F455652

General Info

Members Datasets Scaffolds Average Seq Length
501 277 1002 362

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100001154|Ga0070711_10000115412
Length 423
Sequence VGCVGTEFSSHSKSFSRPRIRSFTPLKVTNLGSDRSAFARIYLLPLVSFHELYYAIQWCCMILNLAVLPGDGVGPEVTDEAIRVLEAIAGAYSHQLRVTRKPVGGAALVSNNDPLPPDTLKACLNSGAVLLGAVGGPAFDSYPSHLRPESGLLRLRKELGVFANLRPATCFSALEDCSPLRAEVVRGTDVMIVRELLGGIYFGRPRTTMGSVGNRSAVDTMAYGESEIERIAHVAFGLARPRRRKVMSVDKANVLDCSRLWRDVVTKVGHQYADVQLSHMYVDSAAMALVARPAEFDVVLTENMFGDILSDQAGAVVGSIGMLGSASIGGRVGLYEPVHGSAPDIAGRGIANPLGAILSVAMLLRYSFKLETEAGCVESAVADVLASGVRTRDLARPGQTVGSTSEMGQKVAFAVKERSSAEA

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
193 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
194 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
195 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
196 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
197 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
267 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
268 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
269 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
270 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
271 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
272 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
273 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
274 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
275 2952252522 Salinicola sp. DM10 Isolate Unclassified
276 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
277 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 1.6
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0.4
Rhizoplane 4.79
Rhizosphere 84.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100001154 3300005439 Bacteria 14203
2 Ga0006562J51391_1006234 3300003578 Bacteria 8396
3 Ga0006562J51391_1051650 3300003578 Bacteria 9240
4 Ga0006562J51391_1051655 3300003578 Bacteria 1780
5 Ga0055536_1000290 3300003781 Bacteria 37915
6 Ga0055531_10024336 3300003794 Bacteria 2238
7 Ga0065712_10006236 3300005290 Bacteria 4313
8 Ga0065712_10068218 3300005290 Bacteria 12810
9 Ga0065715_10099650 3300005293 Bacteria 3386
10 Ga0065715_10180941 3300005293 Bacteria 1458
11 Ga0070676_10036647 3300005328 Bacteria 2826
12 Ga0070683_100177914 3300005329 Bacteria 2019
13 Ga0070683_100416238 3300005329 Bacteria 1282
14 Ga0070690_100069563 3300005330 Bacteria 2285
15 Ga0070670_100003288 3300005331 Bacteria 13371
16 Ga0070666_10042294 3300005335 Bacteria 3048
17 Ga0070666_10068007 3300005335 Bacteria 2419
18 Ga0070666_10210847 3300005335 Bacteria 1368
19 Ga0070682_100017142 3300005337 Bacteria 4221
20 Ga0068868_100146140 3300005338 Bacteria 1944
21 Ga0070691_10046008 3300005341 Bacteria 2072
22 Ga0070687_100100300 3300005343 Bacteria 1620
23 Ga0070661_100004536 3300005344 Bacteria 9556
24 Ga0070692_10067409 3300005345 Bacteria 1900
25 Ga0070668_100053148 3300005347 Bacteria 3124
26 Ga0070668_100117794 3300005347 Bacteria 2119
27 Ga0070669_100314047 3300005353 Bacteria 1264
28 Ga0070671_100047956 3300005355 Bacteria 3552
29 Ga0070671_100152105 3300005355 Bacteria 1954
30 Ga0070674_100024142 3300005356 Bacteria 3943
31 Ga0070674_100138699 3300005356 Bacteria 1823
32 Ga0070659_100008392 3300005366 Bacteria 7546
33 Ga0070659_100097104 3300005366 Bacteria 2367
34 Ga0070667_100114045 3300005367 Bacteria 2346
35 Ga0070667_100305033 3300005367 Bacteria 1434
36 Ga0070709_10019721 3300005434 Bacteria 3903
37 Ga0070709_10232332 3300005434 Bacteria 1320
38 Ga0070713_100048164 3300005436 Bacteria 3507
39 Ga0070713_100089704 3300005436 Bacteria 2641
40 Ga0070710_10020949 3300005437 Bacteria 3400
41 Ga0070710_10037043 3300005437 Bacteria 2671
42 Ga0070710_10201192 3300005437 Bacteria 1258
43 Ga0070701_10137978 3300005438 Bacteria 1392
44 Ga0070711_100050026 3300005439 Bacteria 2864
45 Ga0070711_100051751 3300005439 Bacteria 2822
46 Ga0070700_100041009 3300005441 Bacteria 2836
47 Ga0070694_100004944 3300005444 Bacteria 8040
48 Ga0070694_100060729 3300005444 Bacteria 2579
49 Ga0070708_100000389 3300005445 Bacteria 33171
50 Ga0070708_100002429 3300005445 Bacteria 14446
51 Ga0070708_100019707 3300005445 Bacteria 5674
52 Ga0070708_100063756 3300005445 Bacteria 3300
53 Ga0070708_100123893 3300005445 Bacteria 2387
54 Ga0070662_100016123 3300005457 Bacteria 5012
55 Ga0070681_10063211 3300005458 Bacteria 3674
56 Ga0068867_100082482 3300005459 Bacteria 2425
57 Ga0070685_10023998 3300005466 Bacteria 3345
58 Ga0070706_100004947 3300005467 Bacteria 12758
59 Ga0070706_100014942 3300005467 Bacteria 7171
60 Ga0070706_100025373 3300005467 Bacteria 5453
61 Ga0070706_100032050 3300005467 Bacteria 4847
62 Ga0070706_100135907 3300005467 Bacteria 2295
63 Ga0070707_100003223 3300005468 Bacteria 15446
64 Ga0070707_100045176 3300005468 Bacteria 4216
65 Ga0070698_100000012 3300005471 Bacteria 116260
66 Ga0070698_100027686 3300005471 Bacteria 5892
