F455648

General Info

Members Datasets Scaffolds Average Seq Length
501 247 496 123

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101202855|Ga0070671_1012028552
Length 135
Sequence VSDDAFTWRAGGCHCGGVRFEVALPAEVEAQTCNCSMCAKTGFVHIIVPESRFRLTKGAERLSEYSFNTRVAKHLFCVECGVKSFYRPRSNPDGWSVNARCLDSLDGVTLQVEAFDGQNWEANAAGLAHLSKEHA

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
246 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 0
Rhizoplane 3.39
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 6.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000110 3300001904 Bacteria 13961
2 JGI24741J21665_1005243 3300001915 Bacteria 2744
3 JGI24752J21851_1000117 3300001976 Bacteria 10849
4 JGI24752J21851_1000299 3300001976 Bacteria 6927
5 JGI24740J21852_10013639 3300001979 Bacteria 3024
6 JGI24740J21852_10079329 3300001979 Bacteria 863
7 JGI24739J22299_10003120 3300001989 Bacteria 6323
8 JGI24739J22299_10009998 3300001989 Bacteria 3527
9 JGI24739J22299_10059101 3300001989 Bacteria 1215
10 JGI24737J22298_10001852 3300001990 Bacteria 7565
11 JGI24737J22298_10005386 3300001990 Bacteria 4418
12 JGI24737J22298_10235397 3300001990 Bacteria 540
13 JGI24743J22301_10014867 3300001991 Bacteria 1438
14 JGI24743J22301_10016268 3300001991 Bacteria 1386
15 JGI24735J21928_10016408 3300002067 Bacteria 2297
16 JGI24735J21928_10027963 3300002067 Bacteria 1686
17 JGI24735J21928_10041379 3300002067 Bacteria 1343
18 JGI24735J21928_10041460 3300002067 Bacteria 1342
19 JGI24735J21928_10048876 3300002067 Bacteria 1223
20 JGI24735J21928_10079160 3300002067 Bacteria 941
21 JGI24735J21928_10222290 3300002067 Bacteria 549
22 JGI24750J21931_1000358 3300002070 Bacteria 7800
23 JGI24750J21931_1000504 3300002070 Bacteria 6125
24 JGI24748J21848_1000029 3300002074 Bacteria 90134
25 JGI24738J21930_10001537 3300002075 Bacteria 6363
26 JGI24738J21930_10020090 3300002075 Bacteria 1389
27 JGI24749J21850_1000261 3300002076 Bacteria 8195
28 JGI24744J21845_10000726 3300002077 Bacteria 6086
29 JGI24034J26672_10000006 3300002239 Bacteria 294495
30 JGI24742J22300_10001153 3300002244 Bacteria 4101
31 JGI24751J29686_10000225 3300002459 Bacteria 23753
32 JGI24751J29686_10014058 3300002459 Bacteria 1652
33 JGI25165J46597_1000106 3300003214 Bacteria 151139
34 Ga0055542_1022713 3300003762 Bacteria 889
35 JGI25405J52794_10026775 3300003911 Bacteria 1186
36 Ga0065704_10078300 3300005289 Bacteria 4470
37 Ga0065707_10082105 3300005295 Bacteria 21836
38 Ga0065707_10090132 3300005295 Bacteria 4202
39 Ga0065707_10210508 3300005295 Bacteria 1268
40 Ga0065707_10248241 3300005295 Bacteria 1133
41 Ga0070658_10000478 3300005327 Bacteria 34694
42 Ga0070658_10005193 3300005327 Bacteria 10592
43 Ga0070658_10026624 3300005327 Bacteria 4640
44 Ga0070658_10357618 3300005327 Bacteria 1250
45 Ga0070676_10001299 3300005328 Bacteria 12568
46 Ga0070676_10101437 3300005328 Bacteria 1778
47 Ga0070683_100341959 3300005329 Bacteria 1425
48 Ga0070690_100000002 3300005330 Bacteria 176748
49 Ga0070670_100000005 3300005331 Bacteria 351569
50 Ga0070670_100000021 3300005331 Bacteria 202776
51 Ga0070670_100399374 3300005331 Bacteria 1213
52 Ga0068869_100000134 3300005334 Bacteria 35796
53 Ga0070666_10000002 3300005335 Bacteria 478684
54 Ga0070666_10031628 3300005335 Bacteria 3494
55 Ga0070666_10894948 3300005335 Bacteria 656
56 Ga0068868_100000596 3300005338 Bacteria 24264
57 Ga0070660_100000924 3300005339 Bacteria 19633
58 Ga0070660_100008479 3300005339 Bacteria 7192
59 Ga0070660_100097877 3300005339 Bacteria 2321
60 Ga0070660_100131796 3300005339 Bacteria 2001
61 Ga0070660_100227827 3300005339 Bacteria 1516
62 Ga0070660_100867231 3300005339 Bacteria 760
63 Ga0070689_100015422 3300005340 Bacteria 5571
64 Ga0070689_101272897 3300005340 Bacteria 662
65 Ga0070661_100459089 3300005344 Bacteria 1014
66 Ga0070661_100523807 3300005344 Bacteria 951
67 Ga0070661_101360426 3300005344 Bacteria 597
68 Ga0070661_101914963 3300005344 Bacteria 504
69 Ga0070669_100000057 3300005353 Bacteria 110803
70 Ga0070669_100000078 3300005353 Bacteria 94641
71 Ga0070675_100013296 3300005354 Bacteria 6468
72 Ga0070675_100774683 3300005354 Bacteria 876
73 Ga0070671_100072139 3300005355 Bacteria 2883
74 Ga0070671_100093011 3300005355 Bacteria 2527
75 Ga0070671_101202855 3300005355 Bacteria 667
76 Ga0070674_100008746 3300005356 Bacteria 6040
77 Ga0070674_100324777 3300005356 Bacteria 1235
78 Ga0070673_100000004 3300005364 Bacteria 199809
79 Ga0070673_100311721 3300005364 Bacteria 1388
80 Ga0070688_100056513 3300005365 Bacteria 2465
81 Ga0070659_100044363 3300005366 Bacteria 3480
82 Ga0070659_100044556 3300005366 Bacteria 3473
83 Ga0070659_100220115 3300005366 Bacteria 1566
84 Ga0070659_100486004 3300005366 Bacteria 1051
85 Ga0070659_100493993 3300005366 Bacteria 1042
86 Ga0070667_100000016 3300005367 Bacteria 237028
87 Ga0070667_100000750 3300005367 Bacteria 30912
88 Ga0070667_100001565 3300005367 Bacteria 20500
89 Ga0070667_101299029 3300005367 Bacteria 682
90 Ga0070667_101725606 3300005367 Bacteria 589
91 Ga0070708_100489495 3300005445 Bacteria 1160
92 Ga0070663_100018206 3300005455 Bacteria 4599
93 Ga0070663_100018496 3300005455 Bacteria 4571
94 Ga0070663_100027240 3300005455 Bacteria 3879
95 Ga0070678_100012107 3300005456 Bacteria 5348
96 Ga0070662_100010265 3300005457 Bacteria 6140
97 Ga0070662_100220529 3300005457 Bacteria 1513
98 Ga0068867_100000028 3300005459 Bacteria 87716
99 Ga0070685_10000056 3300005466 Bacteria 68183
100 Ga0070698_100433002 3300005471 Bacteria 1250
101 Ga0070684_100154408 3300005535 Bacteria 2081
102 Ga0070684_101982406 3300005535 Bacteria 549
103 Ga0068853_100006114 3300005539 Bacteria 9533
104 Ga0068853_100148011 3300005539 Bacteria 2112
105 Ga0068853_100272162 3300005539 Bacteria 1560
106 Ga0068853_100323511 3300005539 Bacteria 1430
107 Ga0068853_100779933 3300005539 Bacteria 914
108 Ga0070672_100128724 3300005543 Bacteria 2079
109 Ga0070686_100000002 3300005544 Bacteria 336303
110 Ga0070665_100000025 3300005548 Bacteria 367488
111 Ga0068855_100065569 3300005563 Bacteria 4234
112 Ga0068855_100078239 3300005563 Bacteria 3837
113 Ga0068855_100527389 3300005563 Bacteria 1280
114 Ga0068855_101369930 3300005563 Bacteria 730
115 Ga0070664_100391637 3300005564 Bacteria 1270
116 Ga0068857_100041395 3300005577 Bacteria 4086
117 Ga0068857_100391879 3300005577 Bacteria 1291
118 Ga0068857_101378234 3300005577 Bacteria 685
119 Ga0068854_100000881 3300005578 Bacteria 18023
120 Ga0068854_100015321 3300005578 Bacteria 5076
121 Ga0068854_100100041 3300005578 Bacteria 2172
122 Ga0068854_100122686 3300005578 Bacteria 1975
123 Ga0068854_100557892 3300005578 Bacteria 972
124 Ga0068852_100106310 3300005616 Bacteria 2544
125 Ga0068852_100216308 3300005616 Bacteria 1820
126 Ga0068852_100503079 3300005616 Bacteria 1207
127 Ga0068852_100933082 3300005616 Bacteria 886
128 Ga0068859_100002060 3300005617 Bacteria 20516
129 Ga0068859_100040411 3300005617 Bacteria 4682
130 Ga0068859_100044577 3300005617 Bacteria 4457
131 Ga0068859_100426232 3300005617 Bacteria 1423
