F455754

General Info

Members Datasets Scaffolds Average Seq Length
501 296 1002 515

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_2889_c1|nmdc:mga00v17_2889_c1_6225_7871
Length 523
Sequence MKNPAFFRVCSSIVTPAIDAAMLAPLAGSDTDAKLDTISRLGMLADPGAARILEALSAGALYVGPQEQLLIQTAAGQPIDAISGQAVAMPAQADTVMVNNRLRRAVQSALAGSRLFADDWRVRLAAASNLSRSNDLAQLPLIERALQAEQHDEVRRSLEVAQANLGLQSPQADARRAAAEALGKTRTPAFRTALATLSQPAPDGSFVEPDERVREAAARAVAAIDRHQQTVAWAGHLFYGLSLGSVLLLAALGLAITFGLMGVINMAHGELLMIGAYVTYVTQVLFRQWLPGWMDWYVLAALPAAFFITALVGMVLERTVIRWLYGRPLETLLATWGISLILMQGVRTLFGAQNVEVSNPSWMSGGVTVLGGLVLTYNRMAIIVFAMLVVAFVWLLLNHTRLGLFVRAITQNRRMADCVGVPTGRVDMLAFGLGAGIALSQLGNVGPDLGRAYIVDSFMVVVLGGVGQLAGTVIAAFSLGTINKFIEPYSGAVLAKIMILVLIVLVVQKRPQGLFAPRGRSVE

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
234 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
235 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
236 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
237 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
238 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
239 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
240 2643221569 Achromobacter sp. Root565 Isolate Unclassified
241 2643221594 Achromobacter sp. Root170 Isolate Unclassified
242 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
243 2643221621 Achromobacter sp. Root83 Isolate Unclassified
244 2643221638 Duganella sp. Root336D2 Isolate Unclassified
245 2643221645 Massilia sp. Root351 Isolate Unclassified
246 2643221664 Massilia sp. Root418 Isolate Unclassified
247 2738541280 Massilia sp. GV090 Isolate Unclassified
248 2738541297 Duganella sp. GV083 Isolate Unclassified
249 2738541300 Massilia sp. GV016 Isolate Unclassified
250 2738541357 Duganella sp. GV053 Isolate Unclassified
251 2738543003 Duganella sp. GV066 Isolate Unclassified
252 2738543018 Massilia sp. GV045 Isolate Unclassified
253 2738543026 Duganella sp. GV089 Isolate Unclassified
254 2738543029 Duganella sp. GV039 Isolate Unclassified
255 2738543030 Massilia sp. GV097 Isolate Unclassified
256 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
257 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
258 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
259 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
260 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
261 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
262 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
263 2818991436 Collimonas arenae 515 Isolate Unclassified
264 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
265 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
266 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
267 2842711865 Duganella sp. R-73148 Isolate Unclassified
268 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
269 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
270 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
271 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
272 2857553236 Duganella sp. R-74557 Isolate Unclassified
273 2857558681 Duganella sp. R-74565 Isolate Unclassified
274 2857564685 Duganella sp. R-74599 Isolate Unclassified
275 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
276 2858950400 Achromobacter sp. K91 Isolate Unclassified
277 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
278 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
279 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
280 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
281 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
282 2904424332 Duganella sp. 1411 Isolate Rhizosphere
283 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
284 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
285 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
286 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
287 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
288 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
289 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
290 2919476304 Duganella sp. 3397 Isolate Unclassified
291 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
292 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
293 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
294 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
295 2941479691
296 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.23
Metatranscriptomes 0
Isolates 12.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.17
Nodule 0.6
Rhizoplane 2.2
Rhizosphere 65.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_2889_c1 3300050491 Bacteria 8810
2 JGI25156J39149_1001146 3300002705 Bacteria 11872
3 JGI25162J39368_1000036 3300002737 Bacteria 180433
4 JGI25154J39366_1001169 3300002738 Bacteria 10057
5 JGI25158J39367_1000225 3300002739 Bacteria 13276
6 JGI25157J39369_1000796 3300002741 Bacteria 16066
7 JGI25159J45721_1000510 3300002987 Bacteria 17729
8 JGI25165J46597_1000022 3300003214 Bacteria 357959
9 rootL2_10012879 3300003322 Bacteria 2099
10 JGI25160J50197_1000744 3300003354 Bacteria 17729
