F455697

General Info

Members Datasets Scaffolds Average Seq Length
501 291 1002 97

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10014923|Ga0213875_100149231
Length 115
Sequence MSSANKSALAARRRAAKLSREAMYAIVRNPVITEKATTVGERNQMVFRVALDATKPEIKAAIEGLFSVKVTAVNTLIVKGKTKRFRGRPGRRSDVKKAYVELAQGQSIDLSTGLA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
161 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
164 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
169 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
260 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
263 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
266 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
267 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
282 2643221580 Devosia sp. Root635 Isolate Unclassified
283 2643221591 Devosia sp. Root685 Isolate Unclassified
284 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
285 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
286 2643221629 Devosia sp. Root105 Isolate Unclassified
287 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
288 2643221662 Devosia sp. Root413D1 Isolate Unclassified
289 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
290 2643221674 Devosia sp. Root436 Isolate Unclassified
291 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.63
Metatranscriptomes 11.18
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 2.79
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10014923 3300021388 Bacteria 3784
2 JGI25153J46596_10000830 3300003215 Bacteria 18874
3 Ga0006777J48905_1081902 3300003308 Bacteria 545
4 Ga0006780_1044058 3300003735 Bacteria 552
5 Ga0058862_12808773 3300004803 Bacteria 3691
6 Ga0070658_10094080 3300005327 Bacteria 2472
7 Ga0070683_101664720 3300005329 Bacteria 613
8 Ga0070680_100020347 3300005336 Bacteria 5268
9 Ga0070682_100792633 3300005337 Bacteria 769
10 Ga0068868_101901312 3300005338 Bacteria 564
11 Ga0070660_100001324 3300005339 Bacteria 16829
12 Ga0070689_101375863 3300005340 Bacteria 637
13 Ga0070691_10000386 3300005341 Bacteria 16019
14 Ga0070691_10000795 3300005341 Bacteria 12588
15 Ga0070661_100005946 3300005344 Bacteria 8403
16 Ga0070661_100584297 3300005344 Bacteria 902
17 Ga0070668_100050837 3300005347 Bacteria 3192
18 Ga0070659_100410917 3300005366 Bacteria 1144
19 Ga0070667_100853948 3300005367 Bacteria 846
20 Ga0070709_10003511 3300005434 Bacteria 8423
21 Ga0070714_100011419 3300005435 Bacteria 7044
22 Ga0070714_100990624 3300005435 Bacteria 818
23 Ga0070713_100000012 3300005436 Bacteria 137708
24 Ga0070713_100508190 3300005436 Bacteria 1138
25 Ga0070710_10947475 3300005437 Bacteria 624
26 Ga0070710_11314108 3300005437 Unclassified 538
27 Ga0070705_100068685 3300005440 Bacteria 2133
28 Ga0070708_101305242 3300005445 Bacteria 678
29 Ga0070681_10029349 3300005458 Bacteria 5523
30 Ga0070681_10221516 3300005458 Bacteria 1807
31 Ga0070699_100225191 3300005518 Bacteria 1672
32 Ga0070679_100057285 3300005530 Bacteria 3884
33 Ga0070679_101580192 3300005530 Bacteria 603
34 Ga0070684_101325896 3300005535 Bacteria 677
35 Ga0068853_100002660 3300005539 Bacteria 13466
36 Ga0070695_100003098 3300005545 Bacteria 9679
37 Ga0070693_100051681 3300005547 Bacteria 2354
38 Ga0070693_100054219 3300005547 Bacteria 2305
39 Ga0070693_100203035 3300005547 Bacteria 1289
40 Ga0070693_100745378 3300005547 Bacteria 721
41 Ga0068855_100012001 3300005563 Bacteria 10474
42 Ga0068855_100057023 3300005563 Bacteria 4580
43 Ga0070664_100858079 3300005564 Bacteria 850
44 Ga0070664_102154978 3300005564 Bacteria 529
45 Ga0068857_100007896 3300005577 Bacteria 9178
46 Ga0068854_100837950 3300005578 Bacteria 804
47 Ga0068856_100001032 3300005614 Bacteria 29659
48 Ga0068856_100034393 3300005614 Bacteria 4964
49 Ga0068856_100158389 3300005614 Bacteria 2274
50 Ga0068856_100221172 3300005614 Bacteria 1909
51 Ga0068856_100551362 3300005614 Bacteria 1174
52 Ga0068856_101043910 3300005614 Bacteria 835
53 Ga0068856_101577817 3300005614 Bacteria 670
54 Ga0068852_100006800 3300005616 Bacteria 8301
55 Ga0068864_101027904 3300005618 Bacteria 818
56 Ga0068858_100274655 3300005842 Bacteria 1604
57 Ga0068858_100342360 3300005842 Bacteria 1431
58 Ga0068862_101884812 3300005844 Bacteria 608
59 Ga0075363_100224636 3300006048 Bacteria 1077
60 Ga0075364_10475916 3300006051 Bacteria 854
61 Ga0075364_11177196 3300006051 Bacteria 520
62 Ga0070716_100046578 3300006173 Bacteria 2441
63 Ga0070716_100738028 3300006173 Bacteria 756
64 Ga0070712_100000902 3300006175 Bacteria 17764
65 Ga0070712_100576142 3300006175 Bacteria 950
66 Ga0075367_10068874 3300006178 Bacteria 2123
67 Ga0075369_10091481 3300006186 Bacteria 1358
68 Ga0075366_10096605 3300006195 Bacteria 1771