67 Ga0070699_100000053 3300005518 Bacteria 111244
68 Ga0070699_100001752 3300005518 Bacteria 19809
69 Ga0070679_100135779 3300005530 Bacteria 2441
70 Ga0070679_100258816 3300005530 Bacteria 1695
71 Ga0070684_100114174 3300005535 Bacteria 2424
72 Ga0070697_100000098 3300005536 Bacteria 71729
73 Ga0070697_100002855 3300005536 Bacteria 13282
74 Ga0070697_100004462 3300005536 Bacteria 10759
75 Ga0070697_100006571 3300005536 Bacteria 9011
76 Ga0070697_100015123 3300005536 Bacteria 6060
77 Ga0070697_100023101 3300005536 Bacteria 4945
78 Ga0070697_100051088 3300005536 Bacteria 3358
79 Ga0070697_100070422 3300005536 Bacteria 2867
80 Ga0070697_100196218 3300005536 Bacteria 1714
81 Ga0068853_100000019 3300005539 Bacteria 163178
82 Ga0068853_100063815 3300005539 Bacteria 3191
83 Ga0068853_100144581 3300005539 Bacteria 2136
84 Ga0070686_100151313 3300005544 Bacteria 1625
85 Ga0070696_100000068 3300005546 Bacteria 50176
86 Ga0070693_100009521 3300005547 Bacteria 4832
87 Ga0070665_100010043 3300005548 Bacteria 9577
88 Ga0070704_100008102 3300005549 Bacteria 6280
89 Ga0070704_100041655 3300005549 Bacteria 3171
90 Ga0068855_100023729 3300005563 Bacteria 7347
91 Ga0068855_100037504 3300005563 Bacteria 5763
92 Ga0068855_100546408 3300005563 Bacteria 1254
93 Ga0070664_100027515 3300005564 Bacteria 4725
94 Ga0070664_100171187 3300005564 Bacteria 1926
95 Ga0068857_100109214 3300005577 Bacteria 2485
96 Ga0068857_100246765 3300005577 Bacteria 1636
97 Ga0068854_100035050 3300005578 Bacteria 3511
98 Ga0068854_100069922 3300005578 Bacteria 2564
99 Ga0068854_100099392 3300005578 Bacteria 2179
100 Ga0068854_100099942 3300005578 Bacteria 2173
101 Ga0068856_100002578 3300005614 Bacteria 18679
102 Ga0068856_100024076 3300005614 Bacteria 5924
103 Ga0068856_100084760 3300005614 Bacteria 3148
104 Ga0068856_100117942 3300005614 Bacteria 2655
105 Ga0068856_100489635 3300005614 Bacteria 1251
106 Ga0068852_100000079 3300005616 Bacteria 67303
107 Ga0068852_100162011 3300005616 Bacteria 2089
108 Ga0068852_100184677 3300005616 Bacteria 1963
109 Ga0068859_100092193 3300005617 Bacteria 3081
110 Ga0068859_100219419 3300005617 Bacteria 1989
111 Ga0068859_100469431 3300005617 Bacteria 1354
112 Ga0068866_10220731 3300005718 Bacteria 1143
113 Ga0068861_100113743 3300005719 Bacteria 2172
114 Ga0068851_10040767 3300005834 Bacteria 2334
115 Ga0068863_100124874 3300005841 Bacteria 2455
116 Ga0068863_100179586 3300005841 Bacteria 2032
117 Ga0068858_100063988 3300005842 Bacteria 3403
118 Ga0068860_100146237 3300005843 Bacteria 2274
119 Ga0070717_10002335 3300006028 Bacteria 13354
120 Ga0070717_10007013 3300006028 Bacteria 8339
121 Ga0070717_10011106 3300006028 Bacteria 6825
122 Ga0070717_10026799 3300006028 Bacteria 4602
123 Ga0070717_10036471 3300006028 Bacteria 3987
124 Ga0070717_10182528 3300006028 Bacteria 1830
125 Ga0070717_10295322 3300006028 Bacteria 1439
126 Ga0075368_10050292 3300006042 Bacteria 1655
127 Ga0070715_10012992 3300006163 Bacteria 3048
128 Ga0070716_100047109 3300006173 Bacteria 2430
129 Ga0070716_100099010 3300006173 Bacteria 1783
130 Ga0070716_100160009 3300006173 Bacteria 1458
131 Ga0070712_100001241 3300006175 Bacteria 15416
132 Ga0070712_100067892 3300006175 Bacteria 2538
133 Ga0097621_100000470 3300006237 Bacteria 28293
134 Ga0097621_100006075 3300006237 Bacteria 8544
135 Ga0097621_100013593 3300006237 Bacteria 6073
136 Ga0097621_100232351 3300006237 Bacteria 1610
137 Ga0068871_100008825 3300006358 Bacteria 7261
138 Ga0068871_100077805 3300006358 Bacteria 2742
139 Ga0068871_100205128 3300006358 Bacteria 1703
140 Ga0075430_100003332 3300006846 Bacteria 13452
141 Ga0075431_100021253 3300006847 Bacteria 6633
142 Ga0075433_10023983 3300006852 Bacteria 5143
143 Ga0075433_10056662 3300006852 Bacteria 3424
144 Ga0075433_10118704 3300006852 Bacteria 2348
145 Ga0075434_100001184 3300006871 Bacteria 21618
146 Ga0075434_100012569 3300006871 Bacteria 8028
147 Ga0075434_100111453 3300006871 Bacteria 2747
148 Ga0075434_100149888 3300006871 Bacteria 2352
149 Ga0075434_100176459 3300006871 Bacteria 2157
150 Ga0068865_100192007 3300006881 Bacteria 1580
151 Ga0075436_100009599 3300006914 Bacteria 6624
152 Ga0075436_100068906 3300006914 Bacteria 2444
153 Ga0097620_100092192 3300006931 Bacteria 3081
154 Ga0099824_1000204 3300006942 Bacteria 57939
155 Ga0079104_1002031 3300006946 Bacteria 11795
156 Ga0075435_100000341 3300007076 Bacteria 28740
157 Ga0075435_100048872 3300007076 Bacteria 3400
158 Ga0105240_10000744 3300009093 Bacteria 59430
159 Ga0105240_10017168 3300009093 Bacteria 9769
160 Ga0105240_10017380 3300009093 Bacteria 9696
161 Ga0105240_10025544 3300009093 Bacteria 7761
162 Ga0105240_10028731 3300009093 Bacteria 7254
163 Ga0105240_10044471 3300009093 Bacteria 5642
164 Ga0111539_10169175 3300009094 Bacteria 2554
165 Ga0105245_10000286 3300009098 Bacteria 48236
166 Ga0105245_10034004 3300009098 Bacteria 4518