11 JGI25161J50226_1000492 3300003374 Bacteria 17729
12 Ga0055538_1000011 3300003751 Bacteria 357959
13 Ga0055538_1000024 3300003751 Bacteria 241526
14 Ga0055539_1000016 3300003752 Bacteria 358248
15 Ga0055539_1000031 3300003752 Bacteria 241526
16 Ga0055533_1000019 3300003756 Bacteria 357959
17 Ga0055533_1000041 3300003756 Bacteria 241526
18 Ga0055532_1000074 3300003758 Bacteria 125513
19 Ga0055525_1000009 3300003759 Bacteria 596899
20 Ga0055525_1000042 3300003759 Bacteria 279804
21 Ga0055525_1000049 3300003759 Bacteria 241526
22 Ga0055527_1000332 3300003760 Bacteria 25122
23 Ga0055529_1000015 3300003763 Bacteria 366950
24 Ga0055526_1000411 3300003771 Bacteria 34678
25 Ga0055526_1001905 3300003771 Bacteria 14451
26 Ga0055524_1001861 3300003775 Bacteria 11555
27 Ga0055524_1003528 3300003775 Bacteria 7561
28 Ga0055528_1005863 3300003790 Bacteria 5642
29 Ga0055530_10001104 3300003791 Bacteria 21122
30 Ga0055541_1000017 3300003841 Bacteria 286811
31 Ga0055541_1000022 3300003841 Bacteria 241526
32 Ga0055543_1000677 3300004625 Bacteria 17767
33 Ga0065165_1007648 3300005262 Bacteria 5252
34 Ga0065165_1015398 3300005262 Bacteria 2918
35 Ga0070658_10028826 3300005327 Bacteria 4457
36 Ga0070680_100136673 3300005336 Bacteria 2054
37 Ga0070659_100000014 3300005366 Bacteria 178272
38 Ga0070659_100129262 3300005366 Bacteria 2050
39 Ga0070663_100001005 3300005455 Bacteria 15372
40 Ga0070662_100098093 3300005457 Bacteria 2212
41 Ga0068867_100046529 3300005459 Bacteria 3187
42 Ga0070698_100012253 3300005471 Bacteria 9084
43 Ga0070698_100062477 3300005471 Bacteria 3757
44 Ga0070704_100002235 3300005549 Bacteria 10801
45 Ga0068855_100007810 3300005563 Bacteria 12920
46 Ga0068855_100016915 3300005563 Bacteria 8769
47 Ga0068855_100247486 3300005563 Bacteria 1989
48 Ga0068856_100037646 3300005614 Bacteria 4747
49 Ga0068852_100001737 3300005616 Bacteria 14834
50 Ga0068859_100073719 3300005617 Bacteria 3452
51 Ga0068861_100053585 3300005719 Bacteria 3070
52 Ga0075364_10003171 3300006051 Bacteria 9309
53 Ga0075364_10019359 3300006051 Bacteria 4272
54 Ga0097621_100074595 3300006237 Bacteria 2810
55 Ga0075428_100189154 3300006844 Bacteria 2227
56 Ga0075431_100075589 3300006847 Bacteria 3476
57 Ga0075429_100003181 3300006880 Bacteria 13959
58 Ga0097620_100073718 3300006931 Bacteria 3452
59 Ga0105244_10003810 3300009036 Bacteria 10640
60 Ga0105244_10018527 3300009036 Bacteria 3904
61 Ga0105244_10031445 3300009036 Bacteria 2817
62 Ga0105240_10000849 3300009093 Bacteria 55063
63 Ga0105240_10068760 3300009093 Bacteria 4386
64 Ga0105240_10084908 3300009093 Bacteria 3880
65 Ga0105243_10004131 3300009148 Bacteria 11546
66 Ga0105238_10000107 3300009551 Bacteria 91765
67 Ga0105238_10018714 3300009551 Bacteria 7054
68 Ga0105239_10001202 3300010375 Bacteria 35405
69 Ga0105239_10161116 3300010375 Bacteria 2506
70 Ga0157378_10233919 3300013297 Bacteria 1752
71 Ga0163162_10281539 3300013306 Bacteria 1795
72 Ga0182008_10000141 3300014497 Bacteria 55405
73 Ga0157379_10069884 3300014968 Bacteria 3141
74 Ga0182006_1000002 3300015261 Bacteria 887990
75 Ga0182006_1000231 3300015261 Bacteria 52984
76 Ga0182007_10000176 3300015262 Bacteria 43571
77 Ga0182007_10008818 3300015262 Bacteria 4113
78 Ga0182007_10012212 3300015262 Bacteria 3313
79 Ga0182005_1000002 3300015265 Bacteria 908499
80 Ga0182005_1000037 3300015265 Bacteria 166102
81 Ga0163161_10018775 3300017792 Bacteria 4847
82 Ga0213872_10027628 3300021361 Bacteria 2603
83 Ga0209435_100094 3300025206 Bacteria 39577
84 Ga0209760_101828 3300025207 Bacteria 2109
85 Ga0209436_100444 3300025208 Bacteria 18573
86 Ga0209784_100018 3300025224 Bacteria 456816
87 Ga0209784_100019 3300025224 Bacteria 453558
88 Ga0209566_100016 3300025225 Bacteria 456824
89 Ga0209566_100017 3300025225 Bacteria 453558
90 Ga0209674_100030 3300025226 Bacteria 456824
91 Ga0209674_100031 3300025226 Bacteria 453558
92 Ga0209672_100083 3300025228 Bacteria 135473
93 Ga0209147_100097 3300025229 Bacteria 164034
94 Ga0209147_100244 3300025229 Bacteria 53002
95 Ga0209563_100015 3300025230 Bacteria 879901
96 Ga0209563_100034 3300025230 Bacteria 456824
97 Ga0209563_100035 3300025230 Bacteria 453558
98 Ga0207427_100315 3300025231 Bacteria 32969
99 Ga0209437_100038 3300025233 Bacteria 453558
100 Ga0209437_100372 3300025233 Bacteria 45954
101 Ga0209258_100192 3300025242 Bacteria 125565
102 Ga0209258_100405 3300025242 Bacteria 53002
103 Ga0207425_1000206 3300025245 Bacteria 46827
104 Ga0207425_1000455 3300025245 Bacteria 26503
105 Ga0207425_1008631 3300025245 Bacteria 2590
106 Ga0209646_1000051 3300025246 Bacteria 296525
107 Ga0209646_1000103 3300025246 Bacteria 164034
108 Ga0209646_1000398 3300025246 Bacteria 25972
109 Ga0209026_1000134 3300025250 Bacteria 117098
110 Ga0209026_1001208 3300025250 Bacteria 11962
111 Ga0209677_100019 3300025253 Bacteria 456824
112 Ga0209677_100020 3300025253 Bacteria 453558
113 Ga0209148_1002102 3300025254 Bacteria 7539
114 Ga0209759_1000091 3300025256 Bacteria 164034
115 Ga0209759_1001694 3300025256 Bacteria 11470
116 Ga0209129_1002558 3300025258 Bacteria 8783