69 Ga0097621_100069869 3300006237 Bacteria 2900
70 Ga0075370_10094675 3300006353 Bacteria 1725
71 Ga0075370_10900220 3300006353 Bacteria 541
72 Ga0068871_100289882 3300006358 Bacteria 1434
73 Ga0068871_102215043 3300006358 Bacteria 524
74 Ga0075434_100129075 3300006871 Bacteria 2546
75 Ga0075434_100153113 3300006871 Bacteria 2326
76 Ga0075436_100002564 3300006914 Bacteria 12509
77 Ga0075436_100019157 3300006914 Bacteria 4689
78 Ga0075435_100177695 3300007076 Bacteria 1798
79 Ga0105240_10017473 3300009093 Bacteria 9666
80 Ga0105240_10389360 3300009093 Bacteria 1572
81 Ga0105240_10555162 3300009093 Bacteria 1270
82 Ga0105240_11557115 3300009093 Bacteria 692
83 Ga0105240_11758260 3300009093 Bacteria 647
84 Ga0105245_10745293 3300009098 Bacteria 1015
85 Ga0105245_11444059 3300009098 Bacteria 738
86 Ga0105241_10120327 3300009174 Bacteria 2113
87 Ga0105241_10159833 3300009174 Bacteria 1851
88 Ga0105241_10176283 3300009174 Bacteria 1770
89 Ga0105241_10347551 3300009174 Bacteria 1287
90 Ga0105241_11634568 3300009174 Bacteria 624
91 Ga0105248_11225997 3300009177 Bacteria 848
92 Ga0105237_10032303 3300009545 Bacteria 5300
93 Ga0105238_10001939 3300009551 Bacteria 20807
94 Ga0105238_10035831 3300009551 Bacteria 5044
95 Ga0105239_10060445 3300010375 Bacteria 4159
96 Ga0105239_13315078 3300010375 Bacteria 524
97 Ga0105239_13602993 3300010375 Bacteria 503
98 Ga0157373_10000820 3300013100 Bacteria 24076
99 Ga0157373_10049430 3300013100 Bacteria 2997
100 Ga0157371_10199235 3300013102 Bacteria 1435
101 Ga0157371_11314288 3300013102 Bacteria 560
102 Ga0157370_10003448 3300013104 Bacteria 18559
103 Ga0157370_10040902 3300013104 Bacteria 4474
104 Ga0157369_10001535 3300013105 Bacteria 28280
105 Ga0157374_10294923 3300013296 Bacteria 1603
106 Ga0157378_10804115 3300013297 Bacteria 966
107 Ga0163162_10363163 3300013306 Bacteria 1581
108 Ga0163162_12602856 3300013306 Bacteria 582
109 Ga0157372_10023820 3300013307 Bacteria 6641
110 Ga0157372_10059581 3300013307 Bacteria 4270
111 Ga0157372_10171999 3300013307 Bacteria 2506
112 Ga0157372_10213448 3300013307 Bacteria 2236
113 Ga0157372_10722197 3300013307 Bacteria 1159
114 Ga0157372_11473348 3300013307 Bacteria 784
115 Ga0157372_11864112 3300013307 Bacteria 691
116 Ga0157375_13248534 3300013308 Bacteria 542
117 Ga0163163_10056493 3300014325 Bacteria 3880
118 Ga0163163_11244725 3300014325 Bacteria 807
119 Ga0163163_11342325 3300014325 Bacteria 777
120 Ga0163163_11940963 3300014325 Bacteria 649
121 Ga0182008_10327796 3300014497 Bacteria 807
122 Ga0157379_10018171 3300014968 Bacteria 6195
123 Ga0157379_10038101 3300014968 Bacteria 4289
124 Ga0157379_10071200 3300014968 Bacteria 3111
125 Ga0157376_10346022 3300014969 Bacteria 1421
126 Ga0157376_11742471 3300014969 Bacteria 659
127 Ga0163161_11402451 3300017792 Bacteria 610
128 Ga0213874_10432912 3300021377 Bacteria 516
129 Ga0213876_10000421 3300021384 Bacteria 35344
130 Ga0213876_10457751 3300021384 Bacteria 679
131 Ga0213875_10028865 3300021388 Bacteria 2631
132 Ga0213875_10184431 3300021388 Bacteria 980
133 Ga0213871_10151872 3300021441 Bacteria 705
134 Ga0209026_1018320 3300025250 Bacteria 1109
135 Ga0209676_1050469 3300025292 Bacteria 1097
136 Ga0209758_1000013 3300025297 Bacteria 873003
137 Ga0207699_10000164 3300025906 Bacteria 41177
138 Ga0207699_11374856 3300025906 Bacteria 522
139 Ga0207705_10000180 3300025909 Bacteria 66404
140 Ga0207654_10084942 3300025911 Bacteria 1914
141 Ga0207654_10102125 3300025911 Bacteria 1768
142 Ga0207654_10541599 3300025911 Bacteria 826
143 Ga0207707_10002211 3300025912 Bacteria 17599
144 Ga0207707_10429662 3300025912 Bacteria 1131
145 Ga0207695_10029506 3300025913 Bacteria 6057
146 Ga0207695_10396750 3300025913 Bacteria 1264
147 Ga0207695_10445276 3300025913 Bacteria 1178
148 Ga0207695_10544668 3300025913 Bacteria 1042
149 Ga0207671_10016535 3300025914 Bacteria 5730
150 Ga0207693_10001929 3300025915 Bacteria 18163
151 Ga0207693_10037608 3300025915 Bacteria 3814
152 Ga0207663_10191451 3300025916 Bacteria 1469
153 Ga0207660_10000110 3300025917 Bacteria 46792
154 Ga0207660_10485992 3300025917 Bacteria 1001
155 Ga0207657_10000241 3300025919 Bacteria 57958
156 Ga0207649_10000194 3300025920 Bacteria 50112
157 Ga0207652_10001654 3300025921 Bacteria 19554
158 Ga0207694_10008694 3300025924 Bacteria 7666
159 Ga0207694_10031812 3300025924 Bacteria 4033
160 Ga0207694_10895675 3300025924 Bacteria 750
161 Ga0207687_10303333 3300025927 Bacteria 1287
162 Ga0207687_11129468 3300025927 Bacteria 673
163 Ga0207700_10000295 3300025928 Bacteria 29631
164 Ga0207664_10028891 3300025929 Bacteria 4219
165 Ga0207664_11414258 3300025929 Bacteria 616
166 Ga0207690_10292625 3300025932 Bacteria 1272
167 Ga0207690_11131133 3300025932 Bacteria 653
