F455799

General Info

Members Datasets Scaffolds Average Seq Length
502 238 496 129

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100122224|Ga0070690_1001222242
Length 148
Sequence LKRSSSGRVLTFAVVNKYFKMRITFTSLLVDDQDKALKFYTNVLGFIKKTEIPMGKHKWLTVVSKEEQDGVELVLEPIAFEPAKVYQEELFKAGIPLTAFNVDDVDSEYERLVNLGVTFSMKPTEMGPTKLAVFSDTCGNNIQIFELL

Samples

Sample ID Description Type Environment
1 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
2 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
3 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
4 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
5 2928070936 Variovorax gossypii 1167 Isolate Unclassified
6 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
7 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
225 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
235 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
236 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 3.19
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10039003 3300003316 Unclassified 3494
2 rootH1_10039003 3300003323 Bacteria 2350
3 rootL2_10074260 3300003322 Bacteria 18154
4 rootH1_10034197 3300003323 Bacteria 19665
5 rootH1_10071419 3300003323 Bacteria 2314
6 Ga0065712_10190902 3300005290 Bacteria 1149
7 Ga0065707_10318459 3300005295 Bacteria 971
8 Ga0070658_10404778 3300005327 Bacteria 1172
9 Ga0070676_10005217 3300005328 Bacteria 6907
10 Ga0070676_10286009 3300005328 Unclassified 1113
11 Ga0070676_10294802 3300005328 Unclassified 1097
12 Ga0070683_100157311 3300005329 Bacteria 2156
13 Ga0070683_100298060 3300005329 Bacteria 1534
14 Ga0070690_100122224 3300005330 Bacteria 1748
15 Ga0070690_100173196 3300005330 Bacteria 1486
16 Ga0070690_100244489 3300005330 Bacteria 1267
17 Ga0070670_100043725 3300005331 Bacteria 3850
18 Ga0070670_100107374 3300005331 Bacteria 2406
19 Ga0070670_100215468 3300005331 Bacteria 1670
20 Ga0070670_100273613 3300005331 Bacteria 1474
21 Ga0070670_100305355 3300005331 Bacteria 1392
22 Ga0070670_100335359 3300005331 Unclassified 1327
23 Ga0070670_100431325 3300005331 Bacteria 1166
24 Ga0070670_100804839 3300005331 Bacteria 849
25 Ga0070677_10820656 3300005333 Bacteria 532
26 Ga0068869_100004070 3300005334 Bacteria 9050
27 Ga0068869_100035028 3300005334 Bacteria 3556
28 Ga0068869_100106052 3300005334 Bacteria 2132
29 Ga0068869_100177717 3300005334 Bacteria 1667
30 Ga0070666_10022917 3300005335 Bacteria 4061
31 Ga0070666_10039776 3300005335 Bacteria 3136
32 Ga0070666_10175843 3300005335 Unclassified 1501
33 Ga0070666_10234752 3300005335 Bacteria 1296
34 Ga0070682_100169719 3300005337 Bacteria 1515
35 Ga0068868_100005165 3300005338 Bacteria 9164
36 Ga0068868_100011564 3300005338 Bacteria 6428
37 Ga0068868_100330759 3300005338 Bacteria 1300
38 Ga0068868_100617364 3300005338 Bacteria 962
39 Ga0068868_100680520 3300005338 Bacteria 919
40 Ga0068868_101122057 3300005338 Bacteria 724
41 Ga0070660_101611408 3300005339 Bacteria 552
42 Ga0070660_101715141 3300005339 Bacteria 535
43 Ga0070689_100004075 3300005340 Bacteria 9839
44 Ga0070689_100021838 3300005340 Bacteria 4771
45 Ga0070689_100782419 3300005340 Bacteria 838
46 Ga0070689_101885846 3300005340 Bacteria 546
47 Ga0070661_100018669 3300005344 Bacteria 4934
48 Ga0070661_100065166 3300005344 Bacteria 2677
49 Ga0070668_102017879 3300005347 Unclassified 532