167 Ga0105245_10117415 3300009098 Bacteria 2482
168 Ga0114129_10053184 3300009147 Bacteria 5679
169 Ga0114129_10204686 3300009147 Bacteria 2671
170 Ga0105241_10001940 3300009174 Bacteria 15654
171 Ga0105242_10028947 3300009176 Bacteria 4414
172 Ga0105242_10462647 3300009176 Bacteria 1198
173 Ga0105248_10004688 3300009177 Bacteria 15126
174 Ga0105237_10034817 3300009545 Bacteria 5096
175 Ga0105237_10226413 3300009545 Bacteria 1870
176 Ga0105237_10469509 3300009545 Bacteria 1264
177 Ga0105238_10026805 3300009551 Bacteria 5875
178 Ga0105238_10140417 3300009551 Bacteria 2393
179 Ga0105239_10101050 3300010375 Bacteria 3190
180 Ga0157373_10000002 3300013100 Bacteria 750094
181 Ga0157373_10001268 3300013100 Bacteria 19302
182 Ga0157373_10038915 3300013100 Bacteria 3406
183 Ga0157373_10220797 3300013100 Bacteria 1337
184 Ga0157371_10052775 3300013102 Bacteria 2887
185 Ga0157370_10000160 3300013104 Bacteria 82509
186 Ga0157370_10001332 3300013104 Bacteria 30666
187 Ga0157370_10061232 3300013104 Bacteria 3572
188 Ga0157370_10425795 3300013104 Bacteria 1221
189 Ga0157369_10000341 3300013105 Bacteria 61835
190 Ga0157369_10013321 3300013105 Bacteria 9299
191 Ga0157369_10084652 3300013105 Bacteria 3389
192 Ga0157369_10133493 3300013105 Bacteria 2629
193 Ga0157374_10000600 3300013296 Bacteria 31879
194 Ga0157374_10001542 3300013296 Bacteria 19428
195 Ga0157374_10007679 3300013296 Bacteria 9208
196 Ga0157374_10058567 3300013296 Bacteria 3600
197 Ga0157374_10104345 3300013296 Bacteria 2721
198 Ga0157378_10000023 3300013297 Bacteria 129977
199 Ga0157378_10004216 3300013297 Bacteria 12694
200 Ga0157378_10111475 3300013297 Bacteria 2509
201 Ga0157378_10213731 3300013297 Bacteria 1830
202 Ga0163162_10000943 3300013306 Bacteria 27022
203 Ga0163162_10080599 3300013306 Bacteria 3323
204 Ga0157372_10000627 3300013307 Bacteria 38590
205 Ga0157372_10002287 3300013307 Bacteria 20763
206 Ga0157372_10009102 3300013307 Bacteria 10548
207 Ga0157372_10009615 3300013307 Bacteria 10276
208 Ga0157372_10016406 3300013307 Bacteria 7946
209 Ga0157372_10023718 3300013307 Bacteria 6655
210 Ga0157375_10130600 3300013308 Bacteria 2631
211 Ga0163163_10026757 3300014325 Bacteria 5517
212 Ga0163163_10145271 3300014325 Bacteria 2415
213 Ga0163163_10198624 3300014325 Bacteria 2054
214 Ga0163163_10250977 3300014325 Bacteria 1820
215 Ga0157380_10088477 3300014326 Bacteria 2549
216 Ga0182008_10003300 3300014497 Bacteria 9822
217 Ga0182008_10035808 3300014497 Bacteria 2484
218 Ga0157379_10128832 3300014968 Bacteria 2277
219 Ga0157379_10193819 3300014968 Bacteria 1836
220 Ga0157376_10042027 3300014969 Bacteria 3746
221 Ga0157376_10091145 3300014969 Bacteria 2640
222 Ga0182006_1000011 3300015261 Bacteria 408647
223 Ga0182006_1005312 3300015261 Bacteria 6156
224 Ga0182007_10002095 3300015262 Bacteria 10222
225 Ga0182007_10044891 3300015262 Bacteria 1465
226 Ga0163161_10043912 3300017792 Bacteria 3218
227 Ga0228598_1005951 3300024227 Bacteria 2535
228 Ga0209676_1000182 3300025292 Bacteria 146373
229 Ga0209676_1001439 3300025292 Bacteria 22421
230 Ga0209050_1008311 3300025298 Bacteria 5580
231 Ga0209257_1000484 3300025304 Bacteria 72044
232 Ga0207656_10019300 3300025321 Bacteria 2696
233 Ga0207692_10019901 3300025898 Bacteria 3043
234 Ga0207688_10064808 3300025901 Bacteria 2064
235 Ga0207680_10045748 3300025903 Bacteria 2583
236 Ga0207647_10023534 3300025904 Bacteria 4073
237 Ga0207685_10005799 3300025905 Bacteria 3300
238 Ga0207699_10012231 3300025906 Bacteria 4361
239 Ga0207645_10024377 3300025907 Bacteria 3923
240 Ga0207684_10000745 3300025910 Bacteria 38041
241 Ga0207684_10009507 3300025910 Bacteria 8582
242 Ga0207684_10019522 3300025910 Bacteria 5797
243 Ga0207654_10005728 3300025911 Bacteria 6275
244 Ga0207707_10134141 3300025912 Bacteria 2165
245 Ga0207695_10000460 3300025913 Bacteria 88380
246 Ga0207695_10006370 3300025913 Bacteria 15353
247 Ga0207695_10019992 3300025913 Bacteria 7686
248 Ga0207695_10127553 3300025913 Bacteria 2505
249 Ga0207693_10001309 3300025915 Bacteria 22074
250 Ga0207693_10051296 3300025915 Bacteria 3238
251 Ga0207663_10008210 3300025916 Bacteria 5448
252 Ga0207663_10040795 3300025916 Bacteria 2824
253 Ga0207663_10046317 3300025916 Bacteria 2679
254 Ga0207662_10011137 3300025918 Bacteria 4977
255 Ga0207657_10003063 3300025919 Bacteria 17892
256 Ga0207657_10007409 3300025919 Bacteria 11251
257 Ga0207652_10176743 3300025921 Bacteria 1917
258 Ga0207646_10000287 3300025922 Bacteria 69461
259 Ga0207650_10151901 3300025925 Bacteria 1828
260 Ga0207687_10001100 3300025927 Bacteria 18374
261 Ga0207687_10035397 3300025927 Bacteria 3395
262 Ga0207687_10074781 3300025927 Bacteria 2429
263 Ga0207700_10042705 3300025928 Bacteria 3326
264 Ga0207664_10013835 3300025929 Bacteria 5809
265 Ga0207644_10265741 3300025931 Bacteria 1373
266 Ga0207690_10024396 3300025932 Bacteria 3788
267 Ga0207690_10069142 3300025932 Bacteria 2429