168 Ga0207670_10892977 3300025936 Bacteria 744
169 Ga0207669_10539265 3300025937 Bacteria 940
170 Ga0207665_10070338 3300025939 Bacteria 2388
171 Ga0207661_10117898 3300025944 Bacteria 2256
172 Ga0207661_10890155 3300025944 Bacteria 820
173 Ga0207661_11870905 3300025944 Bacteria 546
174 Ga0207679_10812828 3300025945 Bacteria 853
175 Ga0207667_10006198 3300025949 Bacteria 14519
176 Ga0207667_10013025 3300025949 Bacteria 9546
177 Ga0207667_10024994 3300025949 Bacteria 6548
178 Ga0207668_11557841 3300025972 Bacteria 596
179 Ga0207658_10149838 3300025986 Bacteria 1899
180 Ga0207703_10044546 3300026035 Bacteria 3567
181 Ga0207703_10224569 3300026035 Bacteria 1681
182 Ga0207639_10010763 3300026041 Bacteria 6339
183 Ga0207702_10000315 3300026078 Bacteria 55383
184 Ga0207702_10009824 3300026078 Bacteria 8022
185 Ga0207702_10579822 3300026078 Bacteria 1099
186 Ga0207702_10631139 3300026078 Bacteria 1053
187 Ga0207702_10839870 3300026078 Bacteria 909
188 Ga0207702_11473593 3300026078 Bacteria 674
189 Ga0207702_11634739 3300026078 Bacteria 637
190 Ga0207676_10661181 3300026095 Bacteria 1009
191 Ga0207674_10001605 3300026116 Bacteria 29115
192 Ga0207674_10200318 3300026116 Bacteria 1946
193 Ga0207698_10036626 3300026142 Bacteria 3604
194 Ga0207698_12079595 3300026142 Bacteria 582
195 Ga0268265_10313520 3300028380 Bacteria 1417
196 Ga0268265_11562257 3300028380 Bacteria 664
197 Ga0268264_12546933 3300028381 Bacteria 516
198 Ga0265337_1083801 3300028556 Bacteria 871
199 Ga0265336_10166374 3300028666 Bacteria 656
200 Ga0265338_10309665 3300028800 Bacteria 1146
201 Ga0316182_1227941 3300030745 Bacteria 968
202 Ga0265332_10203971 3300031238 Bacteria 821
203 Ga0265332_10212412 3300031238 Bacteria 803
204 Ga0265325_10000820 3300031241 Bacteria 22557
205 Ga0265325_10012680 3300031241 Bacteria 4814
206 Ga0265340_10138662 3300031247 Bacteria 1113
207 Ga0265339_10005687 3300031249 Bacteria 8275
208 Ga0265331_10119323 3300031250 Bacteria 1206
209 Ga0265327_10005226 3300031251 Bacteria 10946
210 Ga0265316_10061302 3300031344 Bacteria 2922
211 Ga0307408_100927653 3300031548 Bacteria 798
212 Ga0265313_10001315 3300031595 Bacteria 23436
213 Ga0265313_10047949 3300031595 Bacteria 2064
214 Ga0265314_10004460 3300031711 Bacteria 12990
215 Ga0265314_10098246 3300031711 Bacteria 1889
216 Ga0265314_10137507 3300031711 Bacteria 1515
217 Ga0265314_10225166 3300031711 Bacteria 1091
218 Ga0265314_10227005 3300031711 Bacteria 1086
219 Ga0265342_10257424 3300031712 Bacteria 930
220 Ga0307405_10452206 3300031731 Bacteria 1018
221 Ga0307413_10002271 3300031824 Bacteria 7767
222 Ga0307413_11838117 3300031824 Bacteria 543
223 Ga0307410_10813726 3300031852 Bacteria 795
224 Ga0307406_10119121 3300031901 Bacteria 1832
225 Ga0307407_10114232 3300031903 Bacteria 1701
226 Ga0307407_10835703 3300031903 Bacteria 703
227 Ga0307412_10338458 3300031911 Bacteria 1203
228 Ga0307412_10595494 3300031911 Bacteria 935
229 Ga0307412_11261291 3300031911 Bacteria 664
230 Ga0307412_11743685 3300031911 Bacteria 572
231 Ga0307409_101230991 3300031995 Bacteria 772
232 Ga0307414_10358294 3300032004 Bacteria 1254
233 Ga0307414_10445229 3300032004 Bacteria 1135
234 Ga0307414_10667161 3300032004 Bacteria 938
235 Ga0307411_10427678 3300032005 Bacteria 1102
236 Ga0307411_10753026 3300032005 Bacteria 853
237 Ga0307411_10911607 3300032005 Bacteria 781
238 Ga0307415_100071944 3300032126 Bacteria 2434
239 Ga0307415_100943921 3300032126 Bacteria 798
240 Ga0316593_10005586 3300032168 Bacteria 3329
241 Ga0316593_10050501 3300032168 Bacteria 1404
242 Ga0373923_0596853 3300035111 Bacteria 544
243 Ga0373932_0041782 3300035112 Bacteria 1326
244 Ga0373932_0167090 3300035112 Bacteria 764
245 Ga0373957_0407957 3300035120 Bacteria 585
246 Ga0373943_0129614 3300035170 Bacteria 1349
247 Ga0373943_0616662 3300035170 Bacteria 640
248 Ga0373955_0017677 3300035172 Bacteria 3533
249 Ga0373931_0788435 3300035691 Bacteria 633
250 Ga0373935_0235103 3300035692 Bacteria 1277
251 Ga0373933_0246665 3300035724 Bacteria 1149
252 Ga0373933_0746233 3300035724 Bacteria 644
253 Ga0373937_0058492 3300036401 Bacteria 3541
254 Ga0373937_0542341 3300036401 Bacteria 1105
255 Ga0373937_1599824 3300036401 Bacteria 599
256 Ga0373937_1818248 3300036401 Bacteria 556
257 Ga0316582_1125678 3300036647 Bacteria 535
258 Ga0373925_0127468 3300037068 Bacteria 1981
259 Ga0436364_0000682 3300037853 Bacteria 2241
260 Ga0436364_0554982 3300037853 Bacteria 6536
261 Ga0436364_0586291 3300037853 Bacteria 97560
262 Ga0436365_0340931 3300039437 Bacteria 1168
263 Ga0436365_0630930 3300039437 Bacteria 601
264 Ga0436365_1505093 3300039437 Bacteria 2918
265 Ga0436365_1637588 3300039437 Bacteria 49130
266 Ga0436365_1652185 3300039437 Bacteria 660
