F455650

General Info

Members Datasets Scaffolds Average Seq Length
501 262 501 348

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100000067|Ga0070714_10000006724
Length 401
Sequence MSDDKRPQDRGDNVPRVDAGQIAAGERPPEEGRKRATPAARGSTSGTEQATAPAQPQQPSGNGHNHVDLPRDAYKGAATTLCAGCGHNAITNHIIKAFYEYGVEPYRLAKMSGIGCSSKAPAYFVSQAHGFNAVHGRMPSVATGAKLANRELIAVGISGDGDTASIGLGQFCHMIRRNIDLVYLCENNGVYGLTKGQFSATADLGSRAKSGKVNEFEMIDICGLAVELGASFVARSFSGDGKQVVPLIKAALAHNGTAVLDIISPCVTFNDHEGSTKSYKYVKEHDVALQELDFIPFFETVEADYEPGTSTEIELHDGSHVRLRKLAEGEHDPRSRIDALRVIHEARAKGEVLTGLLYLKPEMPDLATREGLPSDRILRDLTEADLRPERDAFEALMREYA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.6
Rhizosphere 96.41
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1150003 2162886006 Bacteria 2142
2 Ga0058862_10745830 3300004803 Bacteria 1318
3 Ga0058862_12638485 3300004803 Bacteria 1757
4 Ga0065707_10088517 3300005295 Bacteria 4636
5 Ga0070658_10021359 3300005327 Bacteria 5188
6 Ga0070676_10036951 3300005328 Bacteria 2814
7 Ga0070683_100000142 3300005329 Bacteria 46584
8 Ga0070690_100000568 3300005330 Bacteria 18592
9 Ga0070690_100010124 3300005330 Bacteria 5478
10 Ga0070670_100075752 3300005331 Bacteria 2891
11 Ga0068869_100083057 3300005334 Bacteria 2395
12 Ga0070666_10001689 3300005335 Bacteria 13468
13 Ga0070680_100391532 3300005336 Bacteria 1184
14 Ga0070682_100000136 3300005337 Bacteria 60325
15 Ga0068868_100000028 3300005338 Bacteria 78800
16 Ga0068868_100000733 3300005338 Bacteria 22189
17 Ga0068868_100125609 3300005338 Bacteria 2095
18 Ga0070660_100189713 3300005339 Bacteria 1665
19 Ga0070689_100000645 3300005340 Bacteria 21089
20 Ga0070689_100008225 3300005340 Bacteria 7336
21 Ga0070689_100015529 3300005340 Bacteria 5556
22 Ga0070689_100039170 3300005340 Bacteria 3628
23 Ga0070689_100049659 3300005340 Bacteria 3240
24 Ga0070689_100151752 3300005340 Bacteria 1869
25 Ga0070689_100249528 3300005340 Bacteria 1464
26 Ga0070691_10037364 3300005341 Bacteria 2291
27 Ga0070687_100084447 3300005343 Bacteria 1740
28 Ga0070692_10004151 3300005345 Bacteria 5997
29 Ga0070675_100008002 3300005354 Bacteria 8192
30 Ga0070675_100256852 3300005354 Bacteria 1530
31 Ga0070671_100138271 3300005355 Unclassified 2054
32 Ga0070688_100000867 3300005365 Bacteria 15032
33 Ga0070688_100034529 3300005365 Bacteria 3064
34 Ga0070688_100060778 3300005365 Bacteria 2387
35 Ga0070688_100135644 3300005365 Bacteria 1666
36 Ga0070659_100154435 3300005366 Bacteria 1874
37 Ga0070709_10024164 3300005434 Bacteria 3575
38 Ga0070714_100000067 3300005435 Bacteria 95377
39 Ga0070714_100001898 3300005435 Bacteria 15257
40 Ga0070714_100004546 3300005435 Bacteria 10458
41 Ga0070713_100002683 3300005436 Bacteria 11608
42 Ga0070713_100003349 3300005436 Bacteria 10577
43 Ga0070713_100007464 3300005436 Bacteria 7678
44 Ga0070700_100092520 3300005441 Bacteria 1976
45 Ga0070700_100124586 3300005441 Bacteria 1731
46 Ga0070694_100075225 3300005444 Bacteria 2335
47 Ga0070694_100138238 3300005444 Bacteria 1767
48 Ga0070708_100013882 3300005445 Bacteria 6616
49 Ga0070708_100305871 3300005445 Bacteria 1497
50 Ga0070663_100096035 3300005455 Bacteria 2204
51 Ga0070678_100002667 3300005456 Bacteria 9833
52 Ga0070662_100064696 3300005457 Bacteria 2679
53 Ga0070681_10008674 3300005458 Bacteria 9970
54 Ga0070681_10056508 3300005458 Bacteria 3906
55 Ga0068867_100058151 3300005459 Bacteria 2865
56 Ga0070685_10065959 3300005466 Bacteria 2132
57 Ga0070685_10100262 3300005466 Bacteria 1768
58 Ga0070706_100001627 3300005467 Bacteria 23437
59 Ga0070706_100068825 3300005467 Bacteria 3274
60 Ga0070698_100035724 3300005471 Bacteria 5136
61 Ga0070698_100090667 3300005471 Bacteria 3040
62 Ga0070698_100110157 3300005471 Bacteria 2719
63 Ga0070699_100353992 3300005518 Bacteria 1323
64 Ga0070679_100024763 3300005530 Bacteria 5882
65 Ga0070679_100391351 3300005530 Bacteria 1336
66 Ga0070697_100164959 3300005536 Bacteria 1873
67 Ga0070672_100000334 3300005543 Bacteria 27005
68 Ga0070672_100114114 3300005543 Unclassified 2205
69 Ga0070686_100012358 3300005544 Bacteria 4859
70 Ga0070686_100070661 3300005544 Bacteria 2283
71 Ga0070686_100257808 3300005544 Bacteria 1277
72 Ga0070686_100293290 3300005544 Bacteria 1204
73 Ga0070696_100006145 3300005546 Bacteria 8025
74 Ga0070665_100246099 3300005548 Bacteria 1788
75 Ga0070704_100146047 3300005549 Bacteria 1853
76 Ga0068855_100000226 3300005563 Bacteria 72130
77 Ga0068855_100000407 3300005563 Bacteria 53304
78 Ga0068855_100043888 3300005563 Bacteria 5294
79 Ga0068855_100126896 3300005563 Bacteria 2916
80 Ga0068857_100054154 3300005577 Bacteria 3560
81 Ga0068857_100079347 3300005577 Bacteria 2930
82 Ga0068857_100293728 3300005577 Bacteria 1497
83 Ga0068856_100022839 3300005614 Bacteria 6084
84 Ga0068859_100005280 3300005617 Bacteria 13135
85 Ga0068859_100094873 3300005617 Bacteria 3036
86 Ga0068859_100207190 3300005617 Bacteria 2046
87 Ga0068859_100300542 3300005617 Bacteria 1698
88 Ga0068864_100000059 3300005618 Bacteria 125184
89 Ga0068861_100029579 3300005719 Bacteria 4008
90 Ga0068851_10025196 3300005834 Bacteria 2917
91 Ga0068870_10015487 3300005840 Bacteria 3619
92 Ga0068870_10031868 3300005840 Bacteria 2674
93 Ga0068860_100171812 3300005843 Bacteria 2094
94 Ga0068862_100214890 3300005844 Bacteria 1739
95 Ga0081455_10000833 3300005937 Bacteria 39733
96 Ga0081455_10001809 3300005937 Bacteria 25785
97 Ga0081538_10004255 3300005981 Bacteria 13267
98 Ga0081540_1054494 3300005983 Bacteria 1954
99 Ga0070717_10000406 3300006028 Bacteria 27593
100 Ga0070717_10000496 3300006028 Bacteria 24977
101 Ga0070717_10048424 3300006028 Unclassified 3486
102 Ga0070717_10050501 3300006028 Bacteria 3419
103 Ga0070717_10164130 3300006028 Bacteria 1929
104 Ga0070717_10345956 3300006028 Bacteria 1328
105 Ga0070715_10010982 3300006163 Bacteria 3246
106 Ga0097621_100140553 3300006237 Unclassified 2063
107 Ga0097621_100397180 3300006237 Bacteria 1234
108 Ga0068871_100048916 3300006358 Bacteria 3415
109 Ga0068871_100167777 3300006358 Unclassified 1880
110 Ga0068871_100407660 3300006358 Bacteria 1211
111 Ga0075428_100019260 3300006844 Bacteria 7551
112 Ga0075428_100070179 3300006844 Bacteria 3830
113 Ga0075428_100252700 3300006844 Bacteria 1899
114 Ga0075430_100049789 3300006846 Bacteria 3535
115 Ga0075431_100005181 3300006847 Bacteria 12839
116 Ga0075431_100011885 3300006847 Bacteria 8786
117 Ga0075431_100112447 3300006847 Bacteria 2810
118 Ga0075433_10000404 3300006852 Bacteria 27547
119 Ga0075433_10115500 3300006852 Bacteria 2382
120 Ga0075433_10225383 3300006852 Bacteria 1665
121 Ga0075433_10244763 3300006852 Bacteria 1592
122 Ga0075434_100001846 3300006871 Bacteria 18283
123 Ga0075434_100062715 3300006871 Bacteria 3701
124 Ga0075434_100067627 3300006871 Bacteria 3558
125 Ga0075434_100119338 3300006871 Bacteria 2651
126 Ga0075434_100180043 3300006871 Bacteria 2134
127 Ga0075434_100323348 3300006871 Bacteria 1563
128 Ga0075429_100009804 3300006880 Bacteria 8304
129 Ga0075429_100062201 3300006880 Bacteria 3252
130 Ga0075429_100115477 3300006880 Bacteria 2346
131 Ga0075429_100294874 3300006880 Bacteria 1420
132 Ga0068865_100003422 3300006881 Bacteria 9495
133 Ga0068865_100035366 3300006881 Bacteria 3358
134 Ga0075436_100003800 3300006914 Bacteria 10358
135 Ga0075436_100102658 3300006914 Bacteria 1992