132 Ga0068864_100000004 3300005618 Bacteria 489341
133 Ga0068864_100000011 3300005618 Bacteria 350056
134 Ga0068864_100987635 3300005618 Bacteria 834
135 Ga0068866_10068610 3300005718 Bacteria 1865
136 Ga0068861_100003702 3300005719 Bacteria 10200
137 Ga0068861_100009174 3300005719 Bacteria 6823
138 Ga0068851_10060715 3300005834 Bacteria 1936
139 Ga0068851_10150821 3300005834 Bacteria 1270
140 Ga0068863_100000002 3300005841 Bacteria 489510
141 Ga0068863_100000070 3300005841 Bacteria 115715
142 Ga0068863_100090679 3300005841 Bacteria 2898
143 Ga0068858_100016855 3300005842 Bacteria 6860
144 Ga0068858_100072792 3300005842 Bacteria 3189
145 Ga0068860_100000001 3300005843 Bacteria 703043
146 Ga0068860_100000196 3300005843 Bacteria 97096
147 Ga0068862_100000002 3300005844 Bacteria 489341
148 Ga0068862_100000011 3300005844 Bacteria 270105
149 Ga0068862_100000020 3300005844 Bacteria 219516
150 Ga0081455_10001900 3300005937 Bacteria 25136
151 Ga0075362_10308588 3300006177 Bacteria 786
152 Ga0097621_100004543 3300006237 Bacteria 9677
153 Ga0097621_100638379 3300006237 Bacteria 976
154 Ga0075370_10005832 3300006353 Bacteria 6152
155 Ga0068871_101136377 3300006358 Bacteria 731
156 Ga0068871_101975478 3300006358 Bacteria 555
157 Ga0068865_100000006 3300006881 Bacteria 201186
158 Ga0097620_100002060 3300006931 Bacteria 20516
159 Ga0097620_100040412 3300006931 Bacteria 4682
160 Ga0097620_100044577 3300006931 Bacteria 4457
161 Ga0097620_100426211 3300006931 Bacteria 1423
162 Ga0105251_10001395 3300009011 Bacteria 20854
163 Ga0105240_10008281 3300009093 Bacteria 14883
164 Ga0105240_10052322 3300009093 Bacteria 5135
165 Ga0105240_10233073 3300009093 Bacteria 2138
166 Ga0105240_10257552 3300009093 Bacteria 2014
167 Ga0105240_10313950 3300009093 Bacteria 1789
168 Ga0105240_11244915 3300009093 Bacteria 787
169 Ga0105240_12289617 3300009093 Bacteria 560
170 Ga0105245_10001073 3300009098 Bacteria 24782
171 Ga0105247_10007084 3300009101 Bacteria 6887
172 Ga0105247_10025182 3300009101 Bacteria 3590
173 Ga0105243_10001033 3300009148 Bacteria 25571
174 Ga0105241_10147951 3300009174 Bacteria 1918
175 Ga0105241_10374869 3300009174 Bacteria 1242
176 Ga0105242_10000413 3300009176 Bacteria 34034
177 Ga0105248_10000010 3300009177 Bacteria 344314
178 Ga0105248_10000406 3300009177 Bacteria 49988
179 Ga0105248_10014736 3300009177 Bacteria 8608
180 Ga0105237_10050433 3300009545 Bacteria 4181
181 Ga0105237_10065333 3300009545 Bacteria 3635
182 Ga0105237_10165183 3300009545 Bacteria 2212
183 Ga0105237_11140661 3300009545 Bacteria 786
184 Ga0105237_11348132 3300009545 Bacteria 720
185 Ga0105238_10216404 3300009551 Bacteria 1892
186 Ga0105238_10232627 3300009551 Bacteria 1819
187 Ga0105238_10296612 3300009551 Bacteria 1600
188 Ga0105238_10808153 3300009551 Bacteria 953
189 Ga0105238_11007106 3300009551 Bacteria 854
190 Ga0105238_11262110 3300009551 Bacteria 764
191 Ga0105249_10000041 3300009553 Bacteria 195999
192 Ga0105249_10019332 3300009553 Bacteria 6076
193 Ga0105249_10190267 3300009553 Bacteria 2002
194 Ga0105239_10000694 3300010375 Bacteria 47928
195 Ga0105239_10236976 3300010375 Bacteria 2048
196 Ga0105239_10597771 3300010375 Bacteria 1258
197 Ga0105239_11397139 3300010375 Bacteria 808
198 Ga0105246_10002567 3300011119 Bacteria 10983
199 Ga0157373_10021371 3300013100 Bacteria 4701
200 Ga0157373_10194892 3300013100 Bacteria 1428
201 Ga0157373_10689590 3300013100 Bacteria 748
202 Ga0157371_11188315 3300013102 Bacteria 587
203 Ga0157370_10000318 3300013104 Bacteria 60585
204 Ga0157370_10378766 3300013104 Bacteria 1303
205 Ga0157370_10541196 3300013104 Bacteria 1068
206 Ga0157369_10018433 3300013105 Bacteria 7826
207 Ga0157369_10139389 3300013105 Bacteria 2567
208 Ga0157369_10213671 3300013105 Bacteria 2021
209 Ga0157369_11480111 3300013105 Bacteria 691
210 Ga0157374_10004031 3300013296 Bacteria 12342
211 Ga0157378_10001466 3300013297 Bacteria 21299
212 Ga0157378_10014891 3300013297 Bacteria 6805
213 Ga0163162_10348255 3300013306 Bacteria 1614
214 Ga0163162_10556341 3300013306 Bacteria 1275
215 Ga0163162_11192092 3300013306 Bacteria 864
216 Ga0163162_11232842 3300013306 Bacteria 849
217 Ga0157372_10061610 3300013307 Bacteria 4202
218 Ga0157372_10077218 3300013307 Bacteria 3761
219 Ga0157372_10514172 3300013307 Bacteria 1396
220 Ga0157372_10525783 3300013307 Bacteria 1379
221 Ga0157372_11163519 3300013307 Bacteria 892
222 Ga0157375_10000586 3300013308 Bacteria 32467
223 Ga0163163_10017089 3300014325 Bacteria 6757
224 Ga0157380_10000031 3300014326 Bacteria 90245
225 Ga0157380_10001415 3300014326 Bacteria 15694
226 Ga0157380_10118075 3300014326 Bacteria 2242
227 Ga0157379_10008271 3300014968 Bacteria 9039
228 Ga0157379_10068801 3300014968 Bacteria 3165
229 Ga0157379_10725409 3300014968 Bacteria 934
230 Ga0157376_10000347 3300014969 Bacteria 30895
231 Ga0163161_10002791 3300017792 Bacteria 12382
232 Ga0163161_10123837 3300017792 Bacteria 1945
233 Ga0163161_10356050 3300017792 Bacteria 1165
234 Ga0209026_1005077 3300025250 Bacteria 3654
235 Ga0209148_1002373 3300025254 Bacteria 6611
236 Ga0209233_1000003 3300025261 Bacteria 1607366
237 Ga0209455_1000441 3300025272 Bacteria 32004
238 Ga0207656_10093619 3300025321 Bacteria 1368
239 Ga0207656_10460397 3300025321 Bacteria 643
240 Ga0207710_10040389 3300025900 Bacteria 2067
241 Ga0207680_10000004 3300025903 Bacteria 827324
242 Ga0207680_10005149 3300025903 Bacteria 6239
243 Ga0207647_10000069 3300025904 Bacteria 80952
244 Ga0207647_10053075 3300025904 Bacteria 2500
245 Ga0207647_10058505 3300025904 Bacteria 2360
246 Ga0207647_10266603 3300025904 Bacteria 980
247 Ga0207645_10003000 3300025907 Bacteria 13042
248 Ga0207645_10059264 3300025907 Bacteria 2445
249 Ga0207705_10000049 3300025909 Bacteria 170616
250 Ga0207705_10000119 3300025909 Bacteria 88108
251 Ga0207705_10000903 3300025909 Bacteria 24279
252 Ga0207705_10137457 3300025909 Bacteria 1823
253 Ga0207705_10200499 3300025909 Bacteria 1512
254 Ga0207654_10278499 3300025911 Bacteria 1131
255 Ga0207654_10567160 3300025911 Bacteria 808
256 Ga0207695_10080676 3300025913 Bacteria 3294
257 Ga0207695_10119320 3300025913 Bacteria 2608
258 Ga0207695_10395768 3300025913 Bacteria 1266
259 Ga0207695_11324229 3300025913 Bacteria 601
260 Ga0207671_10001601 3300025914 Bacteria 25733
261 Ga0207671_10053198 3300025914 Bacteria 3000
262 Ga0207671_10132162 3300025914 Bacteria 1916
263 Ga0207657_10002263 3300025919 Bacteria 20875
264 Ga0207657_10002725 3300025919 Bacteria 19022
265 Ga0207657_10080857 3300025919 Bacteria 2731
266 Ga0207657_10089130 3300025919 Bacteria 2578
267 Ga0207657_10124996 3300025919 Bacteria 2113
268 Ga0207657_10231737 3300025919 Bacteria 1477
269 Ga0207657_10291944 3300025919 Bacteria 1293
270 Ga0207649_10010670 3300025920 Bacteria 5051
271 Ga0207649_10257316 3300025920 Bacteria 1260
272 Ga0207649_10270260 3300025920 Bacteria 1232
273 Ga0207649_11044008 3300025920 Bacteria 644
274 Ga0207681_10000001 3300025923 Bacteria 1105841
275 Ga0207681_10000130 3300025923 Bacteria 61067
276 Ga0207694_10002944 3300025924 Bacteria 13673