267 Ga0436360_0764332 3300039438 Bacteria 1442
268 Ga0436360_0920335 3300039438 Bacteria 1450
269 Ga0436360_1031228 3300039438 Bacteria 563
270 Ga0436360_1157227 3300039438 Bacteria 1115
271 Ga0436360_1324784 3300039438 Bacteria 797
272 Ga0436363_1404294 3300039450 Bacteria 4549
273 Ga0436362_0587556 3300039453 Bacteria 1070
274 Ga0439439_0223197 3300041406 Bacteria 553
275 Ga0439461_0052874 3300041410 Bacteria 905
276 Ga0439466_0139938 3300041411 Bacteria 743
277 Ga0439465_0246044 3300041413 Bacteria 660
278 Ga0451789_1040143 3300041443 Bacteria 965
279 Ga0451792_23173 3300041445 Bacteria 512
280 Ga0451794_03409 3300041446 Bacteria 536
281 Ga0451791_0063844 3300041451 Bacteria 535
282 Ga0451791_0268437 3300041451 Bacteria 822
283 Ga0451801_43680 3300041455 Bacteria 562
284 Ga0451795_0203980 3300041456 Bacteria 789
285 Ga0451802_0642518 3300041460 Bacteria 638
286 Ga0451805_125400 3300041461 Bacteria 615
287 Ga0451833_0331039 3300041491 Bacteria 715
288 Ga0451845_0239639 3300041501 Bacteria 507
289 Ga0439441_043699 3300042001 Bacteria 905
290 Ga0439445_0141063 3300042004 Bacteria 699
291 Ga0439448_0271099 3300042005 Bacteria 601
292 Ga0439449_0097806 3300042007 Bacteria 1084
293 Ga0439462_0147411 3300042015 Bacteria 661
294 Ga0439446_0246033 3300042156 Bacteria 615
295 Ga0451577_0371323 3300042876 Bacteria 1298
296 Ga0453684_2211924 3300044712 Bacteria 549
297 Ga0466967_0404941 3300045976 Bacteria 1328
298 Ga0466967_0871669 3300045976 Bacteria 895
299 Ga0466967_0975239 3300045976 Bacteria 844
300 Ga0495580_0036721 3300046472 Bacteria 3517
301 Ga0495610_0040653 3300046512 Bacteria 2342
302 Ga0495630_0132271 3300046517 Bacteria 1895
303 Ga0495643_0450010 3300046522 Bacteria 561
304 Ga0495668_0493590 3300046616 Bacteria 675
305 Ga0495611_0417542 3300046648 Bacteria 613
306 Ga0495625_0572496 3300046660 Bacteria 681
307 Ga0495657_0141296 3300046675 Bacteria 1500
308 Ga0495623_0050531 3300046679 Bacteria 2633
309 Ga0495669_0000044 3300046684 Bacteria 85633
310 Ga0495669_0000371 3300046684 Bacteria 22866
311 Ga0495649_0627517 3300046694 Bacteria 529
312 Ga0495677_0023144 3300047445 Bacteria 2255
313 Ga0496102_0664674 3300048905 Bacteria 965
314 Ga0496106_0379828 3300048909 Bacteria 1135
315 Ga0496106_1297000 3300048909 Bacteria 565
316 Ga0496110_0357780 3300048913 Bacteria 1330
317 Ga0496110_0974744 3300048913 Bacteria 755
318 Ga0496124_0256921 3300048927 Bacteria 1288
319 Ga0496125_0000815 3300048928 Bacteria 50702
320 Ga0496125_0023733 3300048928 Bacteria 5655
321 Ga0496126_0000480 3300048929 Bacteria 79257
322 Ga0496126_0133942 3300048929 Bacteria 2139
323 Ga0496126_0482697 3300048929 Bacteria 993
324 Ga0501306_005105 3300049127 Bacteria 1494
325 Ga0501306_009483 3300049127 Bacteria 1208
326 Ga0501306_026822 3300049127 Bacteria 836
327 Ga0501308_040044 3300049128 Bacteria 657
328 Ga0501310_003705 3300049130 Bacteria 1504
329 Ga0501341_02105 3300049131 Bacteria 1053
330 Ga0501341_02423 3300049131 Bacteria 1008
331 Ga0501305_054820 3300049161 Bacteria 676
332 Ga0501307_022378 3300049162 Bacteria 830
333 Ga0501307_022590 3300049162 Bacteria 828
334 Ga0501313_014478 3300049529 Bacteria 934
335 Ga0501314_004138 3300049530 Bacteria 1193
336 Ga0501315_074828 3300049531 Bacteria 567
337 Ga0501316_017029 3300049532 Bacteria 888
338 Ga0501316_039006 3300049532 Bacteria 657
339 Ga0501317_054332 3300049533 Bacteria 643
340 Ga0501319_003698 3300049535 Bacteria 1036
341 Ga0501319_024439 3300049535 Bacteria 557
342 Ga0501320_016366 3300049536 Bacteria 820
343 Ga0501320_031740 3300049536 Bacteria 660
344 Ga0501320_034114 3300049536 Bacteria 645
345 Ga0501321_008994 3300049537 Bacteria 1071
346 Ga0501321_010431 3300049537 Bacteria 1020
347 Ga0501321_028338 3300049537 Bacteria 736
348 Ga0501322_013594 3300049538 Bacteria 658
349 Ga0501323_008914 3300049539 Bacteria 1174
350 Ga0501323_039722 3300049539 Bacteria 686
351 Ga0501324_016590 3300049540 Bacteria 724
352 Ga0501324_023410 3300049540 Bacteria 643
353 Ga0501325_003636 3300049541 Bacteria 1136
354 Ga0501325_026121 3300049541 Bacteria 645
355 Ga0501328_07265 3300049544 Bacteria 586
356 Ga0501329_07883 3300049545 Bacteria 631
357 Ga0501332_11664 3300049548 Bacteria 597
358 Ga0501334_02556 3300049550 Bacteria 1087
359 Ga0501338_19576 3300049554 Bacteria 500
360 Ga0501031_0071408 3300049568 Bacteria 2261
361 Ga0501031_0090980 3300049568 Bacteria 1990
362 Ga0501031_0333523 3300049568 Bacteria 982
363 Ga0501031_0742197 3300049568 Bacteria 630
364 Ga0501032_0288405 3300049569 Bacteria 1062
365 Ga0501032_0294266 3300049569 Bacteria 1050
366 Ga0501032_0625334 3300049569 Bacteria 684
367 Ga0501032_0655441 3300049569 Bacteria 667
368 Ga0501033_0109003 3300049570 Bacteria 2017
369 Ga0501033_0148779 3300049570 Bacteria 1690