136 Ga0097620_100005280 3300006931 Bacteria 13135
137 Ga0097620_100094874 3300006931 Bacteria 3036
138 Ga0097620_100207186 3300006931 Bacteria 2046
139 Ga0097620_100300547 3300006931 Bacteria 1698
140 Ga0075435_100006100 3300007076 Bacteria 8496
141 Ga0075435_100024363 3300007076 Bacteria 4695
142 Ga0075435_100081760 3300007076 Bacteria 2654
143 Ga0105240_10299565 3300009093 Bacteria 1840
144 Ga0111539_10002906 3300009094 Bacteria 22736
145 Ga0111539_10009333 3300009094 Bacteria 12392
146 Ga0111539_10025983 3300009094 Bacteria 7166
147 Ga0111539_10059437 3300009094 Bacteria 4533
148 Ga0111539_10121456 3300009094 Bacteria 3061
149 Ga0111539_10195304 3300009094 Bacteria 2361
150 Ga0111539_10214097 3300009094 Bacteria 2245
151 Ga0105245_10000003 3300009098 Bacteria 488207
152 Ga0105245_10048499 3300009098 Bacteria 3799
153 Ga0114129_10008529 3300009147 Bacteria 14609
154 Ga0114129_10009039 3300009147 Bacteria 14198
155 Ga0114129_10090144 3300009147 Bacteria 4251
156 Ga0114129_10109282 3300009147 Bacteria 3817
157 Ga0114129_10135417 3300009147 Bacteria 3380
158 Ga0114129_10136315 3300009147 Bacteria 3368
159 Ga0114129_10231189 3300009147 Bacteria 2490
160 Ga0105241_10044789 3300009174 Unclassified 3354
161 Ga0105241_10100382 3300009174 Bacteria 2300
162 Ga0105242_10032463 3300009176 Bacteria 4175
163 Ga0105248_10162883 3300009177 Bacteria 2515
164 Ga0105248_10284248 3300009177 Bacteria 1862
165 Ga0105237_10014840 3300009545 Bacteria 8129
166 Ga0105238_10000005 3300009551 Bacteria 372840
167 Ga0105249_10101967 3300009553 Bacteria 2700
168 Ga0105239_10032297 3300010375 Bacteria 5753
169 Ga0105239_10704363 3300010375 Bacteria 1155
170 Ga0105246_10440244 3300011119 Bacteria 1093
171 Ga0157370_10134673 3300013104 Bacteria 2303
172 Ga0157374_10000006 3300013296 Bacteria 640284
173 Ga0157378_10002015 3300013297 Bacteria 18177
174 Ga0157378_10014094 3300013297 Bacteria 6998
175 Ga0157378_10060674 3300013297 Bacteria 3374
176 Ga0157378_10065068 3300013297 Bacteria 3263
177 Ga0157378_10080725 3300013297 Bacteria 2939
178 Ga0157378_10177240 3300013297 Unclassified 2003
179 Ga0157372_10085469 3300013307 Bacteria 3578
180 Ga0157372_10190391 3300013307 Bacteria 2376
181 Ga0157372_10210972 3300013307 Bacteria 2251
182 Ga0157372_10237081 3300013307 Bacteria 2116
183 Ga0157372_10280094 3300013307 Bacteria 1939
184 Ga0157375_10000009 3300013308 Bacteria 366440
185 Ga0157375_10000011 3300013308 Bacteria 334557
186 Ga0157375_10001876 3300013308 Bacteria 18091
187 Ga0157375_10095100 3300013308 Bacteria 3049
188 Ga0157375_10211459 3300013308 Bacteria 2097
189 Ga0163163_10018104 3300014325 Bacteria 6584
190 Ga0157380_10054379 3300014326 Bacteria 3177
191 Ga0157380_10074764 3300014326 Bacteria 2752
192 Ga0157380_10233483 3300014326 Bacteria 1654
193 Ga0157377_10000003 3300014745 Bacteria 435133
194 Ga0157377_10000125 3300014745 Bacteria 49824
195 Ga0157377_10060349 3300014745 Bacteria 2164
196 Ga0157376_10000003 3300014969 Bacteria 568634
197 Ga0157376_10438927 3300014969 Bacteria 1271
198 Ga0163161_10039457 3300017792 Bacteria 3390
199 Ga0213873_10000004 3300021358 Bacteria 774374
200 Ga0213876_10000007 3300021384 Bacteria 670340
201 Ga0213876_10000066 3300021384 Bacteria 126862
202 Ga0213876_10000602 3300021384 Bacteria 26658
203 Ga0207697_10017663 3300025315 Unclassified 2930
204 Ga0207656_10024920 3300025321 Bacteria 2425
205 Ga0207647_10005755 3300025904 Bacteria 9047
206 Ga0207645_10010876 3300025907 Bacteria 6237
207 Ga0207645_10182334 3300025907 Bacteria 1378
208 Ga0207643_10022237 3300025908 Bacteria 3489
209 Ga0207705_10001290 3300025909 Bacteria 20109
210 Ga0207684_10036697 3300025910 Bacteria 4160
211 Ga0207707_10116160 3300025912 Bacteria 2338
212 Ga0207707_10158568 3300025912 Unclassified 1978
213 Ga0207663_10005678 3300025916 Bacteria 6310
214 Ga0207660_10004274 3300025917 Bacteria 9311
215 Ga0207662_10003742 3300025918 Bacteria 7881
216 Ga0207662_10024958 3300025918 Bacteria 3441
217 Ga0207657_10016384 3300025919 Bacteria 7150
218 Ga0207657_10131696 3300025919 Bacteria 2049
219 Ga0207652_10034691 3300025921 Bacteria 4253
220 Ga0207646_10034543 3300025922 Bacteria 4570
221 Ga0207646_10038984 3300025922 Bacteria 4276
222 Ga0207694_10000001 3300025924 Bacteria 4078485
223 Ga0207694_10216218 3300025924 Bacteria 1562
224 Ga0207650_10006848 3300025925 Bacteria 7775
225 Ga0207659_10009252 3300025926 Bacteria 6152
226 Ga0207659_10010199 3300025926 Bacteria 5890
227 Ga0207687_10000002 3300025927 Bacteria 975489
228 Ga0207700_10002109 3300025928 Bacteria 11356
229 Ga0207700_10053963 3300025928 Bacteria 3014
230 Ga0207664_10000005 3300025929 Bacteria 485048
231 Ga0207664_10001696 3300025929 Bacteria 14517
232 Ga0207664_10021221 3300025929 Bacteria 4825
233 Ga0207706_10004247 3300025933 Bacteria 13494
234 Ga0207709_10140757 3300025935 Bacteria 1658
235 Ga0207670_10000033 3300025936 Bacteria 110494
236 Ga0207670_10000201 3300025936 Bacteria 39273
237 Ga0207670_10028523 3300025936 Bacteria 3545
238 Ga0207670_10049452 3300025936 Bacteria 2813
239 Ga0207704_10028540 3300025938 Bacteria 3098
240 Ga0207691_10001611 3300025940 Bacteria 22421
241 Ga0207711_10148096 3300025941 Bacteria 2116
242 Ga0207689_10008093 3300025942 Bacteria 9170
243 Ga0207689_10094339 3300025942 Bacteria 2458
244 Ga0207667_10000039 3300025949 Bacteria 278843
245 Ga0207667_10000321 3300025949 Bacteria 66544
246 Ga0207667_10538854 3300025949 Bacteria 1181
247 Ga0207640_10016757 3300025981 Bacteria 4270
248 Ga0207677_10000006 3300026023 Bacteria 283855
249 Ga0207678_10108608 3300026067 Bacteria 2367
250 Ga0207708_10105578 3300026075 Bacteria 2183
251 Ga0207648_10067986 3300026089 Bacteria 3105
252 Ga0207676_10000007 3300026095 Bacteria 591074
253 Ga0207674_10078765 3300026116 Bacteria 3300
254 Ga0207674_10085189 3300026116 Bacteria 3156
255 Ga0207675_100095422 3300026118 Bacteria 2798
256 Ga0207683_10000078 3300026121 Bacteria 77219
257 Ga0207698_10326004 3300026142 Bacteria 1440
258 Ga0209968_1003708 3300027526 Bacteria 2291
259 Ga0209999_1002689 3300027543 Bacteria 3143
260 Ga0209970_1001671 3300027614 Bacteria 3862
261 Ga0209983_1003087 3300027665 Bacteria 3581
262 Ga0209971_1007467 3300027682 Bacteria 2594
263 Ga0209974_10000549 3300027876 Bacteria 12525
264 Ga0207428_10005087 3300027907 Bacteria 12351
265 Ga0207428_10016948 3300027907 Bacteria 6261
266 Ga0268265_10127806 3300028380 Bacteria 2107
267 Ga0265338_10045736 3300028800 Bacteria 4021
268 Ga0307511_10000862 3300030521 Bacteria 32343
269 Ga0307509_10105690 3300031507 Bacteria 2836
270 Ga0307408_100027499 3300031548 Unclassified 3920
271 Ga0265314_10001122 3300031711 Bacteria 30962
272 Ga0265314_10005011 3300031711 Bacteria 12068
273 Ga0307405_10001505 3300031731 Bacteria 9861
274 Ga0307410_10173943 3300031852 Unclassified 1625
275 Ga0307412_10047640 3300031911 Unclassified 2816
276 Ga0307409_100078815 3300031995 Unclassified 2652
277 Ga0307416_100006882 3300032002 Bacteria 7159
278 Ga0307411_10098149 3300032005 Bacteria 2064
279 Ga0307415_100030146 3300032126 Unclassified 3477
280 Ga0373959_0008166 3300034820 Bacteria 1775
281 Ga0373926_0022983 3300035083 Bacteria 2163
282 Ga0373929_0006663 3300035085 Bacteria 2091
283 Ga0373934_0002542 3300035086 Bacteria 6712