277 Ga0207694_10085601 3300025924 Bacteria 2481
278 Ga0207694_10549544 3300025924 Bacteria 969
279 Ga0207694_11211053 3300025924 Bacteria 639
280 Ga0207650_10000018 3300025925 Bacteria 352120
281 Ga0207650_10000298 3300025925 Bacteria 49421
282 Ga0207659_10007115 3300025926 Bacteria 6870
283 Ga0207659_10701431 3300025926 Bacteria 867
284 Ga0207687_10021138 3300025927 Bacteria 4320
285 Ga0207644_10018489 3300025931 Bacteria 4716
286 Ga0207644_10049340 3300025931 Bacteria 3013
287 Ga0207644_10074769 3300025931 Bacteria 2487
288 Ga0207644_10662973 3300025931 Bacteria 869
289 Ga0207690_10007558 3300025932 Bacteria 6451
290 Ga0207690_10258953 3300025932 Bacteria 1347
291 Ga0207690_10365942 3300025932 Bacteria 1143
292 Ga0207690_10674764 3300025932 Bacteria 848
293 Ga0207690_10760939 3300025932 Bacteria 799
294 Ga0207706_10020553 3300025933 Bacteria 5934
295 Ga0207706_10409298 3300025933 Bacteria 1175
296 Ga0207706_10443095 3300025933 Bacteria 1124
297 Ga0207686_10093070 3300025934 Bacteria 1995
298 Ga0207709_10000182 3300025935 Bacteria 83442
299 Ga0207670_10007972 3300025936 Bacteria 5951
300 Ga0207669_10005013 3300025937 Bacteria 5889
301 Ga0207669_10135430 3300025937 Bacteria 1700
302 Ga0207704_10000022 3300025938 Bacteria 146109
303 Ga0207691_10083198 3300025940 Bacteria 2873
304 Ga0207711_10000038 3300025941 Bacteria 163520
305 Ga0207711_10006432 3300025941 Bacteria 9891
306 Ga0207711_10009854 3300025941 Bacteria 7946
307 Ga0207689_10000462 3300025942 Bacteria 38064
308 Ga0207689_10843337 3300025942 Bacteria 773
309 Ga0207667_10033105 3300025949 Bacteria 5561
310 Ga0207667_10063803 3300025949 Bacteria 3849
311 Ga0207667_10490963 3300025949 Bacteria 1246
312 Ga0207667_11391781 3300025949 Bacteria 675
313 Ga0207667_12076629 3300025949 Bacteria 527
314 Ga0207651_10000009 3300025960 Bacteria 199913
315 Ga0207712_10000001 3300025961 Bacteria 750309
316 Ga0207712_10009745 3300025961 Bacteria 6086
317 Ga0207712_10013288 3300025961 Bacteria 5278
318 Ga0207712_10304950 3300025961 Bacteria 1308
319 Ga0207640_10000021 3300025981 Bacteria 168138
320 Ga0207640_10167977 3300025981 Bacteria 1631
321 Ga0207640_10350270 3300025981 Bacteria 1186
322 Ga0207640_10661640 3300025981 Bacteria 891
323 Ga0207640_10751497 3300025981 Bacteria 841
324 Ga0207658_10000075 3300025986 Bacteria 109004
325 Ga0207658_10000350 3300025986 Bacteria 45928
326 Ga0207658_10000474 3300025986 Bacteria 37159
327 Ga0207658_10001041 3300025986 Bacteria 22533
328 Ga0207677_10000164 3300026023 Bacteria 52688
329 Ga0207703_10009056 3300026035 Bacteria 7838
330 Ga0207639_10050735 3300026041 Bacteria 3152
331 Ga0207639_10102332 3300026041 Bacteria 2318
332 Ga0207639_10131587 3300026041 Bacteria 2072
333 Ga0207639_10221999 3300026041 Bacteria 1633
334 Ga0207639_10229412 3300026041 Bacteria 1608
335 Ga0207678_10028170 3300026067 Bacteria 4905
336 Ga0207678_10037533 3300026067 Bacteria 4214
337 Ga0207678_10081423 3300026067 Bacteria 2771
338 Ga0207702_10060037 3300026078 Bacteria 3241
339 Ga0207641_10000002 3300026088 Bacteria 981004
340 Ga0207641_10000033 3300026088 Bacteria 219261
341 Ga0207641_10001366 3300026088 Bacteria 24146
342 Ga0207648_10000084 3300026089 Bacteria 88578
343 Ga0207676_10000004 3300026095 Bacteria 725417
344 Ga0207676_10000005 3300026095 Bacteria 698744
345 Ga0207676_10068058 3300026095 Bacteria 2846
346 Ga0207674_10046831 3300026116 Bacteria 4438
347 Ga0207674_10282895 3300026116 Bacteria 1607
348 Ga0207675_100001662 3300026118 Bacteria 22254
349 Ga0207675_100003358 3300026118 Bacteria 15642
350 Ga0207683_10002643 3300026121 Bacteria 15651
351 Ga0207698_10042180 3300026142 Bacteria 3406
352 Ga0207698_10329026 3300026142 Bacteria 1434
353 Ga0207698_10345459 3300026142 Unclassified 1403
354 Ga0207698_10771396 3300026142 Bacteria 962
355 Ga0207698_10890277 3300026142 Bacteria 897
356 Ga0268266_10000028 3300028379 Bacteria 425294
357 Ga0268265_10000002 3300028380 Bacteria 1035381
358 Ga0268265_10000003 3300028380 Bacteria 949201
359 Ga0268265_10000524 3300028380 Bacteria 39127
360 Ga0268264_10000006 3300028381 Bacteria 827324
361 Ga0268264_10000087 3300028381 Bacteria 236696
362 Ga0307517_10271038 3300028786 Bacteria 976
363 Ga0307408_100328685 3300031548 Bacteria 1290
364 Ga0307405_10031784 3300031731 Bacteria 3112
365 Ga0307406_11609227 3300031901 Bacteria 574
366 Ga0307406_11776098 3300031901 Bacteria 548
367 Ga0307412_10004683 3300031911 Bacteria 7632
368 Ga0307412_10254470 3300031911 Bacteria 1365
369 Ga0307412_10347690 3300031911 Bacteria 1189
370 Ga0307416_100368221 3300032002 Bacteria 1462
371 Ga0307414_11696763 3300032004 Bacteria 589
372 Ga0373944_0037555 3300035089 Bacteria 1484
373 Ga0395899_0005461 3300037312 Bacteria 9859
374 Ga0395899_0642436 3300037312 Bacteria 671
375 Ga0395900_0760926 3300037418 Bacteria 898
376 Ga0395900_0821917 3300037418 Bacteria 856
377 Ga0395905_0016931 3300037471 Bacteria 6924
378 Ga0395905_0107151 3300037471 Bacteria 2624
379 Ga0395905_0164136 3300037471 Bacteria 2087
380 Ga0436360_0243841 3300039438 Bacteria 898
381 Ga0436361_0144463 3300039447 Bacteria 26892
382 Ga0451795_0962454 3300041456 Bacteria 1053
383 Ga0451802_0219098 3300041460 Bacteria 727
384 Ga0451806_247531 3300041462 Bacteria 2986
385 Ga0451807_0392172 3300041486 Bacteria 1483
386 Ga0451807_0576451 3300041486 Bacteria 718
387 Ga0451845_0286583 3300041501 Bacteria 617
388 Ga0451849_0362350 3300041505 Bacteria 1178
389 Ga0451853_1098147 3300041512 Bacteria 1547
390 Ga0439448_0001214 3300042005 Bacteria 6581
391 Ga0439448_0003054 3300042005 Bacteria 4599
392 Ga0439455_0004709 3300042012 Bacteria 2721
393 Ga0439455_0033123 3300042012 Bacteria 1294
394 Ga0439458_0004082 3300042157 Bacteria 3368
395 Ga0466968_0464791 3300044735 Bacteria 627
396 Ga0495638_0029588 3300046460 Bacteria 3532
397 Ga0495638_0084921 3300046460 Bacteria 1915
398 Ga0495585_0361530 3300046492 Bacteria 704
399 Ga0495583_0000139 3300046506 Bacteria 123464
400 Ga0495606_0004048 3300046507 Bacteria 14949
401 Ga0495606_0190150 3300046507 Bacteria 1177
402 Ga0495637_0015420 3300046520 Bacteria 3583
403 Ga0495643_0038139 3300046522 Bacteria 2633
404 Ga0495643_0089040 3300046522 Bacteria 1595
405 Ga0495663_0011281 3300046525 Bacteria 2487
406 Ga0495654_0000736 3300046530 Bacteria 25435
407 Ga0495668_0001456 3300046616 Bacteria 22791
408 Ga0495668_0024118 3300046616 Bacteria 3461
409 Ga0495668_0049366 3300046616 Bacteria 2334
410 Ga0495661_0034003 3300046665 Bacteria 3211
411 Ga0495589_0079391 3300046794 Bacteria 1597
412 Ga0495672_0055722 3300047320 Bacteria 2305
413 Ga0495683_0236447 3300047323 Bacteria 808
414 Ga0495673_0009614 3300047469 Bacteria 5334
415 Ga0495686_0000182 3300047472 Bacteria 119682
416 Ga0495686_0001320 3300047472 Bacteria 27790
417 Ga0495686_0002610 3300047472 Bacteria 16704
418 Ga0495686_0019589 3300047472 Bacteria 4521
419 Ga0496101_0153963 3300048904 Bacteria 1760
420 Ga0496102_0011371 3300048905 Bacteria 7670
421 Ga0496102_0624754 3300048905 Bacteria 1000
422 Ga0496103_0008918 3300048906 Bacteria 5945