268 Ga0207706_10000880 3300025933 Bacteria 30836
269 Ga0207706_10021039 3300025933 Bacteria 5860
270 Ga0207686_10029638 3300025934 Bacteria 3231
271 Ga0207669_10062507 3300025937 Bacteria 2294
272 Ga0207669_10110548 3300025937 Bacteria 1841
273 Ga0207665_10001056 3300025939 Bacteria 18530
274 Ga0207665_10005850 3300025939 Bacteria 8182
275 Ga0207665_10184397 3300025939 Bacteria 1513
276 Ga0207711_10001004 3300025941 Bacteria 27059
277 Ga0207689_10030238 3300025942 Bacteria 4513
278 Ga0207689_10031075 3300025942 Bacteria 4448
279 Ga0207661_10023205 3300025944 Bacteria 4686
280 Ga0207661_10348820 3300025944 Bacteria 1335
281 Ga0207679_10055600 3300025945 Bacteria 2918
282 Ga0207667_10013979 3300025949 Bacteria 9167
283 Ga0207667_10019567 3300025949 Bacteria 7553
284 Ga0207712_10155913 3300025961 Bacteria 1769
285 Ga0207712_10222917 3300025961 Bacteria 1509
286 Ga0207668_10012932 3300025972 Bacteria 5126
287 Ga0207640_10033903 3300025981 Bacteria 3181
288 Ga0207640_10105278 3300025981 Bacteria 1988
289 Ga0207640_10110992 3300025981 Bacteria 1944
290 Ga0207658_10258871 3300025986 Bacteria 1482
291 Ga0207677_10036028 3300026023 Bacteria 3219
292 Ga0207639_10000032 3300026041 Bacteria 163200
293 Ga0207639_10064218 3300026041 Bacteria 2845
294 Ga0207708_10067263 3300026075 Bacteria 2741
295 Ga0207702_10016995 3300026078 Bacteria 6021
296 Ga0207702_10101204 3300026078 Bacteria 2544
297 Ga0207641_10183816 3300026088 Bacteria 1916
298 Ga0207641_10186580 3300026088 Bacteria 1903
299 Ga0207641_10234934 3300026088 Bacteria 1706
300 Ga0207648_10070224 3300026089 Bacteria 3053
301 Ga0207648_10245011 3300026089 Bacteria 1597
302 Ga0207674_10231107 3300026116 Bacteria 1797
303 Ga0207674_10246414 3300026116 Bacteria 1734
304 Ga0207675_100076264 3300026118 Bacteria 3139
305 Ga0207683_10218807 3300026121 Bacteria 1735
306 Ga0207698_10000052 3300026142 Bacteria 83049
307 Ga0207698_10240534 3300026142 Bacteria 1649
308 Ga0268266_10025376 3300028379 Bacteria 5042
309 Ga0268264_10028323 3300028381 Bacteria 4582
310 Ga0265337_1001774 3300028556 Bacteria 10400
311 Ga0265334_10000063 3300028573 Bacteria 78589
312 Ga0265338_10000671 3300028800 Bacteria 59218
313 Ga0265328_10077912 3300031239 Bacteria 1221
314 Ga0265320_10000330 3300031240 Bacteria 38737
315 Ga0307513_10067091 3300031456 Bacteria 3767
316 Ga0307408_100077476 3300031548 Bacteria 2475
317 Ga0316579_10000930 3300031691 Bacteria 10174
318 Ga0316579_10033775 3300031691 Bacteria 2351
319 Ga0316579_10149147 3300031691 Bacteria 1128
320 Ga0265314_10029657 3300031711 Bacteria 4062
321 Ga0316576_10008889 3300031727 Bacteria 6448
322 Ga0316576_10050402 3300031727 Bacteria 3028
323 Ga0316578_10007081 3300031728 Bacteria 5591
324 Ga0316578_10134483 3300031728 Bacteria 1488
325 Ga0316578_10136673 3300031728 Bacteria 1476
326 Ga0307406_10002892 3300031901 Bacteria 9355
327 Ga0307407_10078928 3300031903 Bacteria 1985
328 Ga0307412_10000012 3300031911 Bacteria 404180
329 Ga0307412_10035444 3300031911 Bacteria 3189
330 Ga0307409_100089761 3300031995 Bacteria 2513
331 Ga0307416_100000010 3300032002 Bacteria 320243
332 Ga0307414_10083227 3300032004 Bacteria 2349
333 Ga0307415_100235236 3300032126 Bacteria 1478
334 Ga0316585_10000027 3300032137 Bacteria 21775
335 Ga0316593_10000333 3300032168 Bacteria 8145
336 Ga0316593_10003443 3300032168 Bacteria 3926
337 Ga0316593_10006538 3300032168 Bacteria 3152
338 Ga0316588_1016984 3300033528 Bacteria 1618
339 Ga0316596_1003567 3300033541 Bacteria 3425
340 Ga0373936_0012766 3300035113 Bacteria 3201
341 Ga0373936_0020478 3300035113 Bacteria 2570
342 Ga0373936_0030249 3300035113 Bacteria 2135
343 Ga0373945_0087494 3300035116 Bacteria 1202
344 Ga0373960_0046421 3300035121 Bacteria 1275
345 Ga0316574_0020062 3300035398 Bacteria 3952
346 Ga0316574_0022443 3300035398 Bacteria 3756
347 Ga0316574_0035544 3300035398 Bacteria 3046
348 Ga0316574_0045841 3300035398 Bacteria 2709
349 Ga0373931_0012247 3300035691 Bacteria 4154
350 Ga0373931_0038377 3300035691 Bacteria 2505
351 Ga0373931_0041037 3300035691 Bacteria 2430
352 Ga0373931_0061058 3300035691 Bacteria 2031
353 Ga0373935_0057426 3300035692 Bacteria 2483
354 Ga0373927_0029309 3300035695 Bacteria 3586
355 Ga0373927_0056995 3300035695 Bacteria 2527
356 Ga0373947_0010355 3300035725 Bacteria 5350
357 Ga0373937_0258851 3300036401 Bacteria 1641
358 Ga0316582_0009663 3300036647 Bacteria 5243
359 Ga0316584_0008914 3300036712 Bacteria 6938
360 Ga0316584_0111127 3300036712 Bacteria 2051
361 Ga0316584_0143558 3300036712 Bacteria 1779
362 Ga0316584_0165884 3300036712 Bacteria 1640
363 Ga0373925_0010121 3300037068 Bacteria 6846
364 Ga0373925_0027221 3300037068 Bacteria 4187
365 Ga0373925_0042109 3300037068 Bacteria 3387
366 Ga0373925_0059421 3300037068 Bacteria 2868
367 Ga0373925_0237758 3300037068 Bacteria 1458
368 Ga0316581_0001116 3300037588 Bacteria 5840