284 Ga0373934_0059710 3300035086 Unclassified 1518
285 Ga0373940_0001788 3300035088 Bacteria 4007
286 Ga0373940_0004660 3300035088 Bacteria 2913
287 Ga0373949_0018521 3300035090 Bacteria 1579
288 Ga0373949_0025220 3300035090 Bacteria 1386
289 Ga0373923_0024296 3300035111 Bacteria 2391
290 Ga0373932_0006260 3300035112 Bacteria 2812
291 Ga0373941_0007842 3300035115 Bacteria 2630
292 Ga0373953_0005915 3300035117 Bacteria 3999
293 Ga0373956_0003764 3300035119 Bacteria 6109
294 Ga0373960_0006259 3300035121 Bacteria 2788
295 Ga0373960_0023607 3300035121 Bacteria 1657
296 Ga0373955_0008681 3300035172 Bacteria 4730
297 Ga0373955_0011948 3300035172 Bacteria 4160
298 Ga0373942_0012349 3300035207 Bacteria 2038
299 Ga0373961_0011317 3300035241 Bacteria 2212
300 Ga0373961_0058258 3300035241 Unclassified 1165
301 Ga0373962_0021413 3300035242 Bacteria 1705
302 Ga0373931_0001400 3300035691 Bacteria 10327
303 Ga0373931_0010994 3300035691 Bacteria 4363
304 Ga0373931_0027221 3300035691 Unclassified 2917
305 Ga0373931_0031116 3300035691 Bacteria 2752
306 Ga0373935_0021469 3300035692 Bacteria 3954
307 Ga0373935_0074899 3300035692 Bacteria 2189
308 Ga0373927_0001252 3300035695 Bacteria 19261
309 Ga0373927_0002585 3300035695 Bacteria 13199
310 Ga0373927_0048483 3300035695 Bacteria 2748
311 Ga0373927_0137696 3300035695 Bacteria 1596
312 Ga0373927_0207323 3300035695 Bacteria 1287
313 Ga0373933_0168329 3300035724 Unclassified 1394
314 Ga0373937_0010071 3300036401 Bacteria 8243
315 Ga0373937_0028112 3300036401 Bacteria 5088
316 Ga0373937_0050158 3300036401 Unclassified 3822
317 Ga0373937_0094646 3300036401 Bacteria 2770
318 Ga0373925_0005976 3300037068 Bacteria 9013
319 Ga0373925_0030902 3300037068 Bacteria 3933
320 Ga0373925_0203805 3300037068 Bacteria 1574
321 Ga0395905_0000202 3300037471 Bacteria 92335
322 Ga0436365_0173471 3300039437 Bacteria 110650
323 Ga0436365_0285258 3300039437 Bacteria 125381
324 Ga0436365_0394061 3300039437 Bacteria 142715
325 Ga0436365_0590290 3300039437 Bacteria 2419
326 Ga0436363_0949567 3300039450 Bacteria 1308
327 Ga0436362_0290430 3300039453 Bacteria 772596
328 Ga0451577_0000038 3300042876 Bacteria 356728
329 Ga0451577_0122323 3300042876 Bacteria 2331
330 Ga0451577_0211817 3300042876 Bacteria 1751
331 Ga0451577_0236899 3300042876 Bacteria 1651
332 Ga0453683_0001077 3300044673 Bacteria 25251
333 Ga0453683_0003901 3300044673 Bacteria 10809
334 Ga0453683_0008271 3300044673 Bacteria 6995
335 Ga0453683_0016019 3300044673 Bacteria 4843
336 Ga0453683_0034411 3300044673 Bacteria 3194
337 Ga0453683_0100831 3300044673 Bacteria 1812
338 Ga0453684_0000028 3300044712 Bacteria 762381
339 Ga0453684_0000751 3300044712 Bacteria 112832
340 Ga0453684_0001738 3300044712 Bacteria 58296
341 Ga0453684_0015135 3300044712 Bacteria 12236
342 Ga0453684_0030109 3300044712 Bacteria 7678
343 Ga0453684_0032583 3300044712 Bacteria 7289
344 Ga0453684_0072411 3300044712 Bacteria 4350
345 Ga0453684_0104216 3300044712 Bacteria 3463
346 Ga0453684_0111274 3300044712 Bacteria 3327
347 Ga0451576_0001578 3300045051 Bacteria 38296
348 Ga0451576_0015626 3300045051 Bacteria 8401
349 Ga0451576_0074388 3300045051 Bacteria 3535
350 Ga0451576_0141420 3300045051 Bacteria 2509
351 Ga0451576_0217487 3300045051 Bacteria 1995
352 Ga0451576_0559567 3300045051 Bacteria 1201
353 Ga0495592_0008237 3300046454 Bacteria 7825
354 Ga0495592_0052530 3300046454 Bacteria 3025
355 Ga0495603_0064379 3300046455 Bacteria 2162
356 Ga0495629_0007358 3300046459 Bacteria 8118
357 Ga0495629_0125751 3300046459 Bacteria 1786
358 Ga0495651_0024309 3300046462 Bacteria 4714
359 Ga0495580_0006742 3300046472 Bacteria 9318
360 Ga0495580_0021241 3300046472 Bacteria 4792
361 Ga0495580_0072403 3300046472 Bacteria 2407
362 Ga0495582_0014371 3300046473 Bacteria 4352
363 Ga0495662_0113487 3300046476 Bacteria 1329
364 Ga0495664_0054388 3300046477 Bacteria 2380
365 Ga0495594_0050240 3300046499 Bacteria 2293
366 Ga0495594_0220163 3300046499 Bacteria 1082
367 Ga0495620_0004030 3300046515 Bacteria 8346
368 Ga0495628_0001892 3300046516 Bacteria 18990
369 Ga0495628_0066911 3300046516 Bacteria 2807
370 Ga0495630_0083784 3300046517 Bacteria 2407
371 Ga0495630_0098252 3300046517 Bacteria 2215
372 Ga0495630_0155263 3300046517 Bacteria 1742
373 Ga0495652_0018168 3300046529 Bacteria 6275
374 Ga0495652_0168088 3300046529 Bacteria 1695
375 Ga0495665_0133672 3300046531 Bacteria 1298
376 Ga0495640_0091990 3300046533 Bacteria 2001
377 Ga0495587_0009725 3300046536 Bacteria 6148
378 Ga0495587_0040008 3300046536 Bacteria 2803
379 Ga0495645_0016758 3300046543 Bacteria 5242
380 Ga0495634_0028172 3300046642 Bacteria 3901
381 Ga0495635_0039007 3300046663 Bacteria 3288
382 Ga0495635_0093975 3300046663 Bacteria 2050
383 Ga0495657_0129819 3300046675 Bacteria 1579
384 Ga0495599_0012884 3300046678 Bacteria 5160
385 Ga0495599_0015228 3300046678 Bacteria 4769
386 Ga0495647_0036431 3300046681 Bacteria 1852
387 Ga0495658_0029154 3300046683 Unclassified 2984
388 Ga0495658_0048231 3300046683 Bacteria 2401
389 Ga0495669_0063212 3300046684 Bacteria 1679
390 Ga0495613_0096124 3300046689 Bacteria 2142
391 Ga0495600_0012933 3300046809 Bacteria 5231
392 Ga0495581_0174442 3300047315 Bacteria 1257
393 Ga0495636_0079007 3300047318 Bacteria 1414
394 Ga0495674_0120821 3300047319 Bacteria 2213
395 Ga0495680_0207019 3300047322 Bacteria 1405
396 Ga0495675_0014448 3300047444 Bacteria 4988
397 Ga0495593_0098058 3300047673 Bacteria 1505
398 Ga0496102_0032578 3300048905 Bacteria 4682
399 Ga0496105_0025866 3300048908 Bacteria 4781
400 Ga0496105_0117579 3300048908 Bacteria 2193
401 Ga0496110_0055444 3300048913 Bacteria 3488
402 Ga0496112_0005257 3300048915 Bacteria 11151
403 Ga0496112_0307291 3300048915 Bacteria 1531
404 Ga0496113_0003956 3300048916 Bacteria 8996
405 Ga0496114_0183304 3300048917 Bacteria 1829
406 Ga0501031_0033198 3300049568 Bacteria 3365
407 Ga0501031_0038593 3300049568 Bacteria 3117
408 Ga0501032_0037851 3300049569 Bacteria 3288
409 Ga0501033_0148246 3300049570 Bacteria 1694
410 Ga0501034_0026577 3300049571 Bacteria 5894
411 Ga0501034_0092387 3300049571 Bacteria 3023
412 Ga0501037_0005986 3300049573 Bacteria 8883
413 Ga0501037_0010856 3300049573 Bacteria 6693
414 Ga0501038_0004795 3300049574 Bacteria 12567
415 Ga0501038_0017923 3300049574 Bacteria 6397
416 Ga0501038_0226881 3300049574 Bacteria 1488
417 Ga0501038_0269329 3300049574 Bacteria 1343
418 Ga0501043_0000251 3300049579 Bacteria 48637
419 Ga0501043_0020374 3300049579 Bacteria 5201
420 Ga0501047_0015352 3300049581 Bacteria 7297
421 Ga0501048_0020093 3300049582 Bacteria 4898
422 Ga0501048_0187846 3300049582 Bacteria 1464
423 Ga0501067_0151481 3300049583 Bacteria 1292
424 Ga0501068_0008621 3300049584 Bacteria 5681
425 Ga0501068_0031578 3300049584 Bacteria 3146
426 Ga0501068_0073359 3300049584 Bacteria 2091
427 Ga0501069_0016405 3300049585 Bacteria 3979
428 Ga0501070_0000018 3300049586 Bacteria 172755
429 Ga0501070_0019047 3300049586 Bacteria 5757
430 Ga0501071_0006882 3300049587 Bacteria 7412
431 Ga0501071_0096343 3300049587 Bacteria 2178
432 Ga0501072_0061542 3300049588 Bacteria 2961
433 Ga0501073_0035568 3300049589 Bacteria 3539
434 Ga0501073_0140460 3300049589 Bacteria 1674
435 Ga0501074_0014429 3300049590 Bacteria 5749