117 Ga0209233_1000049 3300025261 Bacteria 453558
118 Ga0209565_1000409 3300025263 Bacteria 35731
119 Ga0209565_1001081 3300025263 Bacteria 13611
120 Ga0209565_1001547 3300025263 Bacteria 9872
121 Ga0209455_1000031 3300025272 Bacteria 519952
122 Ga0209455_1000319 3300025272 Bacteria 47809
123 Ga0209673_1000070 3300025273 Bacteria 241592
124 Ga0209673_1007285 3300025273 Bacteria 5136
125 Ga0209130_1001176 3300025284 Bacteria 18705
126 Ga0209025_1020414 3300025294 Bacteria 3627
127 Ga0209564_1000011 3300025295 Bacteria 822327
128 Ga0209564_1000088 3300025295 Bacteria 250268
129 Ga0209564_1002008 3300025295 Bacteria 17763
130 Ga0209564_1005237 3300025295 Bacteria 7501
131 Ga0209758_1000286 3300025297 Bacteria 99636
132 Ga0209050_1001107 3300025298 Bacteria 32660
133 Ga0209256_1000305 3300025299 Bacteria 85970
134 Ga0209256_1019316 3300025299 Bacteria 2174
135 Ga0207426_1001340 3300025302 Bacteria 20920
136 Ga0209257_1002702 3300025304 Bacteria 16913
137 Ga0207656_10023693 3300025321 Bacteria 2475
138 Ga0207655_1020182 3300025728 Bacteria 3438
139 Ga0207705_10004503 3300025909 Bacteria 10528
140 Ga0207705_10119871 3300025909 Bacteria 1951
141 Ga0207695_10001362 3300025913 Bacteria 41437
142 Ga0207695_10009442 3300025913 Bacteria 12064
143 Ga0207695_10014244 3300025913 Bacteria 9432
144 Ga0207695_10032419 3300025913 Bacteria 5717
145 Ga0207671_10001336 3300025914 Bacteria 28835
146 Ga0207671_10115751 3300025914 Bacteria 2044
147 Ga0207657_10000018 3300025919 Bacteria 172140
148 Ga0207657_10003571 3300025919 Bacteria 16598
149 Ga0207681_10038438 3300025923 Bacteria 3171
150 Ga0207694_10000130 3300025924 Bacteria 77624
151 Ga0207694_10021321 3300025924 Bacteria 4909
152 Ga0207650_10109992 3300025925 Bacteria 2132
153 Ga0207690_10000006 3300025932 Bacteria 433880
154 Ga0207706_10093201 3300025933 Bacteria 2649
155 Ga0207709_10019928 3300025935 Bacteria 3779
156 Ga0207679_10109693 3300025945 Bacteria 2175
157 Ga0207667_10002863 3300025949 Bacteria 21405
158 Ga0207667_10004521 3300025949 Bacteria 17039
159 Ga0207667_10007640 3300025949 Bacteria 12950
160 Ga0207667_10035111 3300025949 Bacteria 5380
161 Ga0207640_10006511 3300025981 Bacteria 6412
162 Ga0207678_10000110 3300026067 Bacteria 67527
163 Ga0207678_10085277 3300026067 Bacteria 2700
164 Ga0207648_10017616 3300026089 Bacteria 6488
165 Ga0207648_10061128 3300026089 Bacteria 3285
166 Ga0207674_10052685 3300026116 Bacteria 4149
167 Ga0207675_100075156 3300026118 Bacteria 3162
168 Ga0207683_10154839 3300026121 Bacteria 2070
169 Ga0207698_10002326 3300026142 Bacteria 11254
170 Ga0268256_1006510 3300030500 Bacteria 4329
171 Ga0265327_10019291 3300031251 Bacteria 4197
172 Ga0307408_100000352 3300031548 Bacteria 43033
173 Ga0307408_100000521 3300031548 Bacteria 33246
174 Ga0307408_100031036 3300031548 Bacteria 3716
175 Ga0307410_10061123 3300031852 Bacteria 2577
176 Ga0307412_10004027 3300031911 Bacteria 8188
177 Ga0307416_100058623 3300032002 Bacteria 3123
178 Ga0395899_0000637 3300037312 Bacteria 36229
179 Ga0395899_0002108 3300037312 Bacteria 16341
180 Ga0395899_0005393 3300037312 Bacteria 9936
181 Ga0395899_0019864 3300037312 Bacteria 5098
182 Ga0395899_0044278 3300037312 Bacteria 3317
183 Ga0395900_0000252 3300037418 Bacteria 83358
184 Ga0395900_0001209 3300037418 Bacteria 31961
185 Ga0395900_0001610 3300037418 Bacteria 26610
186 Ga0395900_0008082 3300037418 Bacteria 10830
187 Ga0395900_0040663 3300037418 Bacteria 4791
188 Ga0395900_0232033 3300037418 Bacteria 1855
189 Ga0395898_0004624 3300037466 Bacteria 15023
190 Ga0395905_0000455 3300037471 Bacteria 57161
191 Ga0395905_0044743 3300037471 Bacteria 4153
192 Ga0395905_0094786 3300037471 Bacteria 2800
193 Ga0395901_0000347 3300038443 Bacteria 56485
194 Ga0395901_0000963 3300038443 Bacteria 31334
195 Ga0395901_0000967 3300038443 Bacteria 31229
196 Ga0395901_0003504 3300038443 Bacteria 15808
197 Ga0395901_0023068 3300038443 Bacteria 6378
198 Ga0395901_0057820 3300038443 Bacteria 4033
199 Ga0436361_0410326 3300039447 Bacteria 8736
200 Ga0466972_0000070 3300044658 Bacteria 100242
201 Ga0466965_0003602 3300044683 Bacteria 6818
202 Ga0466966_0036472 3300044684 Bacteria 3174
203 Ga0466964_0000224 3300044706 Bacteria 16209
204 Ga0466964_0008153 3300044706 Bacteria 3932
205 Ga0466964_0032295 3300044706 Bacteria 2079
206 Ga0466968_0005095 3300044735 Bacteria 4918
207 Ga0466957_0015317 3300044842 Bacteria 4479
208 Ga0466959_0081467 3300045049 Bacteria 2332
209 Ga0451576_0000609 3300045051 Bacteria 75538
210 Ga0466958_0081274 3300045836 Bacteria 1994
211 Ga0495617_000096 3300046452 Bacteria 62625
212 Ga0495627_000059 3300046453 Bacteria 142466
213 Ga0495590_0000002 3300046457 Bacteria 485720
214 Ga0495638_0000367 3300046460 Bacteria 55964
215 Ga0495638_0001765 3300046460 Bacteria 18944
216 Ga0495638_0068717 3300046460 Bacteria 2172
217 Ga0495650_0000015 3300046471 Bacteria 557595
218 Ga0495650_0000019 3300046471 Bacteria 533849
219 Ga0495650_0000276 3300046471 Bacteria 98048
220 Ga0495650_0000530 3300046471 Bacteria 55501
221 Ga0495650_0001558 3300046471 Bacteria 21622