369 Ga0400490_12170 3300038726 Bacteria 70825
370 Ga0400485_17594 3300038735 Bacteria 16483
371 Ga0400486_10303 3300038742 Bacteria 6153
372 Ga0400486_24397 3300038742 Bacteria 28696
373 Ga0400483_136211 3300039062 Bacteria 16457
374 Ga0400487_30382 3300039110 Bacteria 3712
375 Ga0400487_57978 3300039110 Bacteria 9122
376 Ga0436363_1300589 3300039450 Bacteria 1522
377 Ga0436363_1639812 3300039450 Bacteria 2779
378 Ga0436362_0963797 3300039453 Bacteria 7154
379 Ga0451793_0140456 3300041452 Bacteria 1372
380 Ga0451807_2311533 3300041486 Bacteria 2600
381 Ga0451577_0000074 3300042876 Bacteria 232698
382 Ga0451577_0262439 3300042876 Bacteria 1564
383 Ga0453684_0000181 3300044712 Bacteria 279183
384 Ga0453684_0000482 3300044712 Bacteria 158296
385 Ga0453684_0009911 3300044712 Bacteria 16444
386 Ga0453684_0010001 3300044712 Bacteria 16344
387 Ga0453684_0091019 3300044712 Bacteria 3767
388 Ga0453684_0554690 3300044712 Bacteria 1265
389 Ga0495580_0004500 3300046472 Bacteria 11707
390 Ga0495580_0016785 3300046472 Bacteria 5493
391 Ga0495580_0035378 3300046472 Bacteria 3592
392 Ga0495580_0036421 3300046472 Bacteria 3532
393 Ga0495582_0002697 3300046473 Bacteria 9908
394 Ga0495639_0012726 3300046475 Bacteria 3630
395 Ga0495620_0014299 3300046515 Bacteria 4036
396 Ga0495630_0140722 3300046517 Bacteria 1835
397 Ga0495666_0015020 3300046526 Bacteria 3854
398 Ga0495665_0001991 3300046531 Bacteria 11043
399 Ga0495665_0063330 3300046531 Bacteria 1952
400 Ga0495649_0001552 3300046694 Bacteria 17232
401 Ga0495649_0007229 3300046694 Bacteria 6802
402 Ga0495581_0034552 3300047315 Bacteria 2925
403 Ga0495683_0000129 3300047323 Bacteria 75590
404 Ga0496100_0036788 3300048903 Bacteria 3091
405 Ga0496100_0125011 3300048903 Bacteria 1804
406 Ga0496101_0028373 3300048904 Bacteria 3906
407 Ga0496102_0000204 3300048905 Bacteria 79793
408 Ga0496102_0438703 3300048905 Bacteria 1225
409 Ga0496103_0005108 3300048906 Bacteria 7905
410 Ga0496103_0032107 3300048906 Bacteria 3203
411 Ga0496103_0194858 3300048906 Bacteria 1303
412 Ga0496104_0018986 3300048907 Bacteria 6282
413 Ga0496104_0181383 3300048907 Bacteria 2016
414 Ga0496104_0196885 3300048907 Bacteria 1927
415 Ga0496105_0087621 3300048908 Bacteria 2572
416 Ga0496106_0524063 3300048909 Bacteria 952
417 Ga0496108_0133440 3300048911 Bacteria 2134
418 Ga0496108_0324047 3300048911 Bacteria 1343
419 Ga0496109_0056171 3300048912 Bacteria 3592
420 Ga0496110_0016378 3300048913 Bacteria 6189
421 Ga0496112_0016112 3300048915 Bacteria 6990
422 Ga0496112_0053070 3300048915 Bacteria 3980
423 Ga0496112_0247777 3300048915 Bacteria 1733
424 Ga0496113_0089135 3300048916 Bacteria 2374
425 Ga0496114_0192653 3300048917 Bacteria 1784
426 Ga0496116_0001138 3300048919 Bacteria 31624
427 Ga0496116_0003599 3300048919 Bacteria 15237
428 Ga0496116_0036101 3300048919 Bacteria 3464
429 Ga0496116_0036407 3300048919 Bacteria 3444
430 Ga0496117_0000124 3300048920 Bacteria 169701
431 Ga0496118_0058941 3300048921 Bacteria 2864
432 Ga0496119_0000020 3300048922 Bacteria 285602
433 Ga0496119_0181205 3300048922 Bacteria 1104
434 Ga0496120_0000006 3300048923 Bacteria 445068
435 Ga0496120_0000609 3300048923 Bacteria 54335
436 Ga0496120_0001820 3300048923 Bacteria 23826
437 Ga0496122_0000040 3300048925 Bacteria 285095
438 Ga0496122_0000143 3300048925 Bacteria 168086
439 Ga0496122_0006649 3300048925 Bacteria 13180
440 Ga0496122_0012231 3300048925 Bacteria 8581
441 Ga0496123_0001905 3300048926 Bacteria 27213
442 Ga0496123_0006271 3300048926 Bacteria 11581
443 Ga0496123_0007615 3300048926 Bacteria 10138
444 Ga0496123_0012025 3300048926 Bacteria 7423
445 Ga0496124_0176650 3300048927 Bacteria 1648
446 Ga0496125_0000010 3300048928 Bacteria 671167
447 Ga0496125_0010223 3300048928 Bacteria 9512
448 Ga0496126_0000210 3300048929 Bacteria 131214
449 Ga0496126_0001392 3300048929 Bacteria 38279
450 Ga0501037_0003701 3300049573 Bacteria 11101
451 Ga0501037_0019597 3300049573 Bacteria 4991
452 Ga0501038_0017514 3300049574 Bacteria 6475
453 Ga0501039_0028345 3300049575 Bacteria 4310
454 Ga0501042_0321279 3300049578 Bacteria 1118
455 Ga0501046_0013270 3300049580 Bacteria 6981
456 Ga0501047_0295792 3300049581 Bacteria 1462
457 Ga0501069_0012554 3300049585 Bacteria 4505
458 Ga0501070_0025302 3300049586 Bacteria 4977
459 Ga0501070_0080982 3300049586 Bacteria 2686
460 Ga0501070_0117455 3300049586 Bacteria 2197
461 Ga0501071_0009916 3300049587 Bacteria 6361
462 Ga0501073_0226074 3300049589 Bacteria 1293
463 Ga0501074_0000176 3300049590 Bacteria 34551
464 Ga0501074_0219120 3300049590 Bacteria 1355
465 Ga0501075_0104811 3300049591 Bacteria 2149
466 Ga0501080_0008260 3300049742 Bacteria 9429
467 Ga0501083_0068652 3300049744 Bacteria 2359
468 Ga0501035_0171033 3300049822 Bacteria 1877
469 Ga0501044_0045171 3300049823 Bacteria 4567
470 nmdc:mga04h51_31881_c1 3300050495 Bacteria 1668
471 nmdc:mga05p37_131789_c2 3300050507 Bacteria 2435