436 Ga0501074_0016089 3300049590 Bacteria 5436
437 Ga0501076_0005674 3300049592 Bacteria 8999
438 Ga0501076_0241273 3300049592 Bacteria 1478
439 Ga0501077_0069471 3300049593 Unclassified 2232
440 Ga0501077_0132807 3300049593 Bacteria 1578
441 Ga0501079_0016337 3300049741 Bacteria 5671
442 Ga0501079_0026109 3300049741 Bacteria 4479
443 Ga0501079_0156213 3300049741 Bacteria 1778
444 Ga0501080_0005835 3300049742 Bacteria 11018
445 Ga0501080_0114579 3300049742 Bacteria 2499
446 Ga0501080_0219518 3300049742 Unclassified 1740
447 Ga0501081_0035903 3300049743 Bacteria 3376
448 Ga0501083_0070443 3300049744 Bacteria 2326
449 Ga0501035_0001141 3300049822 Bacteria 27779
450 Ga0501035_0161505 3300049822 Bacteria 1939
451 Ga0501044_0005635 3300049823 Bacteria 13902
452 Ga0501044_0009752 3300049823 Bacteria 10449
453 Ga0501044_0182911 3300049823 Bacteria 2062
454 Ga0501044_0426122 3300049823 Bacteria 1236
455 nmdc:mga05p37_31692_c1 3300050507 Bacteria 6460
456 nmdc:mga05p37_393126_c1 3300050507 Bacteria 1621
457 nmdc:mga05p37_46231_c1 3300050507 Bacteria 5352
458 nmdc:mga05p37_86663_c1 3300050507 Bacteria 3860
459 nmdc:mga09592_7630_c1 3300050508 Bacteria 8796
460 nmdc:mga09592_85956_c1 3300050508 Bacteria 2683
461 nmdc:mga06r32_104881_c1 3300050510 Bacteria 2777
462 nmdc:mga06r32_1580_c1 3300050510 Bacteria 20528
463 nmdc:mga06r32_38440_c1 3300050510 Bacteria 4534
464 nmdc:mga06r32_59178_c1 3300050510 Bacteria 3684
465 nmdc:mga08y16_165126_c1 3300050511 Bacteria 2300
466 nmdc:mga08y16_233170_c1 3300050511 Bacteria 1904
467 nmdc:mga08y16_320741_c1 3300050511 Bacteria 1595
468 nmdc:mga08y16_48959_c1 3300050511 Bacteria 4423
469 nmdc:mga08y16_63958_c1 3300050511 Bacteria 3842
470 nmdc:mga08y16_77222_c1 3300050511 Bacteria 3472
471 nmdc:mga0n895_12461_c1 3300050512 Bacteria 7629
472 nmdc:mga0n895_171436_c1 3300050512 Bacteria 2202
473 nmdc:mga0n895_18264_c1 3300050512 Bacteria 6485
474 nmdc:mga0n895_184823_c1 3300050512 Bacteria 2115
475 nmdc:mga0n895_33344_c1 3300050512 Bacteria 4949
476 nmdc:mga0n895_363763_c1 3300050512 Bacteria 1465
477 nmdc:mga0n895_52332_c1 3300050512 Bacteria 4008
478 nmdc:mga0n895_95186_c1 3300050512 Unclassified 2983
479 nmdc:mga0rr50_18662_c1 3300050513 Bacteria 3238
480 nmdc:mga0rr50_20888_c1 3300050513 Bacteria 4458
481 nmdc:mga0rr50_41382_c1 3300050513 Bacteria 3357
482 nmdc:mga0rr50_60393_c1 3300050513 Bacteria 2851
483 nmdc:mga0rr50_64572_c1 3300050513 Bacteria 2770
484 nmdc:mga0rr50_75646_c1 3300050513 Bacteria 2582
485 nmdc:mga0rr50_83451_c1 3300050513 Bacteria 2470
486 nmdc:mga08x19_2619_c1 3300050514 Bacteria 10908
487 nmdc:mga08x19_44785_c1 3300050514 Bacteria 2826
488 nmdc:mga0a205_12893_c1 3300050515 Bacteria 7753
489 nmdc:mga0a205_157829_c1 3300050515 Bacteria 2166
490 nmdc:mga0a205_2396_c1 3300050515 Bacteria 16542
491 nmdc:mga0a205_254526_c1 3300050515 Bacteria 1635
492 nmdc:mga0a205_71973_c1 3300050515 Bacteria 3339
493 Ga0495595_0062646 3300053084 Bacteria 1744
494 Ga0495619_0144757 3300053085 Bacteria 1638
495 Ga0501084_0013388 3300054114 Bacteria 6786
496 Ga0587084_012210 3300059477 Bacteria 1159
497 Ga0587091_012107 3300059511 Bacteria 1359
498 Ga0587119_008243 3300059658 Bacteria 1142
499 Ga0501082_0061077 3300060353 Bacteria 3244
500 Ga0530510_0016460 3300061734 Bacteria 5234
501 Ga0530510_0059690 3300061734 Bacteria 2759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10010876 Ga0207645_100108762 290
2 3300036401 Ga0373937_0050158 Ga0373937_0050158_2890_3783 297
3 3300049742 Ga0501080_0219518 Ga0501080_0219518_232_1194 320
4 3300049583 Ga0501067_0151481 Ga0501067_0151481_73_1041 322
5 3300006847 Ga0075431_100011885 Ga0075431_1000118855 323
6 3300046472 Ga0495580_0072403 Ga0495580_0072403_1084_2127 323
7 3300050510 nmdc:mga06r32_1580_c1 nmdc:mga06r32_1580_c1_13562_14605 323
8 3300010375 Ga0105239_10032297 Ga0105239_100322975 324
9 3300046683 Ga0495658_0048231 Ga0495658_0048231_787_1830 327
10 3300025908 Ga0207643_10022237 Ga0207643_100222372 328
11 3300046476 Ga0495662_0113487 Ga0495662_0113487_200_1186 328
12 3300046515 Ga0495620_0004030 Ga0495620_0004030_7003_8058 328
13 3300005328 Ga0070676_10036951 Ga0070676_100369512 329
14 3300005339 Ga0070660_100189713 Ga0070660_1001897132 329
15 3300005354 Ga0070675_100256852 Ga0070675_1002568521 329
16 3300005355 Ga0070671_100138271 Ga0070671_1001382711 329
17 3300005456 Ga0070678_100002667 Ga0070678_1000026673 329
18 3300005457 Ga0070662_100064696 Ga0070662_1000646962 329
19 3300005459 Ga0068867_100058151 Ga0068867_1000581512 329
20 3300005543 Ga0070672_100114114 Ga0070672_1001141141 329
21 3300005548 Ga0070665_100246099 Ga0070665_1002460992 329
22 3300005563 Ga0068855_100126896 Ga0068855_1001268963 329
23 3300005614 Ga0068856_100022839 Ga0068856_1000228394 329
24 3300005834 Ga0068851_10025196 Ga0068851_100251962 329
25 3300006358 Ga0068871_100048916 Ga0068871_1000489163 329
26 3300006881 Ga0068865_100003422 Ga0068865_1000034224 329
27 3300009098 Ga0105245_10048499 Ga0105245_100484991 329
28 3300009147 Ga0114129_10008529 Ga0114129_1000852918 329
29 3300009174 Ga0105241_10044789 Ga0105241_100447892 329
30 3300009176 Ga0105242_10032463 Ga0105242_100324633 329
31 3300009545 Ga0105237_10014840 Ga0105237_100148402 329
32 3300010375 Ga0105239_10704363 Ga0105239_107043631 329
33 3300011119 Ga0105246_10440244 Ga0105246_104402441 329
34 3300013297 Ga0157378_10177240 Ga0157378_101772402 329
35 3300013308 Ga0157375_10211459 Ga0157375_102114592 329
36 3300014325 Ga0163163_10018104 Ga0163163_100181042 329
37 3300014969 Ga0157376_10438927 Ga0157376_104389272 329
38 3300017792 Ga0163161_10039457 Ga0163161_100394572 329
39 3300025315 Ga0207697_10017663 Ga0207697_100176632 329
40 3300025321 Ga0207656_10024920 Ga0207656_100249201 329
41 3300025904 Ga0207647_10005755 Ga0207647_100057554 329
42 3300025919 Ga0207657_10131696 Ga0207657_101316962 329
43 3300025933 Ga0207706_10004247 Ga0207706_100042479 329
44 3300025935 Ga0207709_10140757 Ga0207709_101407572 329
45 3300026089 Ga0207648_10067986 Ga0207648_100679863 329
46 3300026121 Ga0207683_10000078 Ga0207683_1000007831 329
47 3300026142 Ga0207698_10326004 Ga0207698_103260042 329
48 3300042876 Ga0451577_0211817 Ga0451577_0211817_618_1667 329
49 3300046459 Ga0495629_0007358 Ga0495629_0007358_3463_4512 329
50 3300046517 Ga0495630_0155263 Ga0495630_0155263_292_1347 329
51 3300046536 Ga0495587_0040008 Ga0495587_0040008_313_1362 329
52 3300046684 Ga0495669_0063212 Ga0495669_0063212_168_1214 329
53 3300048917 Ga0496114_0183304 Ga0496114_0183304_608_1654 329
54 3300050507 nmdc:mga05p37_31692_c1 nmdc:mga05p37_31692_c1_4630_5619 329
55 3300050512 nmdc:mga0n895_12461_c1 nmdc:mga0n895_12461_c1_2627_3616 329
56 3300050513 nmdc:mga0rr50_41382_c1 nmdc:mga0rr50_41382_c1_1533_2522 329
57 3300005577 Ga0068857_100054154 Ga0068857_1000541543 330
58 3300026116 Ga0207674_10085189 Ga0207674_100851893 330
59 3300046499 Ga0495594_0220163 Ga0495594_0220163_25_1020 331
60 3300035241 Ga0373961_0058258 Ga0373961_0058258_40_1044 333
61 3300048908 Ga0496105_0117579 Ga0496105_0117579_405_1409 333
62 3300048913 Ga0496110_0055444 Ga0496110_0055444_1253_2257 333
63 3300048915 Ga0496112_0005257 Ga0496112_0005257_4950_5954 333
64 3300048916 Ga0496113_0003956 Ga0496113_0003956_5266_6270 333