222 Ga0495650_0027614 3300046471 Bacteria 2619
223 Ga0495580_0002192 3300046472 Bacteria 17092
224 Ga0495605_0000023 3300046474 Bacteria 236732
225 Ga0495605_0000063 3300046474 Bacteria 140789
226 Ga0495605_0001219 3300046474 Bacteria 17121
227 Ga0495584_0000788 3300046491 Bacteria 20907
228 Ga0495584_0002034 3300046491 Bacteria 11628
229 Ga0495584_0027326 3300046491 Bacteria 2891
230 Ga0495585_0040430 3300046492 Bacteria 2618
231 Ga0495585_0052383 3300046492 Bacteria 2259
232 Ga0495596_0000088 3300046500 Bacteria 64229
233 Ga0495607_0000300 3300046501 Bacteria 51872
234 Ga0495607_0004194 3300046501 Bacteria 10702
235 Ga0495607_0004779 3300046501 Bacteria 9894
236 Ga0495607_0007716 3300046501 Bacteria 7408
237 Ga0495607_0015885 3300046501 Bacteria 4869
238 Ga0495607_0022889 3300046501 Bacteria 3918
239 Ga0495583_0000016 3300046506 Bacteria 312691
240 Ga0495583_0000106 3300046506 Bacteria 140932
241 Ga0495583_0000404 3300046506 Bacteria 65523
242 Ga0495583_0001717 3300046506 Bacteria 21041
243 Ga0495606_0000001 3300046507 Bacteria 592123
244 Ga0495606_0000089 3300046507 Bacteria 154743
245 Ga0495606_0000526 3300046507 Bacteria 61953
246 Ga0495606_0003493 3300046507 Bacteria 16645
247 Ga0495606_0005324 3300046507 Bacteria 12372
248 Ga0495606_0005973 3300046507 Bacteria 11420
249 Ga0495606_0016928 3300046507 Bacteria 5534
250 Ga0495606_0077293 3300046507 Bacteria 2078
251 Ga0495608_0023013 3300046511 Bacteria 4272
252 Ga0495610_0000106 3300046512 Bacteria 97582
253 Ga0495610_0003952 3300046512 Bacteria 11224
254 Ga0495610_0009664 3300046512 Bacteria 6071
255 Ga0495610_0021686 3300046512 Bacteria 3526
256 Ga0495610_0038863 3300046512 Bacteria 2411
257 Ga0495610_0041892 3300046512 Bacteria 2294
258 Ga0495616_0000111 3300046513 Bacteria 71395
259 Ga0495616_0031696 3300046513 Bacteria 2766
260 Ga0495628_0001262 3300046516 Bacteria 23180
261 Ga0495628_0046192 3300046516 Bacteria 3459
262 Ga0495632_0002784 3300046519 Bacteria 12967
263 Ga0495637_0001337 3300046520 Bacteria 14795
264 Ga0495643_0000312 3300046522 Bacteria 67022
265 Ga0495643_0013623 3300046522 Bacteria 4860
266 Ga0495643_0013971 3300046522 Bacteria 4786
267 Ga0495643_0037697 3300046522 Bacteria 2649
268 Ga0495644_0000339 3300046523 Bacteria 21282
269 Ga0495644_0006983 3300046523 Bacteria 4370
270 Ga0495648_0000037 3300046524 Bacteria 195401
271 Ga0495648_0000384 3300046524 Bacteria 48550
272 Ga0495648_0009791 3300046524 Bacteria 7374
273 Ga0495648_0024390 3300046524 Bacteria 4121
274 Ga0495642_0012554 3300046528 Bacteria 3264
275 Ga0495642_0037674 3300046528 Bacteria 1957
276 Ga0495654_0000015 3300046530 Bacteria 307873
277 Ga0495654_0009030 3300046530 Bacteria 5472
278 Ga0495609_0000002 3300046538 Bacteria 739816
279 Ga0495609_0000110 3300046538 Bacteria 96998
280 Ga0495609_0000334 3300046538 Bacteria 41567
281 Ga0495609_0000431 3300046538 Bacteria 34849
282 Ga0495609_0001009 3300046538 Bacteria 20017
283 Ga0495597_0000874 3300046542 Bacteria 23420
284 Ga0495597_0026319 3300046542 Bacteria 2672
285 Ga0495645_0009956 3300046543 Bacteria 6655
286 Ga0495622_0000262 3300046557 Bacteria 40195
287 Ga0495622_0036464 3300046557 Bacteria 2292
288 Ga0495633_0000244 3300046558 Bacteria 65398
289 Ga0495633_0000334 3300046558 Bacteria 52747
290 Ga0495633_0000433 3300046558 Bacteria 43302
291 Ga0495633_0020963 3300046558 Bacteria 3276
292 Ga0495668_0000241 3300046616 Bacteria 78040
293 Ga0495668_0001687 3300046616 Bacteria 20430
294 Ga0495668_0003228 3300046616 Bacteria 12435
295 Ga0495668_0025647 3300046616 Bacteria 3348
296 Ga0495668_0043681 3300046616 Bacteria 2491
297 Ga0495611_0001508 3300046648 Bacteria 11493
298 Ga0495625_0004027 3300046660 Bacteria 14054
299 Ga0495625_0014730 3300046660 Bacteria 6225
300 Ga0495625_0026803 3300046660 Bacteria 4348
301 Ga0495625_0044519 3300046660 Bacteria 3213
302 Ga0495625_0053799 3300046660 Bacteria 2877
303 Ga0495625_0064474 3300046660 Bacteria 2584
304 Ga0495625_0067034 3300046660 Bacteria 2527
305 Ga0495625_0075879 3300046660 Bacteria 2351
306 Ga0495659_0000461 3300046664 Bacteria 15185
307 Ga0495659_0002589 3300046664 Bacteria 5832
308 Ga0495659_0009678 3300046664 Bacteria 3081
309 Ga0495661_0000183 3300046665 Bacteria 72020
310 Ga0495661_0000750 3300046665 Bacteria 31507
311 Ga0495661_0008687 3300046665 Bacteria 7019
312 Ga0495661_0010477 3300046665 Bacteria 6324
313 Ga0495661_0037645 3300046665 Bacteria 3018
314 Ga0495588_0000127 3300046674 Bacteria 125854
315 Ga0495646_0056178 3300046680 Bacteria 2361
316 Ga0495669_0015364 3300046684 Bacteria 3279
317 Ga0495671_0000006 3300046692 Bacteria 500471
318 Ga0495671_0000793 3300046692 Bacteria 22658
319 Ga0495671_0001937 3300046692 Bacteria 13276
320 Ga0495671_0026972 3300046692 Bacteria 2971
321 Ga0495649_0026256 3300046694 Bacteria 3241
322 Ga0495649_0046757 3300046694 Bacteria 2356
323 Ga0495649_0056256 3300046694 Bacteria 2124
324 Ga0495589_0000083 3300046794 Bacteria 87058
325 Ga0495589_0001488 3300046794 Bacteria 13479
326 Ga0495660_0000365 3300046810 Bacteria 39810