370 Ga0501033_0659132 3300049570 Bacteria 714
371 Ga0501034_0066576 3300049571 Bacteria 3615
372 Ga0501034_0213220 3300049571 Bacteria 1885
373 Ga0501034_0247011 3300049571 Bacteria 1729
374 Ga0501034_0392517 3300049571 Bacteria 1311
375 Ga0501034_0700656 3300049571 Bacteria 911
376 Ga0501034_0820627 3300049571 Bacteria 822
377 Ga0501036_0109734 3300049572 Bacteria 2331
378 Ga0501036_0511071 3300049572 Bacteria 999
379 Ga0501036_0584288 3300049572 Bacteria 927
380 Ga0501037_0015651 3300049573 Bacteria 5584
381 Ga0501037_0050986 3300049573 Bacteria 3027
382 Ga0501037_0321929 3300049573 Bacteria 1070
383 Ga0501037_0640198 3300049573 Bacteria 711
384 Ga0501037_0828493 3300049573 Bacteria 610
385 Ga0501038_0044247 3300049574 Bacteria 3870
386 Ga0501038_0177720 3300049574 Bacteria 1719
387 Ga0501038_0219570 3300049574 Bacteria 1517
388 Ga0501043_0169190 3300049579 Bacteria 1705
389 Ga0501043_0577040 3300049579 Bacteria 833
390 Ga0501043_0594310 3300049579 Bacteria 818
391 Ga0501043_1026065 3300049579 Bacteria 586
392 Ga0501046_0012992 3300049580 Bacteria 7068
393 Ga0501046_0101892 3300049580 Bacteria 2202
394 Ga0501046_0121566 3300049580 Bacteria 1986
395 Ga0501046_0122100 3300049580 Bacteria 1981
396 Ga0501046_0400169 3300049580 Bacteria 992
397 Ga0501046_1207684 3300049580 Bacteria 519
398 Ga0501047_0019729 3300049581 Bacteria 6470
399 Ga0501047_0025781 3300049581 Bacteria 5653
400 Ga0501047_0027205 3300049581 Bacteria 5508
401 Ga0501047_0095267 3300049581 Bacteria 2855
402 Ga0501047_0111494 3300049581 Bacteria 2618
403 Ga0501047_0389956 3300049581 Bacteria 1226
404 Ga0501047_0985431 3300049581 Bacteria 656
405 Ga0501048_0102315 3300049582 Bacteria 2021
406 Ga0501048_0211995 3300049582 Bacteria 1374
407 Ga0501048_1325511 3300049582 Bacteria 517
408 Ga0501067_0005350 3300049583 Bacteria 7126
409 Ga0501067_0033573 3300049583 Bacteria 2846
410 Ga0501068_0423151 3300049584 Bacteria 860
411 Ga0501069_0005996 3300049585 Bacteria 6340
412 Ga0501069_0208376 3300049585 Bacteria 1134
413 Ga0501070_0001611 3300049586 Bacteria 20025
414 Ga0501070_0003398 3300049586 Bacteria 13819
415 Ga0501070_0624901 3300049586 Bacteria 857
416 Ga0501070_0663235 3300049586 Bacteria 827
417 Ga0501072_0013154 3300049588 Bacteria 6335
418 Ga0501073_0004494 3300049589 Bacteria 10476
419 Ga0501073_0017294 3300049589 Bacteria 5223
420 Ga0501073_0048979 3300049589 Bacteria 2963
421 Ga0501073_0414933 3300049589 Bacteria 930
422 Ga0501074_0010906 3300049590 Bacteria 6595
423 Ga0501225_0304278 3300049705 Bacteria 540
424 Ga0501079_0018448 3300049741 Bacteria 5331
425 Ga0501080_0006960 3300049742 Bacteria 10202
426 Ga0501080_0028291 3300049742 Bacteria 5213
427 Ga0501080_0142334 3300049742 Bacteria 2217
428 Ga0501080_0253758 3300049742 Bacteria 1603
429 Ga0501080_0708509 3300049742 Bacteria 887
430 Ga0501080_1100428 3300049742 Bacteria 686
431 Ga0501083_0366031 3300049744 Bacteria 938
432 Ga0501083_0446865 3300049744 Bacteria 841
433 Ga0501035_0013364 3300049822 Bacteria 7579
434 Ga0501035_0024934 3300049822 Bacteria 5484
435 Ga0501035_0134735 3300049822 Bacteria 2151
436 Ga0501035_0178365 3300049822 Bacteria 1831
437 Ga0501035_0520272 3300049822 Bacteria 977
438 Ga0501035_0683218 3300049822 Bacteria 829
439 Ga0501044_0028702 3300049823 Bacteria 5870
440 Ga0501044_0087802 3300049823 Bacteria 3140
441 Ga0501044_0236197 3300049823 Bacteria 1773
442 Ga0501044_0545236 3300049823 Bacteria 1057
443 Ga0501044_0583131 3300049823 Bacteria 1012
444 Ga0501044_0697989 3300049823 Bacteria 900
445 Ga0501044_0765300 3300049823 Bacteria 847
446 Ga0501044_0773014 3300049823 Bacteria 841
447 Ga0501044_1122855 3300049823 Bacteria 655
448 nmdc:mga03n38_489073_c1 3300050490 Bacteria 689
449 nmdc:mga00v17_207481_c1 3300050491 Bacteria 1267
450 nmdc:mga0k408_262086_c1 3300050493 Bacteria 1032
451 nmdc:mga06z11_195671_c1 3300050494 Bacteria 1172
452 nmdc:mga07m45_86553_c1 3300050496 Bacteria 1793
453 nmdc:mga0n895_129615_c1 3300050512 Bacteria 2547
454 nmdc:mga0n895_158795_c1 3300050512 Bacteria 2292
455 nmdc:mga0rr50_163926_c1 3300050513 Bacteria 1806
456 nmdc:mga08x19_14934_c1 3300050514 Bacteria 4717
457 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
458 Ga0495612_0403865 3300053078 Bacteria 621
459 Ga0500643_000003 3300053087 Bacteria 876659
460 Ga0500646_0150602 3300053090 Bacteria 770
461 Ga0500555_061498 3300053103 Bacteria 1009
462 Ga0500562_111055 3300053108 Bacteria 747
463 Ga0500595_033265 3300053119 Bacteria 1712
464 Ga0500597_374807 3300053120 Bacteria 547
465 Ga0500608_168807 3300053122 Bacteria 940
466 Ga0500642_0441554 3300053130 Bacteria 560
467 Ga0500655_049063 3300053133 Bacteria 839
468 Ga0500568_0069253 3300053139 Bacteria 1353