65 3300005436 Ga0070713_100002683 Ga0070713_1000026836 334
66 3300025928 Ga0207700_10053963 Ga0207700_100539632 334
67 3300046499 Ga0495594_0050240 Ga0495594_0050240_1112_2158 334
68 3300044712 Ga0453684_0072411 Ga0453684_0072411_284_1336 335
69 3300005577 Ga0068857_100293728 Ga0068857_1002937281 337
70 3300009094 Ga0111539_10002906 Ga0111539_100029061 337
71 3300027907 Ga0207428_10016948 Ga0207428_100169489 337
72 3300047318 Ga0495636_0079007 Ga0495636_0079007_257_1288 337
73 3300050511 nmdc:mga08y16_48959_c1 nmdc:mga08y16_48959_c1_437_1468 337
74 3300005466 Ga0070685_10065959 Ga0070685_100659591 338
75 3300009147 Ga0114129_10231189 Ga0114129_102311892 338
76 3300035115 Ga0373941_0007842 Ga0373941_0007842_274_1290 338
77 3300045051 Ga0451576_0001578 Ga0451576_0001578_3732_4841 338
78 3300046683 Ga0495658_0029154 Ga0495658_0029154_1831_2871 338
79 3300050507 nmdc:mga05p37_86663_c1 nmdc:mga05p37_86663_c1_2330_3367 338
80 3300050510 nmdc:mga06r32_38440_c1 nmdc:mga06r32_38440_c1_2583_3620 338
81 3300050512 nmdc:mga0n895_171436_c1 nmdc:mga0n895_171436_c1_326_1363 338
82 3300050515 nmdc:mga0a205_254526_c1 nmdc:mga0a205_254526_c1_187_1224 338
83 3300005295 Ga0065707_10088517 Ga0065707_100885173 339
84 3300005327 Ga0070658_10021359 Ga0070658_100213593 339
85 3300005329 Ga0070683_100000142 Ga0070683_10000014233 339
86 3300005335 Ga0070666_10001689 Ga0070666_1000168910 339
87 3300005337 Ga0070682_100000136 Ga0070682_10000013649 339
88 3300005338 Ga0068868_100000028 Ga0068868_10000002871 339
89 3300005338 Ga0068868_100000733 Ga0068868_1000007333 339
90 3300005340 Ga0070689_100049659 Ga0070689_1000496593 339
91 3300005345 Ga0070692_10004151 Ga0070692_100041512 339
92 3300005365 Ga0070688_100135644 Ga0070688_1001356441 339
93 3300005366 Ga0070659_100154435 Ga0070659_1001544351 339
94 3300005435 Ga0070714_100004546 Ga0070714_1000045463 339
95 3300005436 Ga0070713_100007464 Ga0070713_10000746411 339
96 3300005445 Ga0070708_100013882 Ga0070708_1000138823 339
97 3300005455 Ga0070663_100096035 Ga0070663_1000960351 339
98 3300005467 Ga0070706_100001627 Ga0070706_1000016279 339
99 3300005471 Ga0070698_100035724 Ga0070698_1000357242 339
100 3300005471 Ga0070698_100090667 Ga0070698_1000906676 339
101 3300005543 Ga0070672_100000334 Ga0070672_10000033421 339
102 3300005544 Ga0070686_100012358 Ga0070686_1000123584 339
103 3300005546 Ga0070696_100006145 Ga0070696_1000061453 339
104 3300005563 Ga0068855_100043888 Ga0068855_1000438886 339
105 3300005617 Ga0068859_100207190 Ga0068859_1002071902 339
106 3300005618 Ga0068864_100000059 Ga0068864_10000005996 339
107 3300005840 Ga0068870_10015487 Ga0068870_100154873 339
108 3300005840 Ga0068870_10031868 Ga0068870_100318682 339
109 3300006028 Ga0070717_10000406 Ga0070717_1000040624 339
110 3300006028 Ga0070717_10048424 Ga0070717_100484242 339
111 3300006237 Ga0097621_100397180 Ga0097621_1003971801 339
112 3300006358 Ga0068871_100407660 Ga0068871_1004076602 339
113 3300006847 Ga0075431_100005181 Ga0075431_1000051812 339
114 3300006871 Ga0075434_100323348 Ga0075434_1003233481 339
115 3300006881 Ga0068865_100035366 Ga0068865_1000353662 339
116 3300006931 Ga0097620_100207186 Ga0097620_1002071862 339
117 3300007076 Ga0075435_100006100 Ga0075435_1000061008 339
118 3300009094 Ga0111539_10195304 Ga0111539_101953043 339
119 3300009098 Ga0105245_10000003 Ga0105245_1000000318 339
120 3300009147 Ga0114129_10009039 Ga0114129_100090392 339
121 3300009551 Ga0105238_10000005 Ga0105238_10000005221 339
122 3300013104 Ga0157370_10134673 Ga0157370_101346732 339
123 3300013296 Ga0157374_10000006 Ga0157374_10000006460 339
124 3300013297 Ga0157378_10060674 Ga0157378_100606742 339
125 3300013297 Ga0157378_10065068 Ga0157378_100650682 339
126 3300013297 Ga0157378_10080725 Ga0157378_100807252 339
127 3300013307 Ga0157372_10085469 Ga0157372_100854693 339
128 3300013307 Ga0157372_10190391 Ga0157372_101903912 339
129 3300013307 Ga0157372_10210972 Ga0157372_102109722 339
130 3300013307 Ga0157372_10237081 Ga0157372_102370812 339
131 3300013307 Ga0157372_10280094 Ga0157372_102800942 339
132 3300013308 Ga0157375_10000009 Ga0157375_10000009313 339
133 3300013308 Ga0157375_10000011 Ga0157375_1000001184 339
134 3300013308 Ga0157375_10001876 Ga0157375_1000187612 339
135 3300013308 Ga0157375_10095100 Ga0157375_100951002 339
136 3300014326 Ga0157380_10054379 Ga0157380_100543793 339
137 3300014745 Ga0157377_10000003 Ga0157377_10000003116 339
138 3300014745 Ga0157377_10000125 Ga0157377_1000012526 339
139 3300014969 Ga0157376_10000003 Ga0157376_10000003391 339
140 3300021358 Ga0213873_10000004 Ga0213873_10000004395 339
141 3300021384 Ga0213876_10000007 Ga0213876_10000007395 339
142 3300021384 Ga0213876_10000066 Ga0213876_1000006656 339
143 3300021384 Ga0213876_10000602 Ga0213876_100006025 339
144 3300025909 Ga0207705_10001290 Ga0207705_100012902 339
145 3300025910 Ga0207684_10036697 Ga0207684_100366972 339
146 3300025917 Ga0207660_10004274 Ga0207660_100042743 339
147 3300025919 Ga0207657_10016384 Ga0207657_100163845 339
148 3300025921 Ga0207652_10034691 Ga0207652_100346913 339
149 3300025922 Ga0207646_10034543 Ga0207646_100345435 339
150 3300025922 Ga0207646_10038984 Ga0207646_100389844 339
151 3300025924 Ga0207694_10000001 Ga0207694_100000012934 339
152 3300025924 Ga0207694_10216218 Ga0207694_102162181 339
153 3300025925 Ga0207650_10006848 Ga0207650_100068483 339
154 3300025927 Ga0207687_10000002 Ga0207687_1000000218 339
155 3300025929 Ga0207664_10021221 Ga0207664_100212212 339
156 3300025938 Ga0207704_10028540 Ga0207704_100285402 339
157 3300025940 Ga0207691_10001611 Ga0207691_1000161111 339
158 3300025942 Ga0207689_10008093 Ga0207689_100080938 339
159 3300025949 Ga0207667_10538854 Ga0207667_105388541 339
160 3300025981 Ga0207640_10016757 Ga0207640_100167572 339
161 3300026023 Ga0207677_10000006 Ga0207677_1000000634 339
162 3300026067 Ga0207678_10108608 Ga0207678_101086081 339
163 3300026095 Ga0207676_10000007 Ga0207676_10000007265 339
164 3300027526 Ga0209968_1003708 Ga0209968_10037082 339
165 3300027543 Ga0209999_1002689 Ga0209999_10026892 339
166 3300027614 Ga0209970_1001671 Ga0209970_10016712 339
167 3300027665 Ga0209983_1003087 Ga0209983_10030872 339
168 3300027682 Ga0209971_1007467 Ga0209971_10074672 339
169 3300027876 Ga0209974_10000549 Ga0209974_1000054910 339
170 3300030521 Ga0307511_10000862 Ga0307511_1000086220 339
171 3300035083 Ga0373926_0022983 Ga0373926_0022983_616_1665 339
172 3300035090 Ga0373949_0018521 Ga0373949_0018521_127_1179 339
173 3300035172 Ga0373955_0008681 Ga0373955_0008681_1338_2390 339
174 3300035692 Ga0373935_0021469 Ga0373935_0021469_2146_3189 339
175 3300035692 Ga0373935_0074899 Ga0373935_0074899_580_1632 339
176 3300035695 Ga0373927_0137696 Ga0373927_0137696_82_1125 339
177 3300036401 Ga0373937_0010071 Ga0373937_0010071_1003_2055 339
178 3300036401 Ga0373937_0028112 Ga0373937_0028112_1676_2719 339
179 3300037068 Ga0373925_0030902 Ga0373925_0030902_690_1739 339
180 3300037471 Ga0395905_0000202 Ga0395905_0000202_40556_41578 339
181 3300039437 Ga0436365_0173471 Ga0436365_0173471_22569_23621 339
182 3300039437 Ga0436365_0285258 Ga0436365_0285258_58495_59553 339
183 3300039437 Ga0436365_0394061 Ga0436365_0394061_29402_30457 339
184 3300039437 Ga0436365_0590290 Ga0436365_0590290_817_1869 339