472 nmdc:mga05p37_60_c1 3300050507 Bacteria 95299
473 nmdc:mga08y16_435706_c1 3300050511 Bacteria 1338
474 nmdc:mga0n895_124839_c1 3300050512 Bacteria 2597
475 nmdc:mga0n895_149096_c1 3300050512 Bacteria 2368
476 nmdc:mga0n895_3907_c1 3300050512 Bacteria 12111
477 nmdc:mga0rr50_44016_c1 3300050513 Bacteria 3271
478 nmdc:mga0rr50_6286_c1 3300050513 Bacteria 7210
479 nmdc:mga08x19_1538_c1 3300050514 Bacteria 14312
480 nmdc:mga08x19_577_c2 3300050514 Bacteria 16157
481 nmdc:mga0a205_287_c1 3300050515 Bacteria 21777
482 nmdc:mga0a205_470097_c1 3300050515 Bacteria 1116
483 nmdc:mga0a205_7391_c1 3300050515 Bacteria 9948
484 Ga0495619_0270347 3300053085 Bacteria 1178
485 Ga0500644_0001774 3300053088 Bacteria 5585
486 Ga0500651_0103936 3300053093 Bacteria 1739
487 Ga0500616_0002912 3300053153 Bacteria 13680
488 Ga0501084_0063250 3300054114 Bacteria 3098
489 Ga0501082_0100322 3300060353 Bacteria 2504
490 2644353871 2643221663 Bacteria 3425771
491 2729198606 2728369107 Bacteria 5082720
492 2748018566 2747842501 Bacteria 5293829
493 2852674587 2852673933 Bacteria 3347676
494 2883577723 2883577096 Bacteria 4709178
495 2894774933 2894772417 Bacteria 5305674
496 2928511233 2928510474 Bacteria 4815308
497 2928973757 2928972540 Bacteria 3058286
498 2941489453 2941485952 Bacteria 3591484
499 2952253284 2952252522 Bacteria 4171745
500 2977241281 2977240413 Bacteria 3191065
501 8011355386 8011350971 Bacteria 6158957
502 Ga0070711_100001154
503 Ga0006562J51391_1006234
504 Ga0006562J51391_1051650
505 Ga0006562J51391_1051655
506 Ga0055536_1000290
507 Ga0055531_10024336
508 Ga0065712_10006236
509 Ga0065712_10068218
510 Ga0065715_10099650
511 Ga0065715_10180941
512 Ga0070676_10036647
513 Ga0070683_100177914
514 Ga0070683_100416238
515 Ga0070690_100069563
516 Ga0070670_100003288
517 Ga0070666_10042294
518 Ga0070666_10068007
519 Ga0070666_10210847
520 Ga0070682_100017142
521 Ga0068868_100146140
522 Ga0070691_10046008
523 Ga0070687_100100300
524 Ga0070661_100004536
525 Ga0070692_10067409
526 Ga0070668_100053148
527 Ga0070668_100117794
528 Ga0070669_100314047
529 Ga0070671_100047956
530 Ga0070671_100152105
531 Ga0070674_100024142
532 Ga0070674_100138699
533 Ga0070659_100008392
534 Ga0070659_100097104
535 Ga0070667_100114045
536 Ga0070667_100305033
537 Ga0070709_10019721
538 Ga0070709_10232332
539 Ga0070713_100048164
540 Ga0070713_100089704
541 Ga0070710_10020949
542 Ga0070710_10037043
543 Ga0070710_10201192
544 Ga0070701_10137978
545 Ga0070711_100050026
546 Ga0070711_100051751
547 Ga0070700_100041009
548 Ga0070694_100004944
549 Ga0070694_100060729
550 Ga0070708_100000389
551 Ga0070708_100002429
552 Ga0070708_100019707
553 Ga0070708_100063756
554 Ga0070708_100123893
555 Ga0070662_100016123
556 Ga0070681_10063211
557 Ga0068867_100082482
558 Ga0070685_10023998
559 Ga0070706_100004947
560 Ga0070706_100014942
561 Ga0070706_100025373
562 Ga0070706_100032050
563 Ga0070706_100135907
564 Ga0070707_100003223
565 Ga0070707_100045176
566 Ga0070698_100000012
567 Ga0070698_100027686
568 Ga0070699_100000053
569 Ga0070699_100001752
570 Ga0070679_100135779
571 Ga0070679_100258816
572 Ga0070684_100114174
573 Ga0070697_100000098
574 Ga0070697_100002855
575 Ga0070697_100004462
576 Ga0070697_100006571
577 Ga0070697_100015123
578 Ga0070697_100023101
579 Ga0070697_100051088
580 Ga0070697_100070422
581 Ga0070697_100196218
582 Ga0068853_100000019
583 Ga0068853_100063815
584 Ga0068853_100144581
585 Ga0070686_100151313
586 Ga0070696_100000068
587 Ga0070693_100009521
588 Ga0070665_100010043
589 Ga0070704_100008102
590 Ga0070704_100041655
591 Ga0068855_100023729
592 Ga0068855_100037504
593 Ga0068855_100546408
594 Ga0070664_100027515
595 Ga0070664_100171187
596 Ga0068857_100109214
597 Ga0068857_100246765
598 Ga0068854_100035050
599 Ga0068854_100069922
600 Ga0068854_100099392
601 Ga0068854_100099942
602 Ga0068856_100002578
603 Ga0068856_100024076
604 Ga0068856_100084760
605 Ga0068856_100117942
606 Ga0068856_100489635
607 Ga0068852_100000079
608 Ga0068852_100162011
609 Ga0068852_100184677
610 Ga0068859_100092193
611 Ga0068859_100219419
612 Ga0068859_100469431
613 Ga0068866_10220731
614 Ga0068861_100113743
615 Ga0068851_10040767
616 Ga0068863_100124874
617 Ga0068863_100179586
618 Ga0068858_100063988
619 Ga0068860_100146237
620 Ga0070717_10002335
621 Ga0070717_10007013
622 Ga0070717_10011106
623 Ga0070717_10026799
624 Ga0070717_10036471
625 Ga0070717_10182528
626 Ga0070717_10295322
627 Ga0075368_10050292
628 Ga0070715_10012992
629 Ga0070716_100047109
630 Ga0070716_100099010
631 Ga0070716_100160009
632 Ga0070712_100001241
633 Ga0070712_100067892
634 Ga0097621_100000470
635 Ga0097621_100006075
636 Ga0097621_100013593
637 Ga0097621_100232351
638 Ga0068871_100008825
639 Ga0068871_100077805
640 Ga0068871_100205128
641 Ga0075430_100003332
642 Ga0075431_100021253
643 Ga0075433_10023983
644 Ga0075433_10056662
645 Ga0075433_10118704