423 Ga0496103_0270109 3300048906 Bacteria 1094
424 Ga0496104_0468293 3300048907 Bacteria 1171
425 Ga0496105_0089541 3300048908 Bacteria 2542
426 Ga0496105_1404732 3300048908 Bacteria 505
427 Ga0496106_0076114 3300048909 Bacteria 2572
428 Ga0496107_0079931 3300048910 Bacteria 2384
429 Ga0496110_0073425 3300048913 Bacteria 3036
430 Ga0496111_0275718 3300048914 Bacteria 1248
431 Ga0496116_0032283 3300048919 Bacteria 3735
432 Ga0496117_0002989 3300048920 Bacteria 20363
433 Ga0496117_0004127 3300048920 Bacteria 16262
434 Ga0496117_0023979 3300048920 Bacteria 4843
435 Ga0496117_0073876 3300048920 Bacteria 2273
436 Ga0496117_0437214 3300048920 Bacteria 650
437 Ga0496118_0000463 3300048921 Bacteria 67382
438 Ga0496118_0020700 3300048921 Bacteria 5824
439 Ga0496118_0041401 3300048921 Bacteria 3648
440 Ga0496118_0084326 3300048921 Bacteria 2217
441 Ga0496118_0121995 3300048921 Bacteria 1696
442 Ga0496118_0257353 3300048921 Bacteria 988
443 Ga0496121_0010236 3300048924 Bacteria 10612
444 Ga0496121_0134874 3300048924 Bacteria 1841
445 Ga0496122_0013706 3300048925 Bacteria 7909
446 Ga0496122_0035124 3300048925 Bacteria 4086
447 Ga0496123_0009700 3300048926 Bacteria 8631
448 Ga0496123_0014602 3300048926 Bacteria 6495
449 Ga0496123_0106060 3300048926 Bacteria 1620
450 Ga0496124_0009261 3300048927 Bacteria 10157
451 Ga0496124_0918067 3300048927 Bacteria 529
452 Ga0496125_0323694 3300048928 Bacteria 933
453 Ga0495678_046482 3300049459 Bacteria 1706
454 Ga0501290_001796 3300049513 Bacteria 2851
455 Ga0501299_013381 3300049522 Bacteria 1414
456 Ga0501300_007119 3300049523 Bacteria 1640
457 Ga0501033_0440606 3300049570 Bacteria 906
458 Ga0501071_0729736 3300049587 Bacteria 763
459 Ga0501257_000012 3300049686 Bacteria 51962
460 Ga0501280_001885 3300049776 Bacteria 3666
461 Ga0501282_003357 3300049778 Bacteria 1726
462 nmdc:mga03683_216057_c1 3300050489 Bacteria 883
463 nmdc:mga0k408_83084_c1 3300050493 Bacteria 1877
464 Ga0500643_000215 3300053087 Bacteria 54391
465 Ga0500643_002098 3300053087 Bacteria 10611
466 Ga0500651_0027888 3300053093 Bacteria 3551
467 Ga0500566_0167500 3300053094 Bacteria 1139
468 Ga0500641_0326747 3300053096 Bacteria 622
469 Ga0500555_000188 3300053103 Bacteria 28317
470 Ga0500555_028998 3300053103 Bacteria 1574
471 Ga0500556_0244888 3300053104 Bacteria 706
472 Ga0500592_000065 3300053116 Bacteria 28864
473 Ga0500592_000255 3300053116 Bacteria 9553
474 Ga0500608_226880 3300053122 Bacteria 749
475 Ga0500618_036783 3300053125 Bacteria 1133
476 Ga0500642_0001739 3300053130 Bacteria 6280
477 Ga0500655_000070 3300053133 Bacteria 27417
478 Ga0500658_0046162 3300053134 Bacteria 1763
479 Ga0500559_0090092 3300053136 Bacteria 1403
480 Ga0500573_0217348 3300053140 Bacteria 1005
481 Ga0500577_0007077 3300053142 Bacteria 3130
482 Ga0500577_0203703 3300053142 Bacteria 854
483 Ga0500577_0366702 3300053142 Bacteria 630
484 Ga0500590_002815 3300053148 Bacteria 7857
485 Ga0500604_0042035 3300053151 Bacteria 1384
486 Ga0500604_0090261 3300053151 Bacteria 1000
487 Ga0500616_0010388 3300053153 Bacteria 5573
488 Ga0500616_0017809 3300053153 Bacteria 4025
489 Ga0500622_0004866 3300053156 Bacteria 8220
490 Ga0500627_0000086 3300053158 Bacteria 31214
491 Ga0500627_0000569 3300053158 Bacteria 9931
492 Ga0500636_0397237 3300053177 Bacteria 641
493 Ga0500636_0533759 3300053177 Bacteria 511
494 Ga0500570_000067 3300053724 Bacteria 27420
495 Ga0500611_024256 3300053727 Bacteria 1189
496 Ga0500645_035533 3300053730 Bacteria 1484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0037555 Ga0373944_0037555_827_1183 110
2 3300013306 Ga0163162_11192092 Ga0163162_111920921 114
3 3300009093 Ga0105240_10008281 Ga0105240_100082819 116
4 3300009093 Ga0105240_10052322 Ga0105240_100523225 116
5 3300009093 Ga0105240_11244915 Ga0105240_112449152 116
6 3300009545 Ga0105237_10065333 Ga0105237_100653334 116
7 3300009551 Ga0105238_10216404 Ga0105238_102164043 116
8 3300009551 Ga0105238_10808153 Ga0105238_108081531 116
9 3300010375 Ga0105239_10000694 Ga0105239_1000069417 116
10 iso_pu_bacteria 2582581305 2585262075 119
11 iso_pu_bacteria 2643221541 2643730583 119
12 iso_pu_bacteria 2643221605 2644037575 119
13 iso_pu_bacteria 2643221606 2644043752 119
14 iso_pu_bacteria 2643221671 2644393911 119
15 3300002067 JGI24735J21928_10222290 JGI24735J21928_102222902 120
16 3300005335 Ga0070666_10031628 Ga0070666_100316282 120
17 3300005354 Ga0070675_100774683 Ga0070675_1007746832 120
18 3300005355 Ga0070671_100093011 Ga0070671_1000930112 120
19 3300005356 Ga0070674_100008746 Ga0070674_1000087464 120
20 3300005367 Ga0070667_101299029 Ga0070667_1012990292 120
21 3300005455 Ga0070663_100027240 Ga0070663_1000272403 120
22 3300005563 Ga0068855_100065569 Ga0068855_1000655693 120
23 3300005616 Ga0068852_100106310 Ga0068852_1001063103 120
24 3300006177 Ga0075362_10308588 Ga0075362_103085881 120
25 3300013100 Ga0157373_10689590 Ga0157373_106895902 120
26 3300013307 Ga0157372_11163519 Ga0157372_111635192 120
27 3300025903 Ga0207680_10005149 Ga0207680_100051494 120
28 3300025926 Ga0207659_10701431 Ga0207659_107014312 120
29 3300025931 Ga0207644_10018489 Ga0207644_100184894 120
30 3300025933 Ga0207706_10443095 Ga0207706_104430952 120
31 3300025937 Ga0207669_10005013 Ga0207669_100050133 120
32 3300025949 Ga0207667_10033105 Ga0207667_100331055 120
33 3300026067 Ga0207678_10081423 Ga0207678_100814232 120
34 3300026142 Ga0207698_10345459 Ga0207698_103454592 120
35 3300041460 Ga0451802_0219098 Ga0451802_0219098_152_514 120
36 3300041462 Ga0451806_247531 Ga0451806_247531_2548_2910 120
37 3300041486 Ga0451807_0392172 Ga0451807_0392172_793_1155 120
38 3300041501 Ga0451845_0286583 Ga0451845_0286583_57_419 120
39 3300041505 Ga0451849_0362350 Ga0451849_0362350_762_1124 120
40 3300041512 Ga0451853_1098147 Ga0451853_1098147_387_749 120
41 3300042005 Ga0439448_0001214 Ga0439448_0001214_4466_4828 120
42 3300042012 Ga0439455_0004709 Ga0439455_0004709_498_860 120
43 3300044735 Ga0466968_0464791 Ga0466968_0464791_251_613 120
44 3300046460 Ga0495638_0084921 Ga0495638_0084921_915_1277 120
45 3300047323 Ga0495683_0236447 Ga0495683_0236447_270_632 120
46 3300047472 Ga0495686_0001320 Ga0495686_0001320_10340_10702 120
47 3300047472 Ga0495686_0019589 Ga0495686_0019589_3238_3600 120
48 3300048920 Ga0496117_0002989 Ga0496117_0002989_18202_18564 120
49 3300048920 Ga0496117_0437214 Ga0496117_0437214_249_611 120
50 3300048921 Ga0496118_0041401 Ga0496118_0041401_326_688 120
51 3300048921 Ga0496118_0121995 Ga0496118_0121995_1075_1437 120
52 3300048921 Ga0496118_0257353 Ga0496118_0257353_315_677 120
53 3300048924 Ga0496121_0010236 Ga0496121_0010236_1837_2199 120
54 3300048925 Ga0496122_0013706 Ga0496122_0013706_1719_2081 120
55 3300048926 Ga0496123_0014602 Ga0496123_0014602_1616_1978 120
56 3300048926 Ga0496123_0106060 Ga0496123_0106060_446_808 120
57 3300050489 nmdc:mga03683_216057_c1 nmdc:mga03683_216057_c1_256_618 120
58 3300053136 Ga0500559_0090092 Ga0500559_0090092_431_793 120
59 3300001915 JGI24741J21665_1005243 JGI24741J21665_10052432 121
60 3300001979 JGI24740J21852_10013639 JGI24740J21852_100136393 121