185 3300039450 Ga0436363_0949567 Ga0436363_0949567_109_1161 339
186 3300039453 Ga0436362_0290430 Ga0436362_0290430_333170_334225 339
187 3300042876 Ga0451577_0000038 Ga0451577_0000038_49910_50947 339
188 3300042876 Ga0451577_0236899 Ga0451577_0236899_53_1108 339
189 3300044673 Ga0453683_0003901 Ga0453683_0003901_8776_9810 339
190 3300044673 Ga0453683_0008271 Ga0453683_0008271_1647_2684 339
191 3300044673 Ga0453683_0016019 Ga0453683_0016019_658_1692 339
192 3300044712 Ga0453684_0000028 Ga0453684_0000028_711435_712472 339
193 3300045051 Ga0451576_0141420 Ga0451576_0141420_1160_2197 339
194 3300046459 Ga0495629_0125751 Ga0495629_0125751_345_1406 339
195 3300046472 Ga0495580_0021241 Ga0495580_0021241_2759_3802 339
196 3300046473 Ga0495582_0014371 Ga0495582_0014371_1688_2731 339
197 3300046517 Ga0495630_0083784 Ga0495630_0083784_962_2011 339
198 3300046531 Ga0495665_0133672 Ga0495665_0133672_223_1272 339
199 3300046663 Ga0495635_0093975 Ga0495635_0093975_675_1724 339
200 3300046681 Ga0495647_0036431 Ga0495647_0036431_750_1793 339
201 3300047315 Ga0495581_0174442 Ga0495581_0174442_27_1079 339
202 3300047673 Ga0495593_0098058 Ga0495593_0098058_332_1381 339
203 3300048905 Ga0496102_0032578 Ga0496102_0032578_2022_3065 339
204 3300049568 Ga0501031_0038593 Ga0501031_0038593_1925_2977 339
205 3300049569 Ga0501032_0037851 Ga0501032_0037851_843_1895 339
206 3300049570 Ga0501033_0148246 Ga0501033_0148246_57_1109 339
207 3300049574 Ga0501038_0269329 Ga0501038_0269329_136_1188 339
208 3300049584 Ga0501068_0031578 Ga0501068_0031578_285_1376 339
209 3300049586 Ga0501070_0000018 Ga0501070_0000018_62063_63115 339
210 3300049741 Ga0501079_0156213 Ga0501079_0156213_203_1261 339
211 3300049742 Ga0501080_0005835 Ga0501080_0005835_90_1142 339
212 3300049822 Ga0501035_0001141 Ga0501035_0001141_18927_19979 339
213 3300049822 Ga0501035_0161505 Ga0501035_0161505_52_1104 339
214 3300049823 Ga0501044_0005635 Ga0501044_0005635_4185_5237 339
215 3300049823 Ga0501044_0182911 Ga0501044_0182911_417_1469 339
216 3300049823 Ga0501044_0426122 Ga0501044_0426122_60_1112 339
217 3300050512 nmdc:mga0n895_184823_c1 nmdc:mga0n895_184823_c1_481_1524 339
218 3300050513 nmdc:mga0rr50_75646_c1 nmdc:mga0rr50_75646_c1_1326_2381 339
219 3300004803 Ga0058862_10745830 Ga0058862_107458301 340
220 3300005330 Ga0070690_100010124 Ga0070690_1000101242 340
221 3300005331 Ga0070670_100075752 Ga0070670_1000757522 340
222 3300005334 Ga0068869_100083057 Ga0068869_1000830572 340
223 3300005338 Ga0068868_100125609 Ga0068868_1001256092 340
224 3300005340 Ga0070689_100000645 Ga0070689_1000006459 340
225 3300005340 Ga0070689_100008225 Ga0070689_1000082257 340
226 3300005340 Ga0070689_100039170 Ga0070689_1000391704 340
227 3300005340 Ga0070689_100151752 Ga0070689_1001517522 340
228 3300005340 Ga0070689_100249528 Ga0070689_1002495282 340
229 3300005341 Ga0070691_10037364 Ga0070691_100373642 340
230 3300005343 Ga0070687_100084447 Ga0070687_1000844472 340
231 3300005365 Ga0070688_100000867 Ga0070688_1000008676 340
232 3300005365 Ga0070688_100034529 Ga0070688_1000345294 340
233 3300005434 Ga0070709_10024164 Ga0070709_100241642 340
234 3300005435 Ga0070714_100001898 Ga0070714_1000018985 340
235 3300005436 Ga0070713_100003349 Ga0070713_1000033492 340
236 3300005441 Ga0070700_100092520 Ga0070700_1000925202 340
237 3300005444 Ga0070694_100075225 Ga0070694_1000752252 340
238 3300005444 Ga0070694_100138238 Ga0070694_1001382382 340
239 3300005458 Ga0070681_10008674 Ga0070681_100086742 340
240 3300005458 Ga0070681_10056508 Ga0070681_100565085 340
241 3300005467 Ga0070706_100068825 Ga0070706_1000688253 340
242 3300005471 Ga0070698_100110157 Ga0070698_1001101572 340
243 3300005518 Ga0070699_100353992 Ga0070699_1003539921 340
244 3300005544 Ga0070686_100070661 Ga0070686_1000706612 340
245 3300005544 Ga0070686_100257808 Ga0070686_1002578081 340
246 3300005549 Ga0070704_100146047 Ga0070704_1001460472 340
247 3300005563 Ga0068855_100000226 Ga0068855_1000002264 340
248 3300005563 Ga0068855_100000407 Ga0068855_10000040721 340
249 3300005577 Ga0068857_100079347 Ga0068857_1000793472 340
250 3300005617 Ga0068859_100094873 Ga0068859_1000948731 340
251 3300005617 Ga0068859_100300542 Ga0068859_1003005422 340
252 3300005719 Ga0068861_100029579 Ga0068861_1000295792 340
253 3300005843 Ga0068860_100171812 Ga0068860_1001718123 340
254 3300005844 Ga0068862_100214890 Ga0068862_1002148902 340
255 3300005937 Ga0081455_10000833 Ga0081455_100008338 340
256 3300005983 Ga0081540_1054494 Ga0081540_10544942 340
257 3300006028 Ga0070717_10050501 Ga0070717_100505012 340
258 3300006028 Ga0070717_10164130 Ga0070717_101641302 340
259 3300006028 Ga0070717_10345956 Ga0070717_103459561 340
260 3300006163 Ga0070715_10010982 Ga0070715_100109821 340
261 3300006237 Ga0097621_100140553 Ga0097621_1001405532 340
262 3300006358 Ga0068871_100167777 Ga0068871_1001677772 340
263 3300006844 Ga0075428_100019260 Ga0075428_1000192608 340
264 3300006844 Ga0075428_100070179 Ga0075428_1000701793 340
265 3300006852 Ga0075433_10000404 Ga0075433_100004044 340
266 3300006852 Ga0075433_10244763 Ga0075433_102447632 340
267 3300006871 Ga0075434_100001846 Ga0075434_10000184611 340
268 3300006871 Ga0075434_100180043 Ga0075434_1001800432 340
269 3300006880 Ga0075429_100009804 Ga0075429_1000098047 340
270 3300006914 Ga0075436_100003800 Ga0075436_1000038005 340
271 3300006914 Ga0075436_100102658 Ga0075436_1001026582 340
272 3300006931 Ga0097620_100094874 Ga0097620_1000948741 340
273 3300006931 Ga0097620_100300547 Ga0097620_1003005471 340
274 3300009093 Ga0105240_10299565 Ga0105240_102995651 340
275 3300009094 Ga0111539_10009333 Ga0111539_100093336 340
276 3300009094 Ga0111539_10059437 Ga0111539_100594372 340
277 3300009094 Ga0111539_10121456 Ga0111539_101214563 340
278 3300009094 Ga0111539_10214097 Ga0111539_102140972 340
279 3300009147 Ga0114129_10090144 Ga0114129_100901445 340
280 3300009147 Ga0114129_10136315 Ga0114129_101363154 340
281 3300009174 Ga0105241_10100382 Ga0105241_101003822 340
282 3300009177 Ga0105248_10162883 Ga0105248_101628832 340
283 3300009177 Ga0105248_10284248 Ga0105248_102842482 340
284 3300013297 Ga0157378_10002015 Ga0157378_100020156 340
285 3300014326 Ga0157380_10233483 Ga0157380_102334832 340
286 3300025907 Ga0207645_10182334 Ga0207645_101823341 340
287 3300025912 Ga0207707_10116160 Ga0207707_101161602 340
288 3300025912 Ga0207707_10158568 Ga0207707_101585682 340
289 3300025916 Ga0207663_10005678 Ga0207663_100056784 340
290 3300025918 Ga0207662_10003742 Ga0207662_100037424 340
291 3300025926 Ga0207659_10010199 Ga0207659_100101995 340
292 3300025928 Ga0207700_10002109 Ga0207700_100021094 340
293 3300025929 Ga0207664_10001696 Ga0207664_100016964 340
294 3300025936 Ga0207670_10000033 Ga0207670_1000003330 340
295 3300025936 Ga0207670_10000201 Ga0207670_1000020120 340
296 3300025936 Ga0207670_10049452 Ga0207670_100494522 340
297 3300025941 Ga0207711_10148096 Ga0207711_101480962 340
298 3300025942 Ga0207689_10094339 Ga0207689_100943392 340
299 3300025949 Ga0207667_10000039 Ga0207667_1000003967 340
300 3300025949 Ga0207667_10000321 Ga0207667_1000032151 340
301 3300026075 Ga0207708_10105578 Ga0207708_101055782 340
302 3300026116 Ga0207674_10078765 Ga0207674_100787652 340