646 Ga0075434_100001184
647 Ga0075434_100012569
648 Ga0075434_100111453
649 Ga0075434_100149888
650 Ga0075434_100176459
651 Ga0068865_100192007
652 Ga0075436_100009599
653 Ga0075436_100068906
654 Ga0097620_100092192
655 Ga0099824_1000204
656 Ga0079104_1002031
657 Ga0075435_100000341
658 Ga0075435_100048872
659 Ga0105240_10000744
660 Ga0105240_10017168
661 Ga0105240_10017380
662 Ga0105240_10025544
663 Ga0105240_10028731
664 Ga0105240_10044471
665 Ga0111539_10169175
666 Ga0105245_10000286
667 Ga0105245_10034004
668 Ga0105245_10117415
669 Ga0114129_10053184
670 Ga0114129_10204686
671 Ga0105241_10001940
672 Ga0105242_10028947
673 Ga0105242_10462647
674 Ga0105248_10004688
675 Ga0105237_10034817
676 Ga0105237_10226413
677 Ga0105237_10469509
678 Ga0105238_10026805
679 Ga0105238_10140417
680 Ga0105239_10101050
681 Ga0157373_10000002
682 Ga0157373_10001268
683 Ga0157373_10038915
684 Ga0157373_10220797
685 Ga0157371_10052775
686 Ga0157370_10000160
687 Ga0157370_10001332
688 Ga0157370_10061232
689 Ga0157370_10425795
690 Ga0157369_10000341
691 Ga0157369_10013321
692 Ga0157369_10084652
693 Ga0157369_10133493
694 Ga0157374_10000600
695 Ga0157374_10001542
696 Ga0157374_10007679
697 Ga0157374_10058567
698 Ga0157374_10104345
699 Ga0157378_10000023
700 Ga0157378_10004216
701 Ga0157378_10111475
702 Ga0157378_10213731
703 Ga0163162_10000943
704 Ga0163162_10080599
705 Ga0157372_10000627
706 Ga0157372_10002287
707 Ga0157372_10009102
708 Ga0157372_10009615
709 Ga0157372_10016406
710 Ga0157372_10023718
711 Ga0157375_10130600
712 Ga0163163_10026757
713 Ga0163163_10145271
714 Ga0163163_10198624
715 Ga0163163_10250977
716 Ga0157380_10088477
717 Ga0182008_10003300
718 Ga0182008_10035808
719 Ga0157379_10128832
720 Ga0157379_10193819
721 Ga0157376_10042027
722 Ga0157376_10091145
723 Ga0182006_1000011
724 Ga0182006_1005312
725 Ga0182007_10002095
726 Ga0182007_10044891
727 Ga0163161_10043912
728 Ga0228598_1005951
729 Ga0209676_1000182
730 Ga0209676_1001439
731 Ga0209050_1008311
732 Ga0209257_1000484
733 Ga0207656_10019300
734 Ga0207692_10019901
735 Ga0207688_10064808
736 Ga0207680_10045748
737 Ga0207647_10023534
738 Ga0207685_10005799
739 Ga0207699_10012231
740 Ga0207645_10024377
741 Ga0207684_10000745
742 Ga0207684_10009507
743 Ga0207684_10019522
744 Ga0207654_10005728
745 Ga0207707_10134141
746 Ga0207695_10000460
747 Ga0207695_10006370
748 Ga0207695_10019992
749 Ga0207695_10127553
750 Ga0207693_10001309
751 Ga0207693_10051296
752 Ga0207663_10008210
753 Ga0207663_10040795
754 Ga0207663_10046317
755 Ga0207662_10011137
756 Ga0207657_10003063
757 Ga0207657_10007409
758 Ga0207652_10176743
759 Ga0207646_10000287
760 Ga0207650_10151901
761 Ga0207687_10001100
762 Ga0207687_10035397
763 Ga0207687_10074781
764 Ga0207700_10042705
765 Ga0207664_10013835
766 Ga0207644_10265741
767 Ga0207690_10024396
768 Ga0207690_10069142
769 Ga0207706_10000880
770 Ga0207706_10021039
771 Ga0207686_10029638
772 Ga0207669_10062507
773 Ga0207669_10110548
774 Ga0207665_10001056
775 Ga0207665_10005850
776 Ga0207665_10184397
777 Ga0207711_10001004
778 Ga0207689_10030238
779 Ga0207689_10031075
780 Ga0207661_10023205
781 Ga0207661_10348820
782 Ga0207679_10055600
783 Ga0207667_10013979
784 Ga0207667_10019567
785 Ga0207712_10155913
786 Ga0207712_10222917
787 Ga0207668_10012932
788 Ga0207640_10033903
789 Ga0207640_10105278
790 Ga0207640_10110992
791 Ga0207658_10258871
792 Ga0207677_10036028
793 Ga0207639_10000032
794 Ga0207639_10064218
795 Ga0207708_10067263
796 Ga0207702_10016995
797 Ga0207702_10101204
798 Ga0207641_10183816
799 Ga0207641_10186580
800 Ga0207641_10234934
801 Ga0207648_10070224
802 Ga0207648_10245011
803 Ga0207674_10231107
804 Ga0207674_10246414
805 Ga0207675_100076264
806 Ga0207683_10218807
807 Ga0207698_10000052
808 Ga0207698_10240534
809 Ga0268266_10025376
810 Ga0268264_10028323
811 Ga0265337_1001774
812 Ga0265334_10000063
813 Ga0265338_10000671
814 Ga0265328_10077912
815 Ga0265320_10000330
816 Ga0307513_10067091
817 Ga0307408_100077476
818 Ga0316579_10000930
819 Ga0316579_10033775
820 Ga0316579_10149147
821 Ga0265314_10029657
822 Ga0316576_10008889
823 Ga0316576_10050402
824 Ga0316578_10007081
825 Ga0316578_10134483
826 Ga0316578_10136673
827 Ga0307406_10002892
828 Ga0307407_10078928
829 Ga0307412_10000012
830 Ga0307412_10035444
831 Ga0307409_100089761
832 Ga0307416_100000010
833 Ga0307414_10083227
834 Ga0307415_100235236
835 Ga0316585_10000027
836 Ga0316593_10000333
837 Ga0316593_10003443
838 Ga0316593_10006538
839 Ga0316588_1016984
840 Ga0316596_1003567
841 Ga0373936_0012766
842 Ga0373936_0020478
843 Ga0373936_0030249
844 Ga0373945_0087494
845 Ga0373960_0046421
846 Ga0316574_0020062
847 Ga0316574_0022443
848 Ga0316574_0035544
849 Ga0316574_0045841
850 Ga0373931_0012247
851 Ga0373931_0038377
852 Ga0373931_0041037
853 Ga0373931_0061058
854 Ga0373935_0057426
855 Ga0373927_0029309
856 Ga0373927_0056995
857 Ga0373947_0010355
858 Ga0373937_0258851