327 Ga0495660_0000625 3300046810 Bacteria 27722
328 Ga0495660_0000907 3300046810 Bacteria 21873
329 Ga0495660_0024489 3300046810 Bacteria 3437
330 Ga0495660_0031957 3300046810 Bacteria 2957
331 Ga0495636_0000252 3300047318 Bacteria 21169
332 Ga0495636_0021670 3300047318 Bacteria 2595
333 Ga0495672_0000159 3300047320 Bacteria 98262
334 Ga0495672_0027342 3300047320 Bacteria 3626
335 Ga0495672_0041415 3300047320 Bacteria 2785
336 Ga0495683_0004311 3300047323 Bacteria 8108
337 Ga0495683_0024687 3300047323 Bacteria 3084
338 Ga0495683_0027756 3300047323 Bacteria 2894
339 Ga0495683_0035473 3300047323 Bacteria 2535
340 Ga0495687_000075 3300047443 Bacteria 152218
341 Ga0495687_000197 3300047443 Bacteria 86694
342 Ga0495687_000281 3300047443 Bacteria 66974
343 Ga0495687_000701 3300047443 Bacteria 37406
344 Ga0495687_001598 3300047443 Bacteria 20448
345 Ga0495687_021032 3300047443 Bacteria 3168
346 Ga0495687_038789 3300047443 Bacteria 2111
347 Ga0495677_0000030 3300047445 Bacteria 87817
348 Ga0495677_0000230 3300047445 Bacteria 25473
349 Ga0495677_0013764 3300047445 Bacteria 2944
350 Ga0495679_001504 3300047446 Bacteria 13174
351 Ga0495679_020563 3300047446 Bacteria 2296
352 Ga0495685_000057 3300047447 Bacteria 41679
353 Ga0495673_0000003 3300047469 Bacteria 1491337
354 Ga0495673_0000061 3300047469 Bacteria 230647
355 Ga0495673_0000351 3300047469 Bacteria 57305
356 Ga0495681_0015909 3300047470 Bacteria 4244
357 Ga0495686_0000321 3300047472 Bacteria 79813
358 Ga0495686_0026700 3300047472 Bacteria 3777
359 Ga0495602_0088775 3300048088 Bacteria 2572
360 Ga0495626_0000111 3300048091 Bacteria 105401
361 Ga0495626_0001501 3300048091 Bacteria 18401
362 Ga0495626_0005215 3300048091 Bacteria 7692
363 Ga0495626_0008949 3300048091 Bacteria 5434
364 Ga0496103_0023805 3300048906 Bacteria 3693
365 Ga0496104_0093460 3300048907 Bacteria 2877
366 Ga0496106_0002714 3300048909 Bacteria 13113
367 Ga0496108_0087895 3300048911 Bacteria 2640
368 Ga0496109_0025707 3300048912 Bacteria 5248
369 Ga0496110_0025065 3300048913 Bacteria 5092
370 Ga0496111_0049700 3300048914 Bacteria 3024
371 Ga0496111_0061902 3300048914 Bacteria 2713
372 Ga0496112_0157894 3300048915 Bacteria 2235
373 Ga0496114_0096458 3300048917 Bacteria 2518
374 Ga0496116_0007298 3300048919 Bacteria 9843
375 Ga0496117_0000001 3300048920 Bacteria 2526244
376 Ga0496118_0000002 3300048921 Bacteria 1690764
377 Ga0496121_0000684 3300048924 Bacteria 63147
378 Ga0496121_0003774 3300048924 Bacteria 21160
379 Ga0496121_0015920 3300048924 Bacteria 7811
380 Ga0496122_0000701 3300048925 Bacteria 66268
381 Ga0496122_0002235 3300048925 Bacteria 28137
382 Ga0496122_0003287 3300048925 Bacteria 21411
383 Ga0496122_0022841 3300048925 Bacteria 5541
384 Ga0496122_0095979 3300048925 Bacteria 2001
385 Ga0496122_0104566 3300048925 Bacteria 1881
386 Ga0496123_0004113 3300048926 Bacteria 15595
387 Ga0496123_0054077 3300048926 Bacteria 2646
388 Ga0496123_0073254 3300048926 Bacteria 2125
389 Ga0496124_0000007 3300048927 Bacteria 883534
390 Ga0496124_0108500 3300048927 Bacteria 2238
391 Ga0496124_0149777 3300048927 Bacteria 1832
392 Ga0496125_0000554 3300048928 Bacteria 64336
393 Ga0496125_0040163 3300048928 Bacteria 4016
394 Ga0496125_0054590 3300048928 Bacteria 3263
395 Ga0496125_0069070 3300048928 Bacteria 2774
396 Ga0496126_0044292 3300048929 Bacteria 4099
397 Ga0495678_000030 3300049459 Bacteria 217986
398 Ga0495678_000905 3300049459 Bacteria 26145
399 Ga0495678_001619 3300049459 Bacteria 17175
400 Ga0495678_004565 3300049459 Bacteria 7965
401 Ga0495678_006345 3300049459 Bacteria 6305
402 Ga0495682_0000408 3300049460 Bacteria 30679
403 Ga0495682_0027452 3300049460 Bacteria 2111
404 Ga0501033_0048979 3300049570 Bacteria 3137
405 Ga0501033_0058075 3300049570 Bacteria 2859
406 Ga0501034_0001318 3300049571 Bacteria 33588
407 Ga0501039_0084692 3300049575 Bacteria 2469
408 Ga0501041_0005223 3300049577 Bacteria 7583
409 Ga0501042_0029726 3300049578 Bacteria 3854
410 Ga0501046_0080434 3300049580 Bacteria 2518
411 Ga0501047_0001745 3300049581 Bacteria 21067
412 Ga0501068_0005874 3300049584 Bacteria 6735
413 Ga0501070_0049440 3300049586 Bacteria 3492
414 Ga0501071_0077605 3300049587 Bacteria 2426
415 Ga0501072_0006553 3300049588 Bacteria 8867
416 Ga0501072_0089210 3300049588 Bacteria 2447
417 Ga0501073_0018946 3300049589 Bacteria 4973
418 Ga0501074_0074022 3300049590 Bacteria 2446
419 Ga0501079_0026148 3300049741 Bacteria 4475
420 Ga0501080_0003752 3300049742 Bacteria 13415
421 Ga0501080_0168511 3300049742 Bacteria 2021
422 Ga0501081_0006631 3300049743 Bacteria 7525
423 Ga0501081_0085738 3300049743 Bacteria 2211
424 Ga0501083_0090420 3300049744 Bacteria 2022
425 Ga0501035_0002263 3300049822 Bacteria 19027
426 Ga0501035_0004536 3300049822 Bacteria 13179
427 Ga0501044_0005080 3300049823 Bacteria 14681
428 Ga0501045_0004030 3300049824 Bacteria 10122
429 nmdc:mga05p37_5467_c1 3300050507 Bacteria 14916
430 nmdc:mga09592_525_c1 3300050508 Bacteria 28937
431 Ga0500595_012688 3300053119 Bacteria 3250
432 Ga0500618_000543 3300053125 Bacteria 23454
433 Ga0500586_000310 3300053145 Bacteria 9716