61 3300001979 JGI24740J21852_10079329 JGI24740J21852_100793292 121
62 3300001989 JGI24739J22299_10059101 JGI24739J22299_100591011 121
63 3300001990 JGI24737J22298_10001852 JGI24737J22298_100018529 121
64 3300001991 JGI24743J22301_10014867 JGI24743J22301_100148672 121
65 3300001991 JGI24743J22301_10016268 JGI24743J22301_100162682 121
66 3300002067 JGI24735J21928_10016408 JGI24735J21928_100164082 121
67 3300002067 JGI24735J21928_10027963 JGI24735J21928_100279632 121
68 3300002067 JGI24735J21928_10041379 JGI24735J21928_100413792 121
69 3300002067 JGI24735J21928_10041460 JGI24735J21928_100414601 121
70 3300002067 JGI24735J21928_10048876 JGI24735J21928_100488762 121
71 3300002067 JGI24735J21928_10079160 JGI24735J21928_100791602 121
72 3300002075 JGI24738J21930_10020090 JGI24738J21930_100200902 121
73 3300002077 JGI24744J21845_10000726 JGI24744J21845_100007266 121
74 3300003214 JGI25165J46597_1000106 JGI25165J46597_1000106106 121
75 3300003762 Ga0055542_1022713 Ga0055542_10227131 121
76 3300005327 Ga0070658_10000478 Ga0070658_1000047814 121
77 3300005327 Ga0070658_10005193 Ga0070658_100051936 121
78 3300005327 Ga0070658_10357618 Ga0070658_103576182 121
79 3300005328 Ga0070676_10001299 Ga0070676_100012995 121
80 3300005328 Ga0070676_10101437 Ga0070676_101014372 121
81 3300005334 Ga0068869_100000134 Ga0068869_10000013432 121
82 3300005338 Ga0068868_100000596 Ga0068868_10000059619 121
83 3300005339 Ga0070660_100000924 Ga0070660_1000009249 121
84 3300005339 Ga0070660_100097877 Ga0070660_1000978772 121
85 3300005339 Ga0070660_100131796 Ga0070660_1001317962 121
86 3300005339 Ga0070660_100227827 Ga0070660_1002278272 121
87 3300005339 Ga0070660_100867231 Ga0070660_1008672312 121
88 3300005344 Ga0070661_100523807 Ga0070661_1005238072 121
89 3300005344 Ga0070661_101914963 Ga0070661_1019149631 121
90 3300005354 Ga0070675_100013296 Ga0070675_1000132966 121
91 3300005355 Ga0070671_100072139 Ga0070671_1000721393 121
92 3300005356 Ga0070674_100324777 Ga0070674_1003247772 121
93 3300005364 Ga0070673_100000004 Ga0070673_10000000462 121
94 3300005364 Ga0070673_100311721 Ga0070673_1003117211 121
95 3300005366 Ga0070659_100044363 Ga0070659_1000443633 121
96 3300005366 Ga0070659_100044556 Ga0070659_1000445562 121
97 3300005366 Ga0070659_100486004 Ga0070659_1004860042 121
98 3300005366 Ga0070659_100493993 Ga0070659_1004939932 121
99 3300005455 Ga0070663_100018206 Ga0070663_1000182062 121
100 3300005456 Ga0070678_100012107 Ga0070678_1000121075 121
101 3300005457 Ga0070662_100220529 Ga0070662_1002205291 121
102 3300005459 Ga0068867_100000028 Ga0068867_10000002815 121
103 3300005539 Ga0068853_100148011 Ga0068853_1001480112 121
104 3300005539 Ga0068853_100272162 Ga0068853_1002721622 121
105 3300005539 Ga0068853_100323511 Ga0068853_1003235112 121
106 3300005543 Ga0070672_100128724 Ga0070672_1001287242 121
107 3300005563 Ga0068855_100078239 Ga0068855_1000782393 121
108 3300005563 Ga0068855_100527389 Ga0068855_1005273892 121
109 3300005563 Ga0068855_101369930 Ga0068855_1013699302 121
110 3300005578 Ga0068854_100000881 Ga0068854_1000008818 121
111 3300005578 Ga0068854_100122686 Ga0068854_1001226862 121
112 3300005616 Ga0068852_100503079 Ga0068852_1005030792 121
113 3300005616 Ga0068852_100933082 Ga0068852_1009330821 121
114 3300005718 Ga0068866_10068610 Ga0068866_100686102 121
115 3300005834 Ga0068851_10060715 Ga0068851_100607152 121
116 3300006237 Ga0097621_100004543 Ga0097621_1000045432 121
117 3300006237 Ga0097621_100638379 Ga0097621_1006383792 121
118 3300006353 Ga0075370_10005832 Ga0075370_100058322 121
119 3300006358 Ga0068871_101136377 Ga0068871_1011363772 121
120 3300006358 Ga0068871_101975478 Ga0068871_1019754781 121
121 3300006881 Ga0068865_100000006 Ga0068865_10000000662 121
122 3300009093 Ga0105240_10257552 Ga0105240_102575521 121
123 3300009093 Ga0105240_10313950 Ga0105240_103139502 121
124 3300009098 Ga0105245_10001073 Ga0105245_1000107318 121
125 3300009148 Ga0105243_10001033 Ga0105243_1000103319 121
126 3300009176 Ga0105242_10000413 Ga0105242_100004139 121
127 3300009545 Ga0105237_10050433 Ga0105237_100504334 121
128 3300009545 Ga0105237_10165183 Ga0105237_101651832 121
129 3300009545 Ga0105237_11348132 Ga0105237_113481322 121
130 3300009551 Ga0105238_10296612 Ga0105238_102966122 121
131 3300009553 Ga0105249_10019332 Ga0105249_100193323 121
132 3300010375 Ga0105239_10236976 Ga0105239_102369762 121
133 3300011119 Ga0105246_10002567 Ga0105246_100025677 121
134 3300013100 Ga0157373_10021371 Ga0157373_100213713 121
135 3300013100 Ga0157373_10194892 Ga0157373_101948922 121
136 3300013104 Ga0157370_10000318 Ga0157370_1000031849 121
137 3300013104 Ga0157370_10378766 Ga0157370_103787662 121
138 3300013104 Ga0157370_10541196 Ga0157370_105411962 121
139 3300013105 Ga0157369_10139389 Ga0157369_101393892 121
140 3300013105 Ga0157369_10213671 Ga0157369_102136712 121
141 3300013296 Ga0157374_10004031 Ga0157374_100040314 121
142 3300013297 Ga0157378_10001466 Ga0157378_1000146618 121
143 3300013307 Ga0157372_10077218 Ga0157372_100772183 121
144 3300013307 Ga0157372_10514172 Ga0157372_105141722 121
145 3300013307 Ga0157372_10525783 Ga0157372_105257832 121
146 3300013308 Ga0157375_10000586 Ga0157375_1000058625 121
147 3300014969 Ga0157376_10000347 Ga0157376_1000034716 121
148 3300017792 Ga0163161_10123837 Ga0163161_101238372 121
149 3300025250 Ga0209026_1005077 Ga0209026_10050773 121
150 3300025254 Ga0209148_1002373 Ga0209148_10023736 121
151 3300025261 Ga0209233_1000003 Ga0209233_1000003660 121
152 3300025272 Ga0209455_1000441 Ga0209455_10004418 121
153 3300025321 Ga0207656_10093619 Ga0207656_100936192 121
154 3300025904 Ga0207647_10053075 Ga0207647_100530752 121
155 3300025904 Ga0207647_10058505 Ga0207647_100585052 121
156 3300025904 Ga0207647_10266603 Ga0207647_102666032 121
157 3300025907 Ga0207645_10003000 Ga0207645_100030003 121
158 3300025907 Ga0207645_10059264 Ga0207645_100592642 121
159 3300025909 Ga0207705_10000049 Ga0207705_1000004967 121
160 3300025909 Ga0207705_10000119 Ga0207705_1000011961 121
161 3300025909 Ga0207705_10000903 Ga0207705_100009035 121
162 3300025909 Ga0207705_10200499 Ga0207705_102004991 121
163 3300025913 Ga0207695_10080676 Ga0207695_100806762 121
164 3300025913 Ga0207695_10395768 Ga0207695_103957682 121
165 3300025914 Ga0207671_10053198 Ga0207671_100531983 121
166 3300025914 Ga0207671_10132162 Ga0207671_101321622 121
167 3300025919 Ga0207657_10002263 Ga0207657_1000226317 121
168 3300025919 Ga0207657_10002725 Ga0207657_100027259 121
169 3300025919 Ga0207657_10080857 Ga0207657_100808571 121
170 3300025919 Ga0207657_10089130 Ga0207657_100891303 121
171 3300025919 Ga0207657_10124996 Ga0207657_101249962 121
172 3300025919 Ga0207657_10231737 Ga0207657_102317372 121
173 3300025920 Ga0207649_10257316 Ga0207649_102573162 121
174 3300025920 Ga0207649_10270260 Ga0207649_102702602 121
175 3300025924 Ga0207694_10085601 Ga0207694_100856012 121
176 3300025926 Ga0207659_10007115 Ga0207659_100071157 121
177 3300025927 Ga0207687_10021138 Ga0207687_100211383 121