303 3300026118 Ga0207675_100095422 Ga0207675_1000954222 340
304 3300027907 Ga0207428_10005087 Ga0207428_100050878 340
305 3300028380 Ga0268265_10127806 Ga0268265_101278062 340
306 3300028800 Ga0265338_10045736 Ga0265338_100457366 340
307 3300031711 Ga0265314_10001122 Ga0265314_100011222 340
308 3300031711 Ga0265314_10005011 Ga0265314_100050116 340
309 3300034820 Ga0373959_0008166 Ga0373959_0008166_127_1185 340
310 3300035085 Ga0373929_0006663 Ga0373929_0006663_452_1510 340
311 3300035086 Ga0373934_0002542 Ga0373934_0002542_4335_5414 340
312 3300035086 Ga0373934_0059710 Ga0373934_0059710_427_1470 340
313 3300035088 Ga0373940_0001788 Ga0373940_0001788_1490_2548 340
314 3300035088 Ga0373940_0004660 Ga0373940_0004660_1439_2497 340
315 3300035090 Ga0373949_0025220 Ga0373949_0025220_47_1105 340
316 3300035111 Ga0373923_0024296 Ga0373923_0024296_879_1958 340
317 3300035112 Ga0373932_0006260 Ga0373932_0006260_421_1479 340
318 3300035117 Ga0373953_0005915 Ga0373953_0005915_680_1759 340
319 3300035119 Ga0373956_0003764 Ga0373956_0003764_3227_4306 340
320 3300035121 Ga0373960_0023607 Ga0373960_0023607_177_1235 340
321 3300035172 Ga0373955_0011948 Ga0373955_0011948_3066_4145 340
322 3300035241 Ga0373961_0011317 Ga0373961_0011317_908_1966 340
323 3300035242 Ga0373962_0021413 Ga0373962_0021413_425_1483 340
324 3300035691 Ga0373931_0001400 Ga0373931_0001400_1480_2538 340
325 3300035691 Ga0373931_0010994 Ga0373931_0010994_1869_2927 340
326 3300035695 Ga0373927_0001252 Ga0373927_0001252_2810_3853 340
327 3300035695 Ga0373927_0048483 Ga0373927_0048483_664_1722 340
328 3300035695 Ga0373927_0207323 Ga0373927_0207323_28_1071 340
329 3300035724 Ga0373933_0168329 Ga0373933_0168329_184_1227 340
330 3300037068 Ga0373925_0203805 Ga0373925_0203805_101_1144 340
331 3300042876 Ga0451577_0122323 Ga0451577_0122323_277_1323 340
332 3300044673 Ga0453683_0034411 Ga0453683_0034411_1325_2371 340
333 3300044712 Ga0453684_0000751 Ga0453684_0000751_106132_107178 340
334 3300044712 Ga0453684_0001738 Ga0453684_0001738_5221_6267 340
335 3300044712 Ga0453684_0015135 Ga0453684_0015135_485_1531 340
336 3300044712 Ga0453684_0030109 Ga0453684_0030109_2294_3340 340
337 3300044712 Ga0453684_0032583 Ga0453684_0032583_5109_6155 340
338 3300044712 Ga0453684_0104216 Ga0453684_0104216_858_1904 340
339 3300044712 Ga0453684_0111274 Ga0453684_0111274_1817_2863 340
340 3300045051 Ga0451576_0074388 Ga0451576_0074388_1974_3020 340
341 3300045051 Ga0451576_0217487 Ga0451576_0217487_166_1263 340
342 3300045051 Ga0451576_0559567 Ga0451576_0559567_29_1114 340
343 3300046454 Ga0495592_0008237 Ga0495592_0008237_1869_2909 340
344 3300046454 Ga0495592_0052530 Ga0495592_0052530_1732_2811 340
345 3300046455 Ga0495603_0064379 Ga0495603_0064379_779_1858 340
346 3300046462 Ga0495651_0024309 Ga0495651_0024309_219_1298 340
347 3300046472 Ga0495580_0006742 Ga0495580_0006742_6276_7319 340
348 3300046477 Ga0495664_0054388 Ga0495664_0054388_1113_2153 340
349 3300046516 Ga0495628_0001892 Ga0495628_0001892_14520_15599 340
350 3300046516 Ga0495628_0066911 Ga0495628_0066911_619_1698 340
351 3300046517 Ga0495630_0098252 Ga0495630_0098252_1035_2078 340
352 3300046529 Ga0495652_0018168 Ga0495652_0018168_2543_3583 340
353 3300046529 Ga0495652_0168088 Ga0495652_0168088_218_1297 340
354 3300046533 Ga0495640_0091990 Ga0495640_0091990_489_1529 340
355 3300046536 Ga0495587_0009725 Ga0495587_0009725_763_1842 340
356 3300046543 Ga0495645_0016758 Ga0495645_0016758_3685_4725 340
357 3300046642 Ga0495634_0028172 Ga0495634_0028172_2680_3720 340
358 3300046663 Ga0495635_0039007 Ga0495635_0039007_1125_2165 340
359 3300046675 Ga0495657_0129819 Ga0495657_0129819_45_1124 340
360 3300046678 Ga0495599_0012884 Ga0495599_0012884_3463_4542 340
361 3300046678 Ga0495599_0015228 Ga0495599_0015228_3629_4669 340
362 3300046689 Ga0495613_0096124 Ga0495613_0096124_872_1912 340
363 3300046809 Ga0495600_0012933 Ga0495600_0012933_1670_2710 340
364 3300047319 Ga0495674_0120821 Ga0495674_0120821_218_1261 340
365 3300047322 Ga0495680_0207019 Ga0495680_0207019_14_1093 340
366 3300047444 Ga0495675_0014448 Ga0495675_0014448_1223_2302 340
367 3300048908 Ga0496105_0025866 Ga0496105_0025866_2975_4036 340
368 3300048915 Ga0496112_0307291 Ga0496112_0307291_320_1381 340
369 3300049571 Ga0501034_0026577 Ga0501034_0026577_1839_2864 340
370 3300049571 Ga0501034_0092387 Ga0501034_0092387_215_1240 340
371 3300049573 Ga0501037_0005986 Ga0501037_0005986_6415_7440 340
372 3300049574 Ga0501038_0017923 Ga0501038_0017923_485_1510 340
373 3300049574 Ga0501038_0226881 Ga0501038_0226881_293_1330 340
374 3300049579 Ga0501043_0000251 Ga0501043_0000251_35498_36523 340
375 3300049581 Ga0501047_0015352 Ga0501047_0015352_4778_5803 340
376 3300049582 Ga0501048_0187846 Ga0501048_0187846_42_1100 340
377 3300049584 Ga0501068_0073359 Ga0501068_0073359_749_1807 340
378 3300049587 Ga0501071_0096343 Ga0501071_0096343_684_1742 340
379 3300049588 Ga0501072_0061542 Ga0501072_0061542_1352_2410 340
380 3300049589 Ga0501073_0140460 Ga0501073_0140460_409_1491 340
381 3300049590 Ga0501074_0014429 Ga0501074_0014429_3444_4502 340
382 3300049592 Ga0501076_0005674 Ga0501076_0005674_4487_5545 340
383 3300049593 Ga0501077_0132807 Ga0501077_0132807_257_1315 340
384 3300049741 Ga0501079_0026109 Ga0501079_0026109_1131_2189 340
385 3300049744 Ga0501083_0070443 Ga0501083_0070443_607_1665 340
386 3300050507 nmdc:mga05p37_393126_c1 nmdc:mga05p37_393126_c1_150_1208 340
387 3300050508 nmdc:mga09592_7630_c1 nmdc:mga09592_7630_c1_3037_4116 340
388 3300050508 nmdc:mga09592_85956_c1 nmdc:mga09592_85956_c1_1005_2090 340
389 3300050510 nmdc:mga06r32_59178_c1 nmdc:mga06r32_59178_c1_311_1432 340
390 3300050511 nmdc:mga08y16_165126_c1 nmdc:mga08y16_165126_c1_1027_2085 340
391 3300050511 nmdc:mga08y16_233170_c1 nmdc:mga08y16_233170_c1_680_1738 340
392 3300050511 nmdc:mga08y16_320741_c1 nmdc:mga08y16_320741_c1_325_1398 340
393 3300050511 nmdc:mga08y16_63958_c1 nmdc:mga08y16_63958_c1_1134_2213 340
394 3300050512 nmdc:mga0n895_33344_c1 nmdc:mga0n895_33344_c1_2769_3827 340
395 3300050512 nmdc:mga0n895_52332_c1 nmdc:mga0n895_52332_c1_706_1779 340
396 3300050513 nmdc:mga0rr50_20888_c1 nmdc:mga0rr50_20888_c1_132_1205 340
397 3300050513 nmdc:mga0rr50_83451_c1 nmdc:mga0rr50_83451_c1_446_1489 340
398 3300050514 nmdc:mga08x19_2619_c1 nmdc:mga08x19_2619_c1_9093_10136 340
399 3300050515 nmdc:mga0a205_157829_c1 nmdc:mga0a205_157829_c1_1032_2105 340
400 3300050515 nmdc:mga0a205_2396_c1 nmdc:mga0a205_2396_c1_4486_5544 340
401 3300053084 Ga0495595_0062646 Ga0495595_0062646_533_1612 340
402 3300053085 Ga0495619_0144757 Ga0495619_0144757_508_1566 340
403 3300054114 Ga0501084_0013388 Ga0501084_0013388_5059_6117 340
404 3300060353 Ga0501082_0061077 Ga0501082_0061077_1860_2918 340
405 3300061734 Ga0530510_0059690 Ga0530510_0059690_320_1363 340
406 3300004803 Ga0058862_12638485 Ga0058862_126384851 341
407 3300005330 Ga0070690_100000568 Ga0070690_10000056810 341
408 3300005336 Ga0070680_100391532 Ga0070680_1003915321 341
409 3300005340 Ga0070689_100015529 Ga0070689_1000155293 341
410 3300005354 Ga0070675_100008002 Ga0070675_1000080027 341
411 3300005365 Ga0070688_100060778 Ga0070688_1000607782 341
412 3300005435 Ga0070714_100000067 Ga0070714_10000006724 341