469 Ga0500573_0280594 3300053140 Bacteria 843
470 Ga0500604_0000294 3300053151 Bacteria 13881
471 Ga0500616_0044593 3300053153 Bacteria 2365
472 Ga0500624_019940 3300053157 Bacteria 1070
473 Ga0500634_0000031 3300053161 Bacteria 75547
474 Ga0500611_115817 3300053727 Bacteria 709
475 Ga0501084_0030163 3300054114 Bacteria 4535
476 Ga0501084_0044330 3300054114 Bacteria 3724
477 Ga0501084_0127908 3300054114 Bacteria 2138
478 Ga0587084_063256 3300059477 Bacteria 683
479 Ga0587070_094488 3300059491 Bacteria 678
480 Ga0587077_095959 3300059493 Bacteria 705
481 Ga0587083_0101128 3300059505 Bacteria 718
482 Ga0587109_074821 3300059624 Bacteria 739
483 Ga0587062_051278 3300059639 Bacteria 699
484 Ga0587068_004290 3300059641 Bacteria 1877
485 Ga0587068_125347 3300059641 Bacteria 561
486 Ga0587072_001135 3300059643 Bacteria 3158
487 Ga0587079_049145 3300059647 Bacteria 880
488 Ga0587107_017865 3300059652 Bacteria 954
489 Ga0501082_0194897 3300060353 Bacteria 1762
490 Ga0530510_0792685 3300061734 Bacteria 723
491 2524609935 2524023250 Bacteria 5457705
492 2643911582 2643221580 Bacteria 3816678
493 2643963618 2643221591 Bacteria 4397626
494 2643997885 2643221598 Bacteria 4578346
495 2644088879 2643221614 Bacteria 4260023
496 2644165901 2643221629 Bacteria 5850260
497 2644342241 2643221661 Bacteria 4267604
498 2644347089 2643221662 Bacteria 5851492
499 2644369624 2643221666 Bacteria 4265935
500 2644410374 2643221674 Bacteria 3919126
501 2932403064 2932401849 Bacteria 4262978
502 Ga0213875_10014923
503 JGI25153J46596_10000830
504 Ga0006777J48905_1081902
505 Ga0006780_1044058
506 Ga0058862_12808773
507 Ga0070658_10094080
508 Ga0070683_101664720
509 Ga0070680_100020347
510 Ga0070682_100792633
511 Ga0068868_101901312
512 Ga0070660_100001324
513 Ga0070689_101375863
514 Ga0070691_10000386
515 Ga0070691_10000795
516 Ga0070661_100005946
517 Ga0070661_100584297
518 Ga0070668_100050837
519 Ga0070659_100410917
520 Ga0070667_100853948
521 Ga0070709_10003511
522 Ga0070714_100011419
523 Ga0070714_100990624
524 Ga0070713_100000012
525 Ga0070713_100508190
526 Ga0070710_10947475
527 Ga0070710_11314108
528 Ga0070705_100068685
529 Ga0070708_101305242
530 Ga0070681_10029349
531 Ga0070681_10221516
532 Ga0070699_100225191
533 Ga0070679_100057285
534 Ga0070679_101580192
535 Ga0070684_101325896
536 Ga0068853_100002660
537 Ga0070695_100003098
538 Ga0070693_100051681
539 Ga0070693_100054219
540 Ga0070693_100203035
541 Ga0070693_100745378
542 Ga0068855_100012001
543 Ga0068855_100057023
544 Ga0070664_100858079
545 Ga0070664_102154978
546 Ga0068857_100007896
547 Ga0068854_100837950
548 Ga0068856_100001032
549 Ga0068856_100034393
550 Ga0068856_100158389
551 Ga0068856_100221172
552 Ga0068856_100551362
553 Ga0068856_101043910
554 Ga0068856_101577817
555 Ga0068852_100006800
556 Ga0068864_101027904
557 Ga0068858_100274655
558 Ga0068858_100342360
559 Ga0068862_101884812
560 Ga0075363_100224636
561 Ga0075364_10475916
562 Ga0075364_11177196
563 Ga0070716_100046578
564 Ga0070716_100738028
565 Ga0070712_100000902
566 Ga0070712_100576142
567 Ga0075367_10068874
568 Ga0075369_10091481
569 Ga0075366_10096605
570 Ga0097621_100069869
571 Ga0075370_10094675
572 Ga0075370_10900220
573 Ga0068871_100289882
574 Ga0068871_102215043
575 Ga0075434_100129075
576 Ga0075434_100153113
577 Ga0075436_100002564
578 Ga0075436_100019157
579 Ga0075435_100177695
580 Ga0105240_10017473
581 Ga0105240_10389360
582 Ga0105240_10555162
583 Ga0105240_11557115
584 Ga0105240_11758260
585 Ga0105245_10745293
586 Ga0105245_11444059
587 Ga0105241_10120327
588 Ga0105241_10159833
589 Ga0105241_10176283
590 Ga0105241_10347551
591 Ga0105241_11634568
592 Ga0105248_11225997
593 Ga0105237_10032303
594 Ga0105238_10001939
595 Ga0105238_10035831
596 Ga0105239_10060445
597 Ga0105239_13315078
598 Ga0105239_13602993
599 Ga0157373_10000820
600 Ga0157373_10049430
601 Ga0157371_10199235
602 Ga0157371_11314288
603 Ga0157370_10003448
604 Ga0157370_10040902
605 Ga0157369_10001535
606 Ga0157374_10294923
607 Ga0157378_10804115
608 Ga0163162_10363163
609 Ga0163162_12602856
610 Ga0157372_10023820
611 Ga0157372_10059581
612 Ga0157372_10171999
613 Ga0157372_10213448
614 Ga0157372_10722197
615 Ga0157372_11473348
616 Ga0157372_11864112
617 Ga0157375_13248534
618 Ga0163163_10056493
619 Ga0163163_11244725
620 Ga0163163_11342325
621 Ga0163163_11940963
622 Ga0182008_10327796
623 Ga0157379_10018171
624 Ga0157379_10038101
625 Ga0157379_10071200
626 Ga0157376_10346022
627 Ga0157376_11742471
628 Ga0163161_11402451
629 Ga0213874_10432912
630 Ga0213876_10000421
631 Ga0213876_10457751
632 Ga0213875_10028865
633 Ga0213875_10184431
634 Ga0213871_10151872
635 Ga0209026_1018320
636 Ga0209676_1050469
637 Ga0209758_1000013
638 Ga0207699_10000164
639 Ga0207699_11374856