178 3300025931 Ga0207644_10049340 Ga0207644_100493402 121
179 3300025932 Ga0207690_10007558 Ga0207690_100075584 121
180 3300025932 Ga0207690_10258953 Ga0207690_102589532 121
181 3300025932 Ga0207690_10365942 Ga0207690_103659422 121
182 3300025932 Ga0207690_10760939 Ga0207690_107609392 121
183 3300025934 Ga0207686_10093070 Ga0207686_100930702 121
184 3300025935 Ga0207709_10000182 Ga0207709_1000018262 121
185 3300025937 Ga0207669_10135430 Ga0207669_101354302 121
186 3300025938 Ga0207704_10000022 Ga0207704_1000002262 121
187 3300025940 Ga0207691_10083198 Ga0207691_100831983 121
188 3300025942 Ga0207689_10000462 Ga0207689_1000046225 121
189 3300025949 Ga0207667_10063803 Ga0207667_100638033 121
190 3300025949 Ga0207667_10490963 Ga0207667_104909633 121
191 3300025960 Ga0207651_10000009 Ga0207651_1000000962 121
192 3300025961 Ga0207712_10009745 Ga0207712_100097452 121
193 3300025981 Ga0207640_10000021 Ga0207640_10000021107 121
194 3300025981 Ga0207640_10167977 Ga0207640_101679772 121
195 3300026023 Ga0207677_10000164 Ga0207677_1000016419 121
196 3300026041 Ga0207639_10050735 Ga0207639_100507352 121
197 3300026041 Ga0207639_10131587 Ga0207639_101315872 121
198 3300026041 Ga0207639_10221999 Ga0207639_102219992 121
199 3300026067 Ga0207678_10028170 Ga0207678_100281702 121
200 3300026089 Ga0207648_10000084 Ga0207648_1000008416 121
201 3300026121 Ga0207683_10002643 Ga0207683_100026439 121
202 3300026142 Ga0207698_10329026 Ga0207698_103290262 121
203 3300026142 Ga0207698_10890277 Ga0207698_108902772 121
204 3300037312 Ga0395899_0005461 Ga0395899_0005461_6838_7203 121
205 3300037312 Ga0395899_0642436 Ga0395899_0642436_25_390 121
206 3300037418 Ga0395900_0760926 Ga0395900_0760926_509_874 121
207 3300037418 Ga0395900_0821917 Ga0395900_0821917_133_498 121
208 3300037471 Ga0395905_0016931 Ga0395905_0016931_2404_2769 121
209 3300037471 Ga0395905_0107151 Ga0395905_0107151_261_626 121
210 3300041456 Ga0451795_0962454 Ga0451795_0962454_348_713 121
211 3300042005 Ga0439448_0003054 Ga0439448_0003054_2717_3082 121
212 3300042012 Ga0439455_0033123 Ga0439455_0033123_658_1023 121
213 3300042157 Ga0439458_0004082 Ga0439458_0004082_1524_1889 121
214 3300046507 Ga0495606_0190150 Ga0495606_0190150_83_448 121
215 3300048905 Ga0496102_0624754 Ga0496102_0624754_187_552 121
216 3300048908 Ga0496105_1404732 Ga0496105_1404732_120_485 121
217 3300048925 Ga0496122_0035124 Ga0496122_0035124_1211_1576 121
218 3300048926 Ga0496123_0009700 Ga0496123_0009700_5529_5894 121
219 3300048927 Ga0496124_0009261 Ga0496124_0009261_1791_2156 121
220 3300048928 Ga0496125_0323694 Ga0496125_0323694_257_628 121
221 3300049570 Ga0501033_0440606 Ga0501033_0440606_262_627 121
222 3300050493 nmdc:mga0k408_83084_c1 nmdc:mga0k408_83084_c1_865_1230 121
223 3300053094 Ga0500566_0167500 Ga0500566_0167500_628_996 121
224 3300053104 Ga0500556_0244888 Ga0500556_0244888_251_622 121
225 3300053122 Ga0500608_226880 Ga0500608_226880_93_461 121
226 3300053140 Ga0500573_0217348 Ga0500573_0217348_53_418 121
227 3300053142 Ga0500577_0366702 Ga0500577_0366702_88_453 121
228 3300053153 Ga0500616_0017809 Ga0500616_0017809_3096_3467 121
229 3300005329 Ga0070683_100341959 Ga0070683_1003419592 122
230 3300005340 Ga0070689_101272897 Ga0070689_1012728972 122
231 3300005355 Ga0070671_101202855 Ga0070671_1012028552 122
232 3300005367 Ga0070667_101725606 Ga0070667_1017256061 122
233 3300005617 Ga0068859_100426232 Ga0068859_1004262322 122
234 3300006931 Ga0097620_100426211 Ga0097620_1004262112 122
235 3300010375 Ga0105239_11397139 Ga0105239_113971392 122
236 3300025924 Ga0207694_11211053 Ga0207694_112110531 122
237 3300025931 Ga0207644_10662973 Ga0207644_106629732 122
238 3300025961 Ga0207712_10304950 Ga0207712_103049502 122
239 3300028786 Ga0307517_10271038 Ga0307517_102710382 122
240 3300037471 Ga0395905_0164136 Ga0395905_0164136_1131_1541 122
241 3300039438 Ga0436360_0243841 Ga0436360_0243841_95_517 122
242 3300039447 Ga0436361_0144463 Ga0436361_0144463_134_538 122
243 3300046460 Ga0495638_0029588 Ga0495638_0029588_530_901 122
244 3300046492 Ga0495585_0361530 Ga0495585_0361530_17_424 122
245 3300046506 Ga0495583_0000139 Ga0495583_0000139_28488_28859 122
246 3300046507 Ga0495606_0004048 Ga0495606_0004048_1233_1604 122
247 3300046616 Ga0495668_0049366 Ga0495668_0049366_1872_2279 122
248 3300046665 Ga0495661_0034003 Ga0495661_0034003_705_1076 122
249 3300047320 Ga0495672_0055722 Ga0495672_0055722_1084_1572 122
250 3300047469 Ga0495673_0009614 Ga0495673_0009614_3141_3509 122
251 3300047472 Ga0495686_0000182 Ga0495686_0000182_52888_53259 122
252 3300047472 Ga0495686_0002610 Ga0495686_0002610_9953_10324 122
253 3300048906 Ga0496103_0270109 Ga0496103_0270109_582_953 122
254 3300048920 Ga0496117_0073876 Ga0496117_0073876_1387_1758 122
255 3300048921 Ga0496118_0084326 Ga0496118_0084326_615_986 122
256 3300049587 Ga0501071_0729736 Ga0501071_0729736_217_621 122
257 3300053103 Ga0500555_000188 Ga0500555_000188_27280_27651 122
258 3300053103 Ga0500555_028998 Ga0500555_028998_276_692 122
259 3300053142 Ga0500577_0007077 Ga0500577_0007077_1240_1611 122
260 3300053153 Ga0500616_0010388 Ga0500616_0010388_1433_1804 122
261 3300001976 JGI24752J21851_1000299 JGI24752J21851_10002999 123
262 3300002459 JGI24751J29686_10000225 JGI24751J29686_1000022515 123
263 3300003911 JGI25405J52794_10026775 JGI25405J52794_100267752 123
264 3300005289 Ga0065704_10078300 Ga0065704_100783003 123
265 3300005295 Ga0065707_10090132 Ga0065707_100901324 123
266 3300005295 Ga0065707_10210508 Ga0065707_102105083 123
267 3300005331 Ga0070670_100000005 Ga0070670_100000005166 123
268 3300005331 Ga0070670_100000021 Ga0070670_100000021139 123
269 3300005335 Ga0070666_10894948 Ga0070666_108949481 123
270 3300005353 Ga0070669_100000057 Ga0070669_10000005718 123
271 3300005367 Ga0070667_100000016 Ga0070667_100000016153 123
272 3300005367 Ga0070667_100000750 Ga0070667_10000075032 123
273 3300005367 Ga0070667_100001565 Ga0070667_1000015657 123
274 3300005617 Ga0068859_100002060 Ga0068859_1000020603 123
275 3300005618 Ga0068864_100000004 Ga0068864_100000004217 123
276 3300005618 Ga0068864_100000011 Ga0068864_100000011164 123
277 3300005719 Ga0068861_100009174 Ga0068861_1000091747 123
278 3300005841 Ga0068863_100000002 Ga0068863_100000002218 123
279 3300005841 Ga0068863_100090679 Ga0068863_1000906794 123
280 3300005843 Ga0068860_100000196 Ga0068860_10000019695 123
281 3300005844 Ga0068862_100000002 Ga0068862_100000002284 123
282 3300005844 Ga0068862_100000011 Ga0068862_10000001171 123
283 3300005937 Ga0081455_10001900 Ga0081455_1000190024 123
284 3300006931 Ga0097620_100002060 Ga0097620_1000020603 123
285 3300009011 Ga0105251_10001395 Ga0105251_1000139519 123
286 3300009177 Ga0105248_10000406 Ga0105248_100004064 123
287 3300009553 Ga0105249_10190267 Ga0105249_101902673 123
288 3300013306 Ga0163162_10556341 Ga0163162_105563412 123
289 3300014326 Ga0157380_10000031 Ga0157380_1000003122 123
290 3300014968 Ga0157379_10725409 Ga0157379_107254092 123
291 3300017792 Ga0163161_10356050 Ga0163161_103560502 123
292 3300025923 Ga0207681_10000001 Ga0207681_10000001495 123