434 Ga0501084_0033378 3300054114 Bacteria 4306
435 Ga0501084_0144691 3300054114 Bacteria 2002
436 Ga0501082_0001529 3300060353 Bacteria 20359
437 Ga0530510_0001545 3300061734 Bacteria 15520
438 2511250585 2511231003 Bacteria 5606035
439 2511387922 2511231026 Bacteria 5225445
440 2521560649 2521172590 Bacteria 5047645
441 2550697255 2548876994 Bacteria 4904866
442 2553008017 2551306416 Bacteria 6152985
443 2601667733 2600255292 Bacteria 6300551
444 2643789781 2643221554 Bacteria 6603920
445 2643863974 2643221569 Bacteria 6064337
446 2643982510 2643221594 Bacteria 5811388
447 2644026680 2643221603 Bacteria 6147767
448 2644121480 2643221621 Bacteria 6212786
449 2644214495 2643221638 Bacteria 6579467
450 2644249706 2643221645 Bacteria 7207331
451 2644356274 2643221664 Bacteria 7272945
452 2738739081 2738541280 Bacteria 6630198
453 2738830183 2738541297 Bacteria 6549566
454 2738846314 2738541300 Bacteria 6675882
455 2739153979 2738541357 Bacteria 6549408
456 2739195899 2738543003 Bacteria 6549560
457 2739275037 2738543018 Bacteria 6718814
458 2739322375 2738543026 Bacteria 6549408
459 2739340616 2738543029 Bacteria 6549249
460 2739344081 2738543030 Bacteria 6719714
461 2739612291 2739367655 Bacteria 4051151
462 2765571897 2765235838 Bacteria 5445269
463 2808982104 2808606386 Bacteria 4471946
464 2809034622 2808606395 Bacteria 6020352
465 2809130095 2808606415 Bacteria 4576710
466 2809144459 2808606418 Bacteria 6724496
467 2809148850 2808606419 Bacteria 4576925
468 2819542492 2818991436 Bacteria 5376622
469 2819595333 2818991445 Bacteria 4955017
470 2819618820 2818991449 Bacteria 5518009
471 2839098379 2839094727 Bacteria 5534556
472 2842712650 2842711865 Bacteria 7155354
473 2852618983 2852618963 Bacteria 4577824
474 2857541786 2857537821 Bacteria 5248181
475 2857544338 2857542790 Bacteria 5326616
476 2857550238 2857547612 Bacteria 6179999
477 2857557648 2857553236 Bacteria 6166726
478 2857561020 2857558681 Bacteria 6617694
479 2857568460 2857564685 Bacteria 6290584
480 2857579885 2857576091 Bacteria 5465855
481 2858953724 2858950400 Bacteria 6783797
482 2884814128 2884811622 Bacteria 5552861
483 2884839283 2884836552 Bacteria 5219991
484 2884856907 2884852848 Bacteria 5221161
485 2885086287 2885080285 Bacteria 6355622
486 2896158253 2896154374 Bacteria 5221518
487 2904425452 2904424332 Bacteria 7633521
488 2904442967 2904439833 Bacteria 5931679
489 2904534825 2904530477 Bacteria 5876334
490 2904588846 2904584206 Bacteria 6028872
491 2904594081 2904589729 Bacteria 6113573
492 2904605075 2904601388 Bacteria 5884906
493 2919048526 2919046199 Bacteria 5567169
494 2919083307 2919079590 Bacteria 5946433
495 2919477296 2919476304 Bacteria 5888696
496 2923514456 2923510766 Bacteria 5926163
497 2928133164 2928130867 Bacteria 5467269
498 2932411346 2932410948 Bacteria 6312192
499 2932419087 2932416698 Bacteria 6315112
500 2941480356
501 8047677985 8047673197 Bacteria 7395230
502 nmdc:mga00v17_2889_c1
503 JGI25156J39149_1001146
504 JGI25162J39368_1000036
505 JGI25154J39366_1001169
506 JGI25158J39367_1000225
507 JGI25157J39369_1000796
508 JGI25159J45721_1000510
509 JGI25165J46597_1000022
510 rootL2_10012879
511 JGI25160J50197_1000744
512 JGI25161J50226_1000492
513 Ga0055538_1000011
514 Ga0055538_1000024
515 Ga0055539_1000016
516 Ga0055539_1000031
517 Ga0055533_1000019
518 Ga0055533_1000041
519 Ga0055532_1000074
520 Ga0055525_1000009
521 Ga0055525_1000042
522 Ga0055525_1000049
523 Ga0055527_1000332
524 Ga0055529_1000015
525 Ga0055526_1000411
526 Ga0055526_1001905
527 Ga0055524_1001861
528 Ga0055524_1003528
529 Ga0055528_1005863
530 Ga0055530_10001104
531 Ga0055541_1000017
532 Ga0055541_1000022
533 Ga0055543_1000677
534 Ga0065165_1007648
535 Ga0065165_1015398
536 Ga0070658_10028826
537 Ga0070680_100136673
538 Ga0070659_100000014
539 Ga0070659_100129262
540 Ga0070663_100001005
541 Ga0070662_100098093
542 Ga0068867_100046529
543 Ga0070698_100012253
544 Ga0070698_100062477
545 Ga0070704_100002235
546 Ga0068855_100007810
547 Ga0068855_100016915
548 Ga0068855_100247486
549 Ga0068856_100037646
550 Ga0068852_100001737
551 Ga0068859_100073719
552 Ga0068861_100053585
553 Ga0075364_10003171
554 Ga0075364_10019359
555 Ga0097621_100074595
556 Ga0075428_100189154
557 Ga0075431_100075589
558 Ga0075429_100003181
559 Ga0097620_100073718
560 Ga0105244_10003810
561 Ga0105244_10018527
562 Ga0105244_10031445
563 Ga0105240_10000849
564 Ga0105240_10068760
565 Ga0105240_10084908
566 Ga0105243_10004131
567 Ga0105238_10000107
568 Ga0105238_10018714
569 Ga0105239_10001202
570 Ga0105239_10161116
571 Ga0157378_10233919
572 Ga0163162_10281539
573 Ga0182008_10000141
574 Ga0157379_10069884
575 Ga0182006_1000002
576 Ga0182006_1000231
577 Ga0182007_10000176
578 Ga0182007_10008818
579 Ga0182007_10012212
580 Ga0182005_1000002
581 Ga0182005_1000037
582 Ga0163161_10018775
583 Ga0213872_10027628
584 Ga0209435_100094
585 Ga0209760_101828
586 Ga0209436_100444
587 Ga0209784_100018
588 Ga0209784_100019
589 Ga0209566_100016
590 Ga0209566_100017
591 Ga0209674_100030
592 Ga0209674_100031