859 Ga0316582_0009663
860 Ga0316584_0008914
861 Ga0316584_0111127
862 Ga0316584_0143558
863 Ga0316584_0165884
864 Ga0373925_0010121
865 Ga0373925_0027221
866 Ga0373925_0042109
867 Ga0373925_0059421
868 Ga0373925_0237758
869 Ga0316581_0001116
870 Ga0400490_12170
871 Ga0400485_17594
872 Ga0400486_10303
873 Ga0400486_24397
874 Ga0400483_136211
875 Ga0400487_30382
876 Ga0400487_57978
877 Ga0436363_1300589
878 Ga0436363_1639812
879 Ga0436362_0963797
880 Ga0451793_0140456
881 Ga0451807_2311533
882 Ga0451577_0000074
883 Ga0451577_0262439
884 Ga0453684_0000181
885 Ga0453684_0000482
886 Ga0453684_0009911
887 Ga0453684_0010001
888 Ga0453684_0091019
889 Ga0453684_0554690
890 Ga0495580_0004500
891 Ga0495580_0016785
892 Ga0495580_0035378
893 Ga0495580_0036421
894 Ga0495582_0002697
895 Ga0495639_0012726
896 Ga0495620_0014299
897 Ga0495630_0140722
898 Ga0495666_0015020
899 Ga0495665_0001991
900 Ga0495665_0063330
901 Ga0495649_0001552
902 Ga0495649_0007229
903 Ga0495581_0034552
904 Ga0495683_0000129
905 Ga0496100_0036788
906 Ga0496100_0125011
907 Ga0496101_0028373
908 Ga0496102_0000204
909 Ga0496102_0438703
910 Ga0496103_0005108
911 Ga0496103_0032107
912 Ga0496103_0194858
913 Ga0496104_0018986
914 Ga0496104_0181383
915 Ga0496104_0196885
916 Ga0496105_0087621
917 Ga0496106_0524063
918 Ga0496108_0133440
919 Ga0496108_0324047
920 Ga0496109_0056171
921 Ga0496110_0016378
922 Ga0496112_0016112
923 Ga0496112_0053070
924 Ga0496112_0247777
925 Ga0496113_0089135
926 Ga0496114_0192653
927 Ga0496116_0001138
928 Ga0496116_0003599
929 Ga0496116_0036101
930 Ga0496116_0036407
931 Ga0496117_0000124
932 Ga0496118_0058941
933 Ga0496119_0000020
934 Ga0496119_0181205
935 Ga0496120_0000006
936 Ga0496120_0000609
937 Ga0496120_0001820
938 Ga0496122_0000040
939 Ga0496122_0000143
940 Ga0496122_0006649
941 Ga0496122_0012231
942 Ga0496123_0001905
943 Ga0496123_0006271
944 Ga0496123_0007615
945 Ga0496123_0012025
946 Ga0496124_0176650
947 Ga0496125_0000010
948 Ga0496125_0010223
949 Ga0496126_0000210
950 Ga0496126_0001392
951 Ga0501037_0003701
952 Ga0501037_0019597
953 Ga0501038_0017514
954 Ga0501039_0028345
955 Ga0501042_0321279
956 Ga0501046_0013270
957 Ga0501047_0295792
958 Ga0501069_0012554
959 Ga0501070_0025302
960 Ga0501070_0080982
961 Ga0501070_0117455
962 Ga0501071_0009916
963 Ga0501073_0226074
964 Ga0501074_0000176
965 Ga0501074_0219120
966 Ga0501075_0104811
967 Ga0501080_0008260
968 Ga0501083_0068652
969 Ga0501035_0171033
970 Ga0501044_0045171
971 nmdc:mga04h51_31881_c1
972 nmdc:mga05p37_131789_c2
973 nmdc:mga05p37_60_c1
974 nmdc:mga08y16_435706_c1
975 nmdc:mga0n895_124839_c1
976 nmdc:mga0n895_149096_c1
977 nmdc:mga0n895_3907_c1
978 nmdc:mga0rr50_44016_c1
979 nmdc:mga0rr50_6286_c1
980 nmdc:mga08x19_1538_c1
981 nmdc:mga08x19_577_c2
982 nmdc:mga0a205_287_c1
983 nmdc:mga0a205_470097_c1
984 nmdc:mga0a205_7391_c1
985 Ga0495619_0270347
986 Ga0500644_0001774
987 Ga0500651_0103936
988 Ga0500616_0002912
989 Ga0501084_0063250
990 Ga0501082_0100322
991 2644353871
992 2729198606
993 2748018566
994 2852674587
995 2883577723
996 2894774933
997 2928511233
998 2928973757
999 2941489453
1000 2952253284
1001 2977241281
1002 8011355386

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

64

411

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a05-assembly1.cif.gz_B crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate 0.9626 3 350
4wuo-assembly1.cif.gz_B structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh 0.9603 3 350
4wuo-assembly1.cif.gz_B structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh 0.9549 3 350
6xxy-assembly1.cif.gz_B crystal structure of haemophilus influenzae 3-isopropylmalate dehydrogenase in complex with o-isobutenyl oxalylhydroxamate. 0.9538 2 349
3wzy-assembly1.cif.gz_A-2 s266a mutant 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at 580mpa - complex with ipm and mg 0.9487 1 352
ID Description Score Start End Superfamily
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9433 4 353 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9367 3 360 3.40.718.10
2d1cA01 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9314 4 350 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9283 3 360 3.40.718.10
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9227 4 353 3.40.718.10
ID Description Score Start End GO Terms
AF-X1TLG0-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.995 1 75 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A5N9E846-F1-model_v4 Isopropylmalate dehydrogenase-like domain-containing protein 0.9934 2 79 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A4Q3AWV8-F1-model_v4 deleted 0.9921 1 313
AF-A0A090VQY6-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) 0.9917 1 298 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-A0A3D5S8N2-F1-model_v4 3-isopropylmalate dehydrogenase 0.9917 2 228 GO:0003862
GO:0005829
GO:0009098
GO:0046872

Map