293 3300025925 Ga0207650_10000018 Ga0207650_10000018164 123
294 3300025925 Ga0207650_10000298 Ga0207650_100002985 123
295 3300025941 Ga0207711_10000038 Ga0207711_10000038126 123
296 3300025941 Ga0207711_10009854 Ga0207711_100098544 123
297 3300025942 Ga0207689_10843337 Ga0207689_108433372 123
298 3300025986 Ga0207658_10000075 Ga0207658_1000007569 123
299 3300025986 Ga0207658_10000350 Ga0207658_1000035037 123
300 3300025986 Ga0207658_10000474 Ga0207658_1000047412 123
301 3300026088 Ga0207641_10000002 Ga0207641_10000002698 123
302 3300026088 Ga0207641_10001366 Ga0207641_1000136614 123
303 3300026095 Ga0207676_10000004 Ga0207676_10000004557 123
304 3300026095 Ga0207676_10000005 Ga0207676_10000005109 123
305 3300026118 Ga0207675_100001662 Ga0207675_10000166216 123
306 3300028380 Ga0268265_10000002 Ga0268265_10000002512 123
307 3300028380 Ga0268265_10000003 Ga0268265_10000003291 123
308 3300028381 Ga0268264_10000087 Ga0268264_10000087154 123
309 3300031731 Ga0307405_10031784 Ga0307405_100317842 123
310 3300031911 Ga0307412_10004683 Ga0307412_100046833 123
311 3300046520 Ga0495637_0015420 Ga0495637_0015420_128_505 123
312 3300046522 Ga0495643_0038139 Ga0495643_0038139_1830_2204 123
313 3300046522 Ga0495643_0089040 Ga0495643_0089040_262_639 123
314 3300048920 Ga0496117_0004127 Ga0496117_0004127_5065_5439 123
315 3300048921 Ga0496118_0000463 Ga0496118_0000463_8694_9068 123
316 3300053093 Ga0500651_0027888 Ga0500651_0027888_1801_2175 123
317 3300053096 Ga0500641_0326747 Ga0500641_0326747_181_555 123
318 3300053125 Ga0500618_036783 Ga0500618_036783_612_983 123
319 3300053130 Ga0500642_0001739 Ga0500642_0001739_5288_5662 123
320 3300053133 Ga0500655_000070 Ga0500655_000070_22230_22604 123
321 3300053142 Ga0500577_0203703 Ga0500577_0203703_370_744 123
322 3300053148 Ga0500590_002815 Ga0500590_002815_2774_3148 123
323 3300053156 Ga0500622_0004866 Ga0500622_0004866_5981_6355 123
324 3300053177 Ga0500636_0397237 Ga0500636_0397237_193_567 123
325 3300053177 Ga0500636_0533759 Ga0500636_0533759_59_433 123
326 3300053724 Ga0500570_000067 Ga0500570_000067_5749_6123 123
327 3300053730 Ga0500645_035533 Ga0500645_035533_18_395 123
328 3300001904 JGI24736J21556_1000110 JGI24736J21556_100011013 124
329 3300001976 JGI24752J21851_1000117 JGI24752J21851_10001175 124
330 3300001989 JGI24739J22299_10003120 JGI24739J22299_100031203 124
331 3300001989 JGI24739J22299_10009998 JGI24739J22299_100099984 124
332 3300001990 JGI24737J22298_10005386 JGI24737J22298_100053864 124
333 3300001990 JGI24737J22298_10235397 JGI24737J22298_102353971 124
334 3300002070 JGI24750J21931_1000358 JGI24750J21931_10003584 124
335 3300002070 JGI24750J21931_1000504 JGI24750J21931_10005045 124
336 3300002074 JGI24748J21848_1000029 JGI24748J21848_100002985 124
337 3300002075 JGI24738J21930_10001537 JGI24738J21930_100015375 124
338 3300002076 JGI24749J21850_1000261 JGI24749J21850_10002615 124
339 3300002239 JGI24034J26672_10000006 JGI24034J26672_10000006232 124
340 3300002244 JGI24742J22300_10001153 JGI24742J22300_100011532 124
341 3300002459 JGI24751J29686_10014058 JGI24751J29686_100140582 124
342 3300005295 Ga0065707_10082105 Ga0065707_1008210512 124
343 3300005295 Ga0065707_10248241 Ga0065707_102482412 124
344 3300005327 Ga0070658_10026624 Ga0070658_100266247 124
345 3300005330 Ga0070690_100000002 Ga0070690_100000002120 124
346 3300005331 Ga0070670_100399374 Ga0070670_1003993742 124
347 3300005335 Ga0070666_10000002 Ga0070666_10000002482 124
348 3300005339 Ga0070660_100008479 Ga0070660_1000084794 124
349 3300005340 Ga0070689_100015422 Ga0070689_1000154222 124
350 3300005344 Ga0070661_100459089 Ga0070661_1004590892 124
351 3300005344 Ga0070661_101360426 Ga0070661_1013604262 124
352 3300005353 Ga0070669_100000078 Ga0070669_10000007894 124
353 3300005365 Ga0070688_100056513 Ga0070688_1000565132 124
354 3300005366 Ga0070659_100220115 Ga0070659_1002201153 124
355 3300005445 Ga0070708_100489495 Ga0070708_1004894951 124
356 3300005455 Ga0070663_100018496 Ga0070663_1000184966 124
357 3300005457 Ga0070662_100010265 Ga0070662_1000102655 124
358 3300005466 Ga0070685_10000056 Ga0070685_1000005666 124
359 3300005471 Ga0070698_100433002 Ga0070698_1004330022 124
360 3300005535 Ga0070684_100154408 Ga0070684_1001544084 124
361 3300005535 Ga0070684_101982406 Ga0070684_1019824061 124
362 3300005539 Ga0068853_100006114 Ga0068853_1000061144 124
363 3300005539 Ga0068853_100779933 Ga0068853_1007799332 124
364 3300005544 Ga0070686_100000002 Ga0070686_100000002101 124
365 3300005548 Ga0070665_100000025 Ga0070665_100000025235 124
366 3300005564 Ga0070664_100391637 Ga0070664_1003916372 124
367 3300005577 Ga0068857_100041395 Ga0068857_1000413956 124
368 3300005577 Ga0068857_100391879 Ga0068857_1003918792 124
369 3300005577 Ga0068857_101378234 Ga0068857_1013782342 124
370 3300005578 Ga0068854_100015321 Ga0068854_1000153212 124
371 3300005578 Ga0068854_100100041 Ga0068854_1001000411 124
372 3300005578 Ga0068854_100557892 Ga0068854_1005578922 124
373 3300005616 Ga0068852_100216308 Ga0068852_1002163082 124
374 3300005617 Ga0068859_100040411 Ga0068859_1000404115 124
375 3300005617 Ga0068859_100044577 Ga0068859_1000445772 124
376 3300005618 Ga0068864_100987635 Ga0068864_1009876351 124
377 3300005719 Ga0068861_100003702 Ga0068861_10000370213 124
378 3300005834 Ga0068851_10150821 Ga0068851_101508212 124
379 3300005841 Ga0068863_100000070 Ga0068863_10000007076 124
380 3300005842 Ga0068858_100016855 Ga0068858_1000168555 124
381 3300005842 Ga0068858_100072792 Ga0068858_1000727922 124
382 3300005843 Ga0068860_100000001 Ga0068860_100000001489 124
383 3300005844 Ga0068862_100000020 Ga0068862_100000020179 124
384 3300006931 Ga0097620_100040412 Ga0097620_1000404122 124
385 3300006931 Ga0097620_100044577 Ga0097620_1000445774 124
386 3300009093 Ga0105240_10233073 Ga0105240_102330732 124
387 3300009093 Ga0105240_12289617 Ga0105240_122896171 124
388 3300009101 Ga0105247_10007084 Ga0105247_100070846 124
389 3300009101 Ga0105247_10025182 Ga0105247_100251825 124
390 3300009174 Ga0105241_10147951 Ga0105241_101479512 124
391 3300009174 Ga0105241_10374869 Ga0105241_103748692 124
392 3300009177 Ga0105248_10000010 Ga0105248_10000010127 124
393 3300009177 Ga0105248_10014736 Ga0105248_100147362 124
394 3300009545 Ga0105237_11140661 Ga0105237_111406612 124
395 3300009551 Ga0105238_10232627 Ga0105238_102326274 124
396 3300009551 Ga0105238_11007106 Ga0105238_110071061 124
397 3300009551 Ga0105238_11262110 Ga0105238_112621102 124
398 3300009553 Ga0105249_10000041 Ga0105249_10000041185 124
399 3300010375 Ga0105239_10597771 Ga0105239_105977712 124
400 3300013102 Ga0157371_11188315 Ga0157371_111883152 124
401 3300013105 Ga0157369_10018433 Ga0157369_100184333 124
402 3300013105 Ga0157369_11480111 Ga0157369_114801112 124
403 3300013297 Ga0157378_10014891 Ga0157378_100148913 124
404 3300013306 Ga0163162_10348255 Ga0163162_103482552 124
405 3300013306 Ga0163162_11232842 Ga0163162_112328422 124
406 3300013307 Ga0157372_10061610 Ga0157372_100616103 124