593 Ga0209672_100083
594 Ga0209147_100097
595 Ga0209147_100244
596 Ga0209563_100015
597 Ga0209563_100034
598 Ga0209563_100035
599 Ga0207427_100315
600 Ga0209437_100038
601 Ga0209437_100372
602 Ga0209258_100192
603 Ga0209258_100405
604 Ga0207425_1000206
605 Ga0207425_1000455
606 Ga0207425_1008631
607 Ga0209646_1000051
608 Ga0209646_1000103
609 Ga0209646_1000398
610 Ga0209026_1000134
611 Ga0209026_1001208
612 Ga0209677_100019
613 Ga0209677_100020
614 Ga0209148_1002102
615 Ga0209759_1000091
616 Ga0209759_1001694
617 Ga0209129_1002558
618 Ga0209233_1000049
619 Ga0209565_1000409
620 Ga0209565_1001081
621 Ga0209565_1001547
622 Ga0209455_1000031
623 Ga0209455_1000319
624 Ga0209673_1000070
625 Ga0209673_1007285
626 Ga0209130_1001176
627 Ga0209025_1020414
628 Ga0209564_1000011
629 Ga0209564_1000088
630 Ga0209564_1002008
631 Ga0209564_1005237
632 Ga0209758_1000286
633 Ga0209050_1001107
634 Ga0209256_1000305
635 Ga0209256_1019316
636 Ga0207426_1001340
637 Ga0209257_1002702
638 Ga0207656_10023693
639 Ga0207655_1020182
640 Ga0207705_10004503
641 Ga0207705_10119871
642 Ga0207695_10001362
643 Ga0207695_10009442
644 Ga0207695_10014244
645 Ga0207695_10032419
646 Ga0207671_10001336
647 Ga0207671_10115751
648 Ga0207657_10000018
649 Ga0207657_10003571
650 Ga0207681_10038438
651 Ga0207694_10000130
652 Ga0207694_10021321
653 Ga0207650_10109992
654 Ga0207690_10000006
655 Ga0207706_10093201
656 Ga0207709_10019928
657 Ga0207679_10109693
658 Ga0207667_10002863
659 Ga0207667_10004521
660 Ga0207667_10007640
661 Ga0207667_10035111
662 Ga0207640_10006511
663 Ga0207678_10000110
664 Ga0207678_10085277
665 Ga0207648_10017616
666 Ga0207648_10061128
667 Ga0207674_10052685
668 Ga0207675_100075156
669 Ga0207683_10154839
670 Ga0207698_10002326
671 Ga0268256_1006510
672 Ga0265327_10019291
673 Ga0307408_100000352
674 Ga0307408_100000521
675 Ga0307408_100031036
676 Ga0307410_10061123
677 Ga0307412_10004027
678 Ga0307416_100058623
679 Ga0395899_0000637
680 Ga0395899_0002108
681 Ga0395899_0005393
682 Ga0395899_0019864
683 Ga0395899_0044278
684 Ga0395900_0000252
685 Ga0395900_0001209
686 Ga0395900_0001610
687 Ga0395900_0008082
688 Ga0395900_0040663
689 Ga0395900_0232033
690 Ga0395898_0004624
691 Ga0395905_0000455
692 Ga0395905_0044743
693 Ga0395905_0094786
694 Ga0395901_0000347
695 Ga0395901_0000963
696 Ga0395901_0000967
697 Ga0395901_0003504
698 Ga0395901_0023068
699 Ga0395901_0057820
700 Ga0436361_0410326
701 Ga0466972_0000070
702 Ga0466965_0003602
703 Ga0466966_0036472
704 Ga0466964_0000224
705 Ga0466964_0008153
706 Ga0466964_0032295
707 Ga0466968_0005095
708 Ga0466957_0015317
709 Ga0466959_0081467
710 Ga0451576_0000609
711 Ga0466958_0081274
712 Ga0495617_000096
713 Ga0495627_000059
714 Ga0495590_0000002
715 Ga0495638_0000367
716 Ga0495638_0001765
717 Ga0495638_0068717
718 Ga0495650_0000015
719 Ga0495650_0000019
720 Ga0495650_0000276
721 Ga0495650_0000530
722 Ga0495650_0001558
723 Ga0495650_0027614
724 Ga0495580_0002192
725 Ga0495605_0000023
726 Ga0495605_0000063
727 Ga0495605_0001219
728 Ga0495584_0000788
729 Ga0495584_0002034
730 Ga0495584_0027326
731 Ga0495585_0040430
732 Ga0495585_0052383
733 Ga0495596_0000088
734 Ga0495607_0000300
735 Ga0495607_0004194
736 Ga0495607_0004779
737 Ga0495607_0007716
738 Ga0495607_0015885
739 Ga0495607_0022889
740 Ga0495583_0000016
741 Ga0495583_0000106
742 Ga0495583_0000404
743 Ga0495583_0001717
744 Ga0495606_0000001
745 Ga0495606_0000089
746 Ga0495606_0000526
747 Ga0495606_0003493
748 Ga0495606_0005324
749 Ga0495606_0005973
750 Ga0495606_0016928
751 Ga0495606_0077293
752 Ga0495608_0023013
753 Ga0495610_0000106
754 Ga0495610_0003952
755 Ga0495610_0009664
756 Ga0495610_0021686
757 Ga0495610_0038863
758 Ga0495610_0041892
759 Ga0495616_0000111
760 Ga0495616_0031696
761 Ga0495628_0001262
762 Ga0495628_0046192
763 Ga0495632_0002784
764 Ga0495637_0001337
765 Ga0495643_0000312
766 Ga0495643_0013623
767 Ga0495643_0013971
768 Ga0495643_0037697
769 Ga0495644_0000339
770 Ga0495644_0006983
771 Ga0495648_0000037
772 Ga0495648_0000384
773 Ga0495648_0009791
774 Ga0495648_0024390
775 Ga0495642_0012554
776 Ga0495642_0037674
777 Ga0495654_0000015
778 Ga0495654_0009030
779 Ga0495609_0000002
780 Ga0495609_0000110
781 Ga0495609_0000334
782 Ga0495609_0000431
783 Ga0495609_0001009
784 Ga0495597_0000874
785 Ga0495597_0026319
786 Ga0495645_0009956
787 Ga0495622_0000262
788 Ga0495622_0036464
789 Ga0495633_0000244
790 Ga0495633_0000334
791 Ga0495633_0000433
792 Ga0495633_0020963
793 Ga0495668_0000241
794 Ga0495668_0001687
795 Ga0495668_0003228
796 Ga0495668_0025647
797 Ga0495668_0043681
798 Ga0495611_0001508
799 Ga0495625_0004027
800 Ga0495625_0014730
801 Ga0495625_0026803
802 Ga0495625_0044519
803 Ga0495625_0053799
804 Ga0495625_0064474
805 Ga0495625_0067034
806 Ga0495625_0075879
807 Ga0495659_0000461
808 Ga0495659_0002589
809 Ga0495659_0009678
810 Ga0495661_0000183
811 Ga0495661_0000750
812 Ga0495661_0008687
813 Ga0495661_0010477
814 Ga0495661_0037645
815 Ga0495588_0000127
816 Ga0495646_0056178
817 Ga0495669_0015364
818 Ga0495671_0000006
819 Ga0495671_0000793
820 Ga0495671_0001937
