069_0016349_2917_3321 134
444 3300049586 Ga0501070_0072615 Ga0501070_0072615_1407_1814 134
445 3300049586 Ga0501070_0220417 Ga0501070_0220417_242_661 134
446 3300049587 Ga0501071_0006946 Ga0501071_0006946_6897_7316 134
447 3300049587 Ga0501071_0045686 Ga0501071_0045686_1956_2375 134
448 3300049589 Ga0501073_0884683 Ga0501073_0884683_162_581 134
449 3300049590 Ga0501074_0141911 Ga0501074_0141911_257_676 134
450 3300049590 Ga0501074_0440526 Ga0501074_0440526_119_556 134
451 3300049591 Ga0501075_0188379 Ga0501075_0188379_205_624 134
452 3300049591 Ga0501075_0325573 Ga0501075_0325573_493_906 134
453 3300049591 Ga0501075_1532625 Ga0501075_1532625_65_484 134
454 3300049592 Ga0501076_0027192 Ga0501076_0027192_75_494 134
455 3300049592 Ga0501076_0052582 Ga0501076_0052582_1625_2044 134
456 3300049593 Ga0501077_0028978 Ga0501077_0028978_2960_3379 134
457 3300049742 Ga0501080_0469885 Ga0501080_0469885_634_1053 134
458 3300049742 Ga0501080_1286182 Ga0501080_1286182_78_500 134
459 3300049743 Ga0501081_1114081 Ga0501081_1114081_162_581 134
460 3300049822 Ga0501035_0355151 Ga0501035_0355151_683_1120 134
461 3300049822 Ga0501035_0919370 Ga0501035_0919370_252_677 134
462 3300049822 Ga0501035_0975721 Ga0501035_0975721_174_593 134
463 3300049823 Ga0501044_0388185 Ga0501044_0388185_828_1247 134
464 3300049823 Ga0501044_1558428 Ga0501044_1558428_21_458 134
465 3300049824 Ga0501045_0005556 Ga0501045_0005556_8200_8619 134
466 3300049824 Ga0501045_0094940 Ga0501045_0094940_141_560 134
467 3300049824 Ga0501045_0185549 Ga0501045_0185549_285_731 134
468 3300049824 Ga0501045_0663387 Ga0501045_0663387_205_642 134
469 3300049824 Ga0501045_0716631 Ga0501045_0716631_238_687 134
470 3300050489 nmdc:mga03683_643749_c1 nmdc:mga03683_643749_c1_84_506 134
471 3300050491 nmdc:mga00v17_204022_c1 nmdc:mga00v17_204022_c1_59_466 134
472 3300050491 nmdc:mga00v17_237406_c1 nmdc:mga00v17_237406_c1_759_1163 134
473 3300050491 nmdc:mga00v17_286762_c1 nmdc:mga00v17_286762_c1_498_917 134
474 3300050491 nmdc:mga00v17_497841_c1 nmdc:mga00v17_497841_c1_67_486 134
475 3300050491 nmdc:mga00v17_5750_c1 nmdc:mga00v17_5750_c1_5593_6000 134
476 3300050492 nmdc:mga0yw44_1112484_c1 nmdc:mga0yw44_1112484_c1_70_489 134
477 3300050492 nmdc:mga0yw44_140428_c1 nmdc:mga0yw44_140428_c1_812_1234 134
478 3300050492 nmdc:mga0yw44_232408_c1 nmdc:mga0yw44_232408_c1_376_795 134
479 3300050492 nmdc:mga0yw44_718681_c1 nmdc:mga0yw44_718681_c1_20_430 134
480 3300050494 nmdc:mga06z11_728293_c1 nmdc:mga06z11_728293_c1_139_561 134
481 3300050496 nmdc:mga07m45_407331_c1 nmdc:mga07m45_407331_c1_95_502 134
482 3300050511 nmdc:mga08y16_24595_c1 nmdc:mga08y16_24595_c1_4937_5341 134
483 3300053077 Ga0495601_0030352 Ga0495601_0030352_2139_2579 134
484 3300053078 Ga0495612_0111137 Ga0495612_0111137_259_699 134
485 3300053104 Ga0500556_0069883 Ga0500556_0069883_839_1261 134
486 3300053140 Ga0500573_0094719 Ga0500573_0094719_787_1206 134
487 3300054114 Ga0501084_0004527 Ga0501084_0004527_200_619 134
488 3300054114 Ga0501084_0214905 Ga0501084_0214905_881_1300 134
489 3300060353 Ga0501082_0056615 Ga0501082_0056615_372_791 134
490 3300060353 Ga0501082_0158353 Ga0501082_0158353_1416_1835 134
491 3300060353 Ga0501082_1170327 Ga0501082_1170327_154_591 134
492 3300061719 Ga0466962_0037529 Ga0466962_0037529_1333_1755 134
493 3300061734 Ga0530510_0037891 Ga0530510_0037891_205_624 134
494 3300061734 Ga0530510_0227511 Ga0530510_0227511_163_600 134
495 3300061734 Ga0530510_0416540 Ga0530510_0416540_432_836 134
496 3300061734 Ga0530510_0428764 Ga0530510_0428764_492_914 134
497 iso_pu_bacteria 2582581312 2585297780 134
498 iso_pu_bacteria 2643221576 2643892531 134
499 iso_pu_bacteria 2643221590 2643961583 134
500 iso_pu_bacteria 3006321560 3006324452 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

40

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9397 5 133
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9371 5 133
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9283 5 133
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9216 5 133
3q9u-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9164 5 133
ID Description Score Start End Superfamily
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9151 5 133 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8987 17 129 3.40.50.720
2duwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8918 9 133 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8839 1 133 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8774 17 129 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L6XWT7-F1-model_v4 CoA-binding protein 1.001 12 134
AF-A0A4Q2S5W7-F1-model_v4 CoA-binding protein 1 12 134
AF-A0A5C8BW05-F1-model_v4 CoA-binding protein 0.9995 12 133
AF-A0A494SVP1-F1-model_v4 CoA-binding protein 0.9983 1 134
AF-A0A1I1DTU4-F1-model_v4 CoA-binding domain-containing protein 0.9965 1 134

Feature Viewer

pLDDT pTM Quality
96.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map