640 Ga0207705_10000180
641 Ga0207654_10084942
642 Ga0207654_10102125
643 Ga0207654_10541599
644 Ga0207707_10002211
645 Ga0207707_10429662
646 Ga0207695_10029506
647 Ga0207695_10396750
648 Ga0207695_10445276
649 Ga0207695_10544668
650 Ga0207671_10016535
651 Ga0207693_10001929
652 Ga0207693_10037608
653 Ga0207663_10191451
654 Ga0207660_10000110
655 Ga0207660_10485992
656 Ga0207657_10000241
657 Ga0207649_10000194
658 Ga0207652_10001654
659 Ga0207694_10008694
660 Ga0207694_10031812
661 Ga0207694_10895675
662 Ga0207687_10303333
663 Ga0207687_11129468
664 Ga0207700_10000295
665 Ga0207664_10028891
666 Ga0207664_11414258
667 Ga0207690_10292625
668 Ga0207690_11131133
669 Ga0207670_10892977
670 Ga0207669_10539265
671 Ga0207665_10070338
672 Ga0207661_10117898
673 Ga0207661_10890155
674 Ga0207661_11870905
675 Ga0207679_10812828
676 Ga0207667_10006198
677 Ga0207667_10013025
678 Ga0207667_10024994
679 Ga0207668_11557841
680 Ga0207658_10149838
681 Ga0207703_10044546
682 Ga0207703_10224569
683 Ga0207639_10010763
684 Ga0207702_10000315
685 Ga0207702_10009824
686 Ga0207702_10579822
687 Ga0207702_10631139
688 Ga0207702_10839870
689 Ga0207702_11473593
690 Ga0207702_11634739
691 Ga0207676_10661181
692 Ga0207674_10001605
693 Ga0207674_10200318
694 Ga0207698_10036626
695 Ga0207698_12079595
696 Ga0268265_10313520
697 Ga0268265_11562257
698 Ga0268264_12546933
699 Ga0265337_1083801
700 Ga0265336_10166374
701 Ga0265338_10309665
702 Ga0316182_1227941
703 Ga0265332_10203971
704 Ga0265332_10212412
705 Ga0265325_10000820
706 Ga0265325_10012680
707 Ga0265340_10138662
708 Ga0265339_10005687
709 Ga0265331_10119323
710 Ga0265327_10005226
711 Ga0265316_10061302
712 Ga0307408_100927653
713 Ga0265313_10001315
714 Ga0265313_10047949
715 Ga0265314_10004460
716 Ga0265314_10098246
717 Ga0265314_10137507
718 Ga0265314_10225166
719 Ga0265314_10227005
720 Ga0265342_10257424
721 Ga0307405_10452206
722 Ga0307413_10002271
723 Ga0307413_11838117
724 Ga0307410_10813726
725 Ga0307406_10119121
726 Ga0307407_10114232
727 Ga0307407_10835703
728 Ga0307412_10338458
729 Ga0307412_10595494
730 Ga0307412_11261291
731 Ga0307412_11743685
732 Ga0307409_101230991
733 Ga0307414_10358294
734 Ga0307414_10445229
735 Ga0307414_10667161
736 Ga0307411_10427678
737 Ga0307411_10753026
738 Ga0307411_10911607
739 Ga0307415_100071944
740 Ga0307415_100943921
741 Ga0316593_10005586
742 Ga0316593_10050501
743 Ga0373923_0596853
744 Ga0373932_0041782
745 Ga0373932_0167090
746 Ga0373957_0407957
747 Ga0373943_0129614
748 Ga0373943_0616662
749 Ga0373955_0017677
750 Ga0373931_0788435
751 Ga0373935_0235103
752 Ga0373933_0246665
753 Ga0373933_0746233
754 Ga0373937_0058492
755 Ga0373937_0542341
756 Ga0373937_1599824
757 Ga0373937_1818248
758 Ga0316582_1125678
759 Ga0373925_0127468
760 Ga0436364_0000682
761 Ga0436364_0554982
762 Ga0436364_0586291
763 Ga0436365_0340931
764 Ga0436365_0630930
765 Ga0436365_1505093
766 Ga0436365_1637588
767 Ga0436365_1652185
768 Ga0436360_0764332
769 Ga0436360_0920335
770 Ga0436360_1031228
771 Ga0436360_1157227
772 Ga0436360_1324784
773 Ga0436363_1404294
774 Ga0436362_0587556
775 Ga0439439_0223197
776 Ga0439461_0052874
777 Ga0439466_0139938
778 Ga0439465_0246044
779 Ga0451789_1040143
780 Ga0451792_23173
781 Ga0451794_03409
782 Ga0451791_0063844
783 Ga0451791_0268437
784 Ga0451801_43680
785 Ga0451795_0203980
786 Ga0451802_0642518
787 Ga0451805_125400
788 Ga0451833_0331039
789 Ga0451845_0239639
790 Ga0439441_043699
791 Ga0439445_0141063
792 Ga0439448_0271099
793 Ga0439449_0097806
794 Ga0439462_0147411
795 Ga0439446_0246033
796 Ga0451577_0371323
797 Ga0453684_2211924
798 Ga0466967_0404941
799 Ga0466967_0871669
800 Ga0466967_0975239
801 Ga0495580_0036721
802 Ga0495610_0040653
803 Ga0495630_0132271
804 Ga0495643_0450010
805 Ga0495668_0493590
806 Ga0495611_0417542
807 Ga0495625_0572496
808 Ga0495657_0141296
809 Ga0495623_0050531
810 Ga0495669_0000044
811 Ga0495669_0000371
812 Ga0495649_0627517
813 Ga0495677_0023144
814 Ga0496102_0664674
815 Ga0496106_0379828
816 Ga0496106_1297000
817 Ga0496110_0357780
818 Ga0496110_0974744
819 Ga0496124_0256921
820 Ga0496125_0000815
821 Ga0496125_0023733
822 Ga0496126_0000480
823 Ga0496126_0133942
824 Ga0496126_0482697
825 Ga0501306_005105
826 Ga0501306_009483
827 Ga0501306_026822
828 Ga0501308_040044
829 Ga0501310_003705
830 Ga0501341_02105
831 Ga0501341_02423
832 Ga0501305_054820
833 Ga0501307_022378
834 Ga0501307_022590
835 Ga0501313_014478
836 Ga0501314_004138
837 Ga0501315_074828
838 Ga0501316_017029
839 Ga0501316_039006
840 Ga0501317_054332
841 Ga0501319_003698
842 Ga0501319_024439
843 Ga0501320_016366
844 Ga0501320_031740
845 Ga0501320_034114
846 Ga0501321_008994
847 Ga0501321_010431
848 Ga0501321_028338
849 Ga0501322_013594
850 Ga0501323_008914