821 Ga0495671_0026972
822 Ga0495649_0026256
823 Ga0495649_0046757
824 Ga0495649_0056256
825 Ga0495589_0000083
826 Ga0495589_0001488
827 Ga0495660_0000365
828 Ga0495660_0000625
829 Ga0495660_0000907
830 Ga0495660_0024489
831 Ga0495660_0031957
832 Ga0495636_0000252
833 Ga0495636_0021670
834 Ga0495672_0000159
835 Ga0495672_0027342
836 Ga0495672_0041415
837 Ga0495683_0004311
838 Ga0495683_0024687
839 Ga0495683_0027756
840 Ga0495683_0035473
841 Ga0495687_000075
842 Ga0495687_000197
843 Ga0495687_000281
844 Ga0495687_000701
845 Ga0495687_001598
846 Ga0495687_021032
847 Ga0495687_038789
848 Ga0495677_0000030
849 Ga0495677_0000230
850 Ga0495677_0013764
851 Ga0495679_001504
852 Ga0495679_020563
853 Ga0495685_000057
854 Ga0495673_0000003
855 Ga0495673_0000061
856 Ga0495673_0000351
857 Ga0495681_0015909
858 Ga0495686_0000321
859 Ga0495686_0026700
860 Ga0495602_0088775
861 Ga0495626_0000111
862 Ga0495626_0001501
863 Ga0495626_0005215
864 Ga0495626_0008949
865 Ga0496103_0023805
866 Ga0496104_0093460
867 Ga0496106_0002714
868 Ga0496108_0087895
869 Ga0496109_0025707
870 Ga0496110_0025065
871 Ga0496111_0049700
872 Ga0496111_0061902
873 Ga0496112_0157894
874 Ga0496114_0096458
875 Ga0496116_0007298
876 Ga0496117_0000001
877 Ga0496118_0000002
878 Ga0496121_0000684
879 Ga0496121_0003774
880 Ga0496121_0015920
881 Ga0496122_0000701
882 Ga0496122_0002235
883 Ga0496122_0003287
884 Ga0496122_0022841
885 Ga0496122_0095979
886 Ga0496122_0104566
887 Ga0496123_0004113
888 Ga0496123_0054077
889 Ga0496123_0073254
890 Ga0496124_0000007
891 Ga0496124_0108500
892 Ga0496124_0149777
893 Ga0496125_0000554
894 Ga0496125_0040163
895 Ga0496125_0054590
896 Ga0496125_0069070
897 Ga0496126_0044292
898 Ga0495678_000030
899 Ga0495678_000905
900 Ga0495678_001619
901 Ga0495678_004565
902 Ga0495678_006345
903 Ga0495682_0000408
904 Ga0495682_0027452
905 Ga0501033_0048979
906 Ga0501033_0058075
907 Ga0501034_0001318
908 Ga0501039_0084692
909 Ga0501041_0005223
910 Ga0501042_0029726
911 Ga0501046_0080434
912 Ga0501047_0001745
913 Ga0501068_0005874
914 Ga0501070_0049440
915 Ga0501071_0077605
916 Ga0501072_0006553
917 Ga0501072_0089210
918 Ga0501073_0018946
919 Ga0501074_0074022
920 Ga0501079_0026148
921 Ga0501080_0003752
922 Ga0501080_0168511
923 Ga0501081_0006631
924 Ga0501081_0085738
925 Ga0501083_0090420
926 Ga0501035_0002263
927 Ga0501035_0004536
928 Ga0501044_0005080
929 Ga0501045_0004030
930 nmdc:mga05p37_5467_c1
931 nmdc:mga09592_525_c1
932 Ga0500595_012688
933 Ga0500618_000543
934 Ga0500586_000310
935 Ga0501084_0033378
936 Ga0501084_0144691
937 Ga0501082_0001529
938 Ga0530510_0001545
939 2511250585
940 2511387922
941 2521560649
942 2550697255
943 2553008017
944 2601667733
945 2643789781
946 2643863974
947 2643982510
948 2644026680
949 2644121480
950 2644214495
951 2644249706
952 2644356274
953 2738739081
954 2738830183
955 2738846314
956 2739153979
957 2739195899
958 2739275037
959 2739322375
960 2739340616
961 2739344081
962 2739612291
963 2765571897
964 2808982104
965 2809034622
966 2809130095
967 2809144459
968 2809148850
969 2819542492
970 2819595333
971 2819618820
972 2839098379
973 2842712650
974 2852618983
975 2857541786
976 2857544338
977 2857550238
978 2857557648
979 2857561020
980 2857568460
981 2857579885
982 2858953724
983 2884814128
984 2884839283
985 2884856907
986 2885086287
987 2896158253
988 2904425452
989 2904442967
990 2904534825
991 2904588846
992 2904594081
993 2904605075
994 2919048526
995 2919083307
996 2919477296
997 2923514456
998 2928133164
999 2932411346
1000 2932419087
1001 2941480356
1002 8047677985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

236

507

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t8y-assembly2.cif.gz_B structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. 0.6148 111 167
5t8y-assembly1.cif.gz_A structure of epoxyqueuosine reductase from bacillus subtilis with the asp134 catalytic loop swung out of the active site. 0.5384 101 167
6nt1-assembly1.cif.gz_A catalase 3 from n.crassa in ferrous state (2.89 mgy) 0.4241 108 178
6nsw-assembly1.cif.gz_D x-ray reduced catalase 3 from n.crassa in cpd i state (0.135 mgy) 0.4221 108 178
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.3806 202 428
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7672 206 479 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.744 206 479 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6508 209 480 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6431 209 480 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.64 209 482 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1F7QST7-F1-model_v4 ABC transporter permease 0.937 214 431 GO:0005886
GO:0006865
GO:0022857
AF-A0A257CZ98-F1-model_v4 deleted 0.9362 202 438
AF-A0A259S603-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9291 199 415 GO:0005886
GO:0006865
GO:0022857
AF-A0A522SA66-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9272 199 406 GO:0005886
GO:0006865
GO:0022857
AF-A0A1F7QST7-F1-model_v4 ABC transporter permease 0.9239 214 431 GO:0005886
GO:0006865
GO:0022857

Map