407 3300014325 Ga0163163_10017089 Ga0163163_100170897 124
408 3300014326 Ga0157380_10001415 Ga0157380_100014158 124
409 3300014326 Ga0157380_10118075 Ga0157380_101180753 124
410 3300014968 Ga0157379_10008271 Ga0157379_1000827111 124
411 3300014968 Ga0157379_10068801 Ga0157379_100688013 124
412 3300017792 Ga0163161_10002791 Ga0163161_1000279114 124
413 3300025321 Ga0207656_10460397 Ga0207656_104603972 124
414 3300025900 Ga0207710_10040389 Ga0207710_100403894 124
415 3300025903 Ga0207680_10000004 Ga0207680_10000004379 124
416 3300025904 Ga0207647_10000069 Ga0207647_1000006987 124
417 3300025909 Ga0207705_10137457 Ga0207705_101374574 124
418 3300025911 Ga0207654_10278499 Ga0207654_102784992 124
419 3300025911 Ga0207654_10567160 Ga0207654_105671602 124
420 3300025913 Ga0207695_10119320 Ga0207695_101193203 124
421 3300025913 Ga0207695_11324229 Ga0207695_113242291 124
422 3300025914 Ga0207671_10001601 Ga0207671_1000160123 124
423 3300025919 Ga0207657_10291944 Ga0207657_102919442 124
424 3300025920 Ga0207649_10010670 Ga0207649_100106703 124
425 3300025920 Ga0207649_11044008 Ga0207649_110440082 124
426 3300025923 Ga0207681_10000130 Ga0207681_1000013057 124
427 3300025924 Ga0207694_10002944 Ga0207694_100029442 124
428 3300025924 Ga0207694_10549544 Ga0207694_105495442 124
429 3300025931 Ga0207644_10074769 Ga0207644_100747693 124
430 3300025932 Ga0207690_10674764 Ga0207690_106747642 124
431 3300025933 Ga0207706_10020553 Ga0207706_100205534 124
432 3300025933 Ga0207706_10409298 Ga0207706_104092982 124
433 3300025936 Ga0207670_10007972 Ga0207670_100079728 124
434 3300025941 Ga0207711_10006432 Ga0207711_1000643211 124
435 3300025949 Ga0207667_11391781 Ga0207667_113917811 124
436 3300025949 Ga0207667_12076629 Ga0207667_120766291 124
437 3300025961 Ga0207712_10000001 Ga0207712_10000001253 124
438 3300025961 Ga0207712_10013288 Ga0207712_100132883 124
439 3300025981 Ga0207640_10350270 Ga0207640_103502702 124
440 3300025981 Ga0207640_10661640 Ga0207640_106616402 124
441 3300025981 Ga0207640_10751497 Ga0207640_107514972 124
442 3300025986 Ga0207658_10001041 Ga0207658_1000104114 124
443 3300026035 Ga0207703_10009056 Ga0207703_100090563 124
444 3300026041 Ga0207639_10102332 Ga0207639_101023321 124
445 3300026041 Ga0207639_10229412 Ga0207639_102294122 124
446 3300026067 Ga0207678_10037533 Ga0207678_100375333 124
447 3300026078 Ga0207702_10060037 Ga0207702_100600375 124
448 3300026088 Ga0207641_10000033 Ga0207641_10000033185 124
449 3300026095 Ga0207676_10068058 Ga0207676_100680585 124
450 3300026116 Ga0207674_10046831 Ga0207674_100468316 124
451 3300026116 Ga0207674_10282895 Ga0207674_102828952 124
452 3300026118 Ga0207675_100003358 Ga0207675_10000335816 124
453 3300026142 Ga0207698_10042180 Ga0207698_100421802 124
454 3300026142 Ga0207698_10771396 Ga0207698_107713962 124
455 3300028379 Ga0268266_10000028 Ga0268266_10000028152 124
456 3300028380 Ga0268265_10000524 Ga0268265_100005242 124
457 3300028381 Ga0268264_10000006 Ga0268264_10000006379 124
458 3300031548 Ga0307408_100328685 Ga0307408_1003286852 124
459 3300031901 Ga0307406_11609227 Ga0307406_116092271 124
460 3300031901 Ga0307406_11776098 Ga0307406_117760981 124
461 3300031911 Ga0307412_10254470 Ga0307412_102544702 124
462 3300031911 Ga0307412_10347690 Ga0307412_103476902 124
463 3300032002 Ga0307416_100368221 Ga0307416_1003682212 124
464 3300032004 Ga0307414_11696763 Ga0307414_116967631 124
465 3300041486 Ga0451807_0576451 Ga0451807_0576451_223_597 124
466 3300046525 Ga0495663_0011281 Ga0495663_0011281_1390_1764 124
467 3300046530 Ga0495654_0000736 Ga0495654_0000736_23230_23604 124
468 3300046616 Ga0495668_0001456 Ga0495668_0001456_7184_7558 124
469 3300046616 Ga0495668_0024118 Ga0495668_0024118_1098_1472 124
470 3300046794 Ga0495589_0079391 Ga0495589_0079391_675_1049 124
471 3300048904 Ga0496101_0153963 Ga0496101_0153963_198_572 124
472 3300048905 Ga0496102_0011371 Ga0496102_0011371_4031_4405 124
473 3300048906 Ga0496103_0008918 Ga0496103_0008918_630_1004 124
474 3300048907 Ga0496104_0468293 Ga0496104_0468293_645_1019 124
475 3300048908 Ga0496105_0089541 Ga0496105_0089541_249_623 124
476 3300048909 Ga0496106_0076114 Ga0496106_0076114_144_518 124
477 3300048910 Ga0496107_0079931 Ga0496107_0079931_1089_1463 124
478 3300048913 Ga0496110_0073425 Ga0496110_0073425_107_481 124
479 3300048914 Ga0496111_0275718 Ga0496111_0275718_656_1030 124
480 3300048919 Ga0496116_0032283 Ga0496116_0032283_2848_3222 124
481 3300048920 Ga0496117_0023979 Ga0496117_0023979_1308_1682 124
482 3300048921 Ga0496118_0020700 Ga0496118_0020700_4663_5037 124
483 3300048924 Ga0496121_0134874 Ga0496121_0134874_1027_1401 124
484 3300048927 Ga0496124_0918067 Ga0496124_0918067_136_510 124
485 3300049459 Ga0495678_046482 Ga0495678_046482_1039_1413 124
486 3300049513 Ga0501290_001796 Ga0501290_001796_1381_1755 124
487 3300049522 Ga0501299_013381 Ga0501299_013381_515_889 124
488 3300049523 Ga0501300_007119 Ga0501300_007119_1228_1602 124
489 3300049686 Ga0501257_000012 Ga0501257_000012_5016_5390 124
490 3300049776 Ga0501280_001885 Ga0501280_001885_1552_1926 124
491 3300049778 Ga0501282_003357 Ga0501282_003357_1000_1374 124
492 3300053087 Ga0500643_000215 Ga0500643_000215_18255_18629 124
493 3300053087 Ga0500643_002098 Ga0500643_002098_6840_7214 124
494 3300053116 Ga0500592_000065 Ga0500592_000065_13757_14131 124
495 3300053116 Ga0500592_000255 Ga0500592_000255_6713_7087 124
496 3300053134 Ga0500658_0046162 Ga0500658_0046162_746_1120 124
497 3300053151 Ga0500604_0042035 Ga0500604_0042035_628_1002 124
498 3300053151 Ga0500604_0090261 Ga0500604_0090261_355_729 124
499 3300053158 Ga0500627_0000086 Ga0500627_0000086_14660_15034 124
500 3300053158 Ga0500627_0000569 Ga0500627_0000569_4321_4746 124
501 3300053727 Ga0500611_024256 Ga0500611_024256_115_489 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

31

118

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8301 5 107
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8189 1 101
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7879 5 107
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6394 1 123
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6304 1 123
ID Description Score Start End Superfamily
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8903 5 99 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8849 6 119 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8849 5 100 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8641 6 119 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8334 5 99 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A382CKB3-F1-model_v4 CENP-V/GFA domain-containing protein 0.9749 39 100 GO:0016846
GO:0046872
AF-A0A2S6UP30-F1-model_v4 CENP-V/GFA domain-containing protein 0.9577 42 100 GO:0016846
GO:0046872
AF-A0A7W7ESE2-F1-model_v4 CENP-V/GFA domain-containing protein 0.9426 42 100 GO:0016846
GO:0046872
AF-A0A331GFE7-F1-model_v4 deleted 0.9387 42 100
AF-K0CAU2-F1-model_v4 Glutathione-dependent formaldehyde-activating GFA 0.9373 42 100 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map