851 Ga0501323_039722
852 Ga0501324_016590
853 Ga0501324_023410
854 Ga0501325_003636
855 Ga0501325_026121
856 Ga0501328_07265
857 Ga0501329_07883
858 Ga0501332_11664
859 Ga0501334_02556
860 Ga0501338_19576
861 Ga0501031_0071408
862 Ga0501031_0090980
863 Ga0501031_0333523
864 Ga0501031_0742197
865 Ga0501032_0288405
866 Ga0501032_0294266
867 Ga0501032_0625334
868 Ga0501032_0655441
869 Ga0501033_0109003
870 Ga0501033_0148779
871 Ga0501033_0659132
872 Ga0501034_0066576
873 Ga0501034_0213220
874 Ga0501034_0247011
875 Ga0501034_0392517
876 Ga0501034_0700656
877 Ga0501034_0820627
878 Ga0501036_0109734
879 Ga0501036_0511071
880 Ga0501036_0584288
881 Ga0501037_0015651
882 Ga0501037_0050986
883 Ga0501037_0321929
884 Ga0501037_0640198
885 Ga0501037_0828493
886 Ga0501038_0044247
887 Ga0501038_0177720
888 Ga0501038_0219570
889 Ga0501043_0169190
890 Ga0501043_0577040
891 Ga0501043_0594310
892 Ga0501043_1026065
893 Ga0501046_0012992
894 Ga0501046_0101892
895 Ga0501046_0121566
896 Ga0501046_0122100
897 Ga0501046_0400169
898 Ga0501046_1207684
899 Ga0501047_0019729
900 Ga0501047_0025781
901 Ga0501047_0027205
902 Ga0501047_0095267
903 Ga0501047_0111494
904 Ga0501047_0389956
905 Ga0501047_0985431
906 Ga0501048_0102315
907 Ga0501048_0211995
908 Ga0501048_1325511
909 Ga0501067_0005350
910 Ga0501067_0033573
911 Ga0501068_0423151
912 Ga0501069_0005996
913 Ga0501069_0208376
914 Ga0501070_0001611
915 Ga0501070_0003398
916 Ga0501070_0624901
917 Ga0501070_0663235
918 Ga0501072_0013154
919 Ga0501073_0004494
920 Ga0501073_0017294
921 Ga0501073_0048979
922 Ga0501073_0414933
923 Ga0501074_0010906
924 Ga0501225_0304278
925 Ga0501079_0018448
926 Ga0501080_0006960
927 Ga0501080_0028291
928 Ga0501080_0142334
929 Ga0501080_0253758
930 Ga0501080_0708509
931 Ga0501080_1100428
932 Ga0501083_0366031
933 Ga0501083_0446865
934 Ga0501035_0013364
935 Ga0501035_0024934
936 Ga0501035_0134735
937 Ga0501035_0178365
938 Ga0501035_0520272
939 Ga0501035_0683218
940 Ga0501044_0028702
941 Ga0501044_0087802
942 Ga0501044_0236197
943 Ga0501044_0545236
944 Ga0501044_0583131
945 Ga0501044_0697989
946 Ga0501044_0765300
947 Ga0501044_0773014
948 Ga0501044_1122855
949 nmdc:mga03n38_489073_c1
950 nmdc:mga00v17_207481_c1
951 nmdc:mga0k408_262086_c1
952 nmdc:mga06z11_195671_c1
953 nmdc:mga07m45_86553_c1
954 nmdc:mga0n895_129615_c1
955 nmdc:mga0n895_158795_c1
956 nmdc:mga0rr50_163926_c1
957 nmdc:mga08x19_14934_c1
958 nmdc:mga08x19_177_c1
959 Ga0495612_0403865
960 Ga0500643_000003
961 Ga0500646_0150602
962 Ga0500555_061498
963 Ga0500562_111055
964 Ga0500595_033265
965 Ga0500597_374807
966 Ga0500608_168807
967 Ga0500642_0441554
968 Ga0500655_049063
969 Ga0500568_0069253
970 Ga0500573_0280594
971 Ga0500604_0000294
972 Ga0500616_0044593
973 Ga0500624_019940
974 Ga0500634_0000031
975 Ga0500611_115817
976 Ga0501084_0030163
977 Ga0501084_0044330
978 Ga0501084_0127908
979 Ga0587084_063256
980 Ga0587070_094488
981 Ga0587077_095959
982 Ga0587083_0101128
983 Ga0587109_074821
984 Ga0587062_051278
985 Ga0587068_004290
986 Ga0587068_125347
987 Ga0587072_001135
988 Ga0587079_049145
989 Ga0587107_017865
990 Ga0501082_0194897
991 Ga0530510_0792685
992 2524609935
993 2643911582
994 2643963618
995 2643997885
996 2644088879
997 2644165901
998 2644342241
999 2644347089
1000 2644369624
1001 2644410374
1002 2932403064

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

25

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9716 4 88
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9713 4 85
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9705 4 90
6ddg-assembly1.cif.gz_F structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.963 6 89
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.962 4 91
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9653 4 90 3.30.70.330
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.939 4 88 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9236 4 90 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9222 4 88 3.30.70.330
af_E9AG68_26_145_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9182 4 88 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1E5Q547-F1-model_v4 Large ribosomal subunit protein uL23 0.9931 4 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7X7X7C2-F1-model_v4 Large ribosomal subunit protein uL23 0.9922 6 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0S7X6A9-F1-model_v4 Large ribosomal subunit protein uL23 0.9909 4 92 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A419EVM5-F1-model_v4 Large ribosomal subunit protein uL23 0.9906 4 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3S0FW11-F1-model_v4 Large ribosomal subunit protein uL23 0.9901 4 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map