413 3300005441 Ga0070700_100124586 Ga0070700_1001245862 341
414 3300005445 Ga0070708_100305871 Ga0070708_1003058712 341
415 3300005466 Ga0070685_10100262 Ga0070685_101002622 341
416 3300005530 Ga0070679_100391351 Ga0070679_1003913512 341
417 3300005536 Ga0070697_100164959 Ga0070697_1001649591 341
418 3300005544 Ga0070686_100293290 Ga0070686_1002932901 341
419 3300005617 Ga0068859_100005280 Ga0068859_1000052808 341
420 3300006028 Ga0070717_10000496 Ga0070717_1000049612 341
421 3300006844 Ga0075428_100252700 Ga0075428_1002527002 341
422 3300006847 Ga0075431_100112447 Ga0075431_1001124473 341
423 3300006852 Ga0075433_10115500 Ga0075433_101155002 341
424 3300006852 Ga0075433_10225383 Ga0075433_102253832 341
425 3300006871 Ga0075434_100062715 Ga0075434_1000627153 341
426 3300006871 Ga0075434_100067627 Ga0075434_1000676272 341
427 3300006880 Ga0075429_100115477 Ga0075429_1001154772 341
428 3300006880 Ga0075429_100294874 Ga0075429_1002948741 341
429 3300006931 Ga0097620_100005280 Ga0097620_1000052808 341
430 3300007076 Ga0075435_100024363 Ga0075435_1000243632 341
431 3300007076 Ga0075435_100081760 Ga0075435_1000817602 341
432 3300009094 Ga0111539_10025983 Ga0111539_100259834 341
433 3300009147 Ga0114129_10109282 Ga0114129_101092822 341
434 3300009147 Ga0114129_10135417 Ga0114129_101354172 341
435 3300009553 Ga0105249_10101967 Ga0105249_101019672 341
436 3300014326 Ga0157380_10074764 Ga0157380_100747642 341
437 3300014745 Ga0157377_10060349 Ga0157377_100603492 341
438 3300025918 Ga0207662_10024958 Ga0207662_100249583 341
439 3300025926 Ga0207659_10009252 Ga0207659_100092522 341
440 3300025929 Ga0207664_10000005 Ga0207664_10000005459 341
441 3300025936 Ga0207670_10028523 Ga0207670_100285233 341
442 3300031507 Ga0307509_10105690 Ga0307509_101056902 341
443 3300035121 Ga0373960_0006259 Ga0373960_0006259_202_1269 341
444 3300035207 Ga0373942_0012349 Ga0373942_0012349_706_1773 341
445 3300035691 Ga0373931_0031116 Ga0373931_0031116_595_1662 341
446 3300035695 Ga0373927_0002585 Ga0373927_0002585_9374_10441 341
447 3300036401 Ga0373937_0094646 Ga0373937_0094646_1250_2332 341
448 3300037068 Ga0373925_0005976 Ga0373925_0005976_1963_3030 341
449 3300044673 Ga0453683_0100831 Ga0453683_0100831_258_1301 341
450 3300050507 nmdc:mga05p37_46231_c1 nmdc:mga05p37_46231_c1_1104_2153 341
451 3300050511 nmdc:mga08y16_77222_c1 nmdc:mga08y16_77222_c1_1015_2085 341
452 3300050512 nmdc:mga0n895_18264_c1 nmdc:mga0n895_18264_c1_1291_2343 341
453 3300050512 nmdc:mga0n895_363763_c1 nmdc:mga0n895_363763_c1_62_1111 341
454 3300050513 nmdc:mga0rr50_18662_c1 nmdc:mga0rr50_18662_c1_1069_2136 341
455 3300050513 nmdc:mga0rr50_60393_c1 nmdc:mga0rr50_60393_c1_485_1537 341
456 3300050515 nmdc:mga0a205_71973_c1 nmdc:mga0a205_71973_c1_494_1546 341
457 3300059477 Ga0587084_012210 Ga0587084_012210_55_1119 341
458 3300059511 Ga0587091_012107 Ga0587091_012107_165_1229 341
459 3300059658 Ga0587119_008243 Ga0587119_008243_18_1082 341
460 2162886006 SwRhRL3b_contig_1150003 SwRhRL3b_0727.00002270 342
461 3300005530 Ga0070679_100024763 Ga0070679_1000247633 342
462 3300005937 Ga0081455_10001809 Ga0081455_100018098 342
463 3300005981 Ga0081538_10004255 Ga0081538_100042558 342
464 3300006846 Ga0075430_100049789 Ga0075430_1000497892 342
465 3300006871 Ga0075434_100119338 Ga0075434_1001193382 342
466 3300006880 Ga0075429_100062201 Ga0075429_1000622013 342
467 3300013297 Ga0157378_10014094 Ga0157378_100140943 342
468 3300031548 Ga0307408_100027499 Ga0307408_1000274993 342
469 3300031731 Ga0307405_10001505 Ga0307405_100015059 342
470 3300031852 Ga0307410_10173943 Ga0307410_101739432 342
471 3300031911 Ga0307412_10047640 Ga0307412_100476402 342
472 3300031995 Ga0307409_100078815 Ga0307409_1000788152 342
473 3300032002 Ga0307416_100006882 Ga0307416_1000068826 342
474 3300032005 Ga0307411_10098149 Ga0307411_100981492 342
475 3300032126 Ga0307415_100030146 Ga0307415_1000301462 342
476 3300035691 Ga0373931_0027221 Ga0373931_0027221_174_1202 342
477 3300044673 Ga0453683_0001077 Ga0453683_0001077_13441_14469 342
478 3300045051 Ga0451576_0015626 Ga0451576_0015626_2626_3720 342
479 3300049568 Ga0501031_0033198 Ga0501031_0033198_2078_3106 342
480 3300049573 Ga0501037_0010856 Ga0501037_0010856_5598_6626 342
481 3300049574 Ga0501038_0004795 Ga0501038_0004795_1935_2963 342
482 3300049579 Ga0501043_0020374 Ga0501043_0020374_3795_4823 342
483 3300049582 Ga0501048_0020093 Ga0501048_0020093_3735_4763 342
484 3300049584 Ga0501068_0008621 Ga0501068_0008621_3822_4850 342
485 3300049585 Ga0501069_0016405 Ga0501069_0016405_2843_3871 342
486 3300049586 Ga0501070_0019047 Ga0501070_0019047_4502_5530 342
487 3300049587 Ga0501071_0006882 Ga0501071_0006882_2135_3163 342
488 3300049589 Ga0501073_0035568 Ga0501073_0035568_1763_2791 342
489 3300049590 Ga0501074_0016089 Ga0501074_0016089_4139_5167 342
490 3300049592 Ga0501076_0241273 Ga0501076_0241273_260_1288 342
491 3300049593 Ga0501077_0069471 Ga0501077_0069471_1185_2213 342
492 3300049741 Ga0501079_0016337 Ga0501079_0016337_380_1408 342
493 3300049742 Ga0501080_0114579 Ga0501080_0114579_219_1247 342
494 3300049743 Ga0501081_0035903 Ga0501081_0035903_2091_3119 342
495 3300049823 Ga0501044_0009752 Ga0501044_0009752_7587_8615 342
496 3300050510 nmdc:mga06r32_104881_c1 nmdc:mga06r32_104881_c1_752_1780 342
497 3300050512 nmdc:mga0n895_95186_c1 nmdc:mga0n895_95186_c1_1619_2647 342
498 3300050513 nmdc:mga0rr50_64572_c1 nmdc:mga0rr50_64572_c1_14_1042 342
499 3300050514 nmdc:mga08x19_44785_c1 nmdc:mga08x19_44785_c1_1168_2199 342
500 3300050515 nmdc:mga0a205_12893_c1 nmdc:mga0a205_12893_c1_5026_6057 342
501 3300061734 Ga0530510_0016460 Ga0530510_0016460_2091_3119 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

113

262

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8702 1 312
5b47-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex 0.8331 23 312
7plm-assembly1.cif.gz_B cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions 0.8254 23 208
5b48-assembly1.cif.gz_D 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.803 30 337
6ciq-assembly2.cif.gz_C pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound 0.8023 24 208
ID Description Score Start End Superfamily
af_Q57714_86_295_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9145 94 208 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8535 83 225 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8343 82 231 3.40.50.970
af_P52647_794_1167_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8254 16 208 3.40.50.970
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8254 89 228 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A833DMP4-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9803 3 119 GO:0006082
GO:0016625
GO:0030976
GO:0044272
AF-A0A7V4UN98-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9792 1 115 GO:0016625
GO:0030976
AF-A0A661EQM8-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9773 1 119 GO:0016625
GO:0030976
GO:0044281
AF-A0A0F8Y5H2-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9723 1 195 GO:0016625
GO:0030976
AF-A0A534B7V2-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9721 1 115 GO:0016625
GO:0030976
GO:0044281

Feature Viewer

pLDDT pTM Quality
82.18 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map