50 Ga0070669_101206045 3300005353 Bacteria 654
51 Ga0070675_100204633 3300005354 Unclassified 1714
52 Ga0070675_100221674 3300005354 Bacteria 1647
53 Ga0070675_100642576 3300005354 Bacteria 964
54 Ga0070671_100020886 3300005355 Bacteria 5341
55 Ga0070671_100041838 3300005355 Bacteria 3808
56 Ga0070671_100257010 3300005355 Unclassified 1484
57 Ga0070671_100403644 3300005355 Bacteria 1169
58 Ga0070671_101727270 3300005355 Bacteria 556
59 Ga0070674_100047158 3300005356 Bacteria 2950
60 Ga0070674_101419079 3300005356 Unclassified 622
61 Ga0070673_100059631 3300005364 Bacteria 3022
62 Ga0070673_100167375 3300005364 Bacteria 1874
63 Ga0070673_100283449 3300005364 Bacteria 1454
64 Ga0070673_100534566 3300005364 Bacteria 1063
65 Ga0070688_100077834 3300005365 Bacteria 2138
66 Ga0070688_100673686 3300005365 Bacteria 798
67 Ga0070659_101101444 3300005366 Bacteria 700
68 Ga0070667_100032022 3300005367 Bacteria 4384
69 Ga0070667_100197965 3300005367 Bacteria 1782
70 Ga0070667_100448838 3300005367 Bacteria 1178
71 Ga0070713_101473003 3300005436 Unclassified 660
72 Ga0070663_100191327 3300005455 Bacteria 1592
73 Ga0070663_100314430 3300005455 Unclassified 1258
74 Ga0070663_100394644 3300005455 Bacteria 1130
75 Ga0070678_100033638 3300005456 Bacteria 3561
76 Ga0070678_100280731 3300005456 Bacteria 1408
77 Ga0070678_100379718 3300005456 Bacteria 1222
78 Ga0070678_101264429 3300005456 Bacteria 686
79 Ga0070662_100020905 3300005457 Bacteria 4464
80 Ga0070662_100025032 3300005457 Bacteria 4118
81 Ga0070662_100057988 3300005457 Bacteria 2816
82 Ga0070662_100169800 3300005457 Bacteria 1712
83 Ga0070662_100232341 3300005457 Bacteria 1476
84 Ga0070681_10768921 3300005458 Bacteria 880
85 Ga0068867_100016164 3300005459 Bacteria 5300
86 Ga0068867_100076883 3300005459 Bacteria 2507
87 Ga0068867_100109862 3300005459 Bacteria 2117
88 Ga0070685_10061056 3300005466 Bacteria 2206
89 Ga0070685_10188230 3300005466 Bacteria 1333
90 Ga0070684_100005000 3300005535 Bacteria 10126
91 Ga0070684_100233161 3300005535 Bacteria 1681
92 Ga0070684_101024998 3300005535 Bacteria 775
93 Ga0068853_100269331 3300005539 Bacteria 1568
94 Ga0068853_101567151 3300005539 Unclassified 638
95 Ga0068853_101567461 3300005539 Bacteria 638
96 Ga0070672_100068140 3300005543 Bacteria 2822
97 Ga0070672_100089614 3300005543 Bacteria 2479
98 Ga0070672_101476486 3300005543 Bacteria 609
99 Ga0070686_100026141 3300005544 Bacteria 3520
100 Ga0070686_100450676 3300005544 Bacteria 989
101 Ga0070686_100942016 3300005544 Bacteria 705
102 Ga0070665_100000008 3300005548 Bacteria 606341
103 Ga0070665_100334474 3300005548 Bacteria 1519
104 Ga0070665_100426877 3300005548 Bacteria 1334
105 Ga0070665_101013335 3300005548 Bacteria 843
106 Ga0070704_101274860 3300005549 Bacteria 672
107 Ga0068855_100000724 3300005563 Bacteria 40544
108 Ga0068855_100000927 3300005563 Bacteria 36472
109 Ga0068855_100383806 3300005563 Bacteria 1542
110 Ga0068855_101869408 3300005563 Unclassified 609
111 Ga0068855_101922025 3300005563 Bacteria 599
112 Ga0070664_100098480 3300005564 Bacteria 2540
113 Ga0070664_100675260 3300005564 Bacteria 961
114 Ga0068857_100019122 3300005577 Bacteria 6012
115 Ga0068857_100158203 3300005577 Bacteria 2055
116 Ga0068857_100255065 3300005577 Bacteria 1609
117 Ga0068854_100120839 3300005578 Bacteria 1989
118 Ga0068854_100171997 3300005578 Unclassified 1686
119 Ga0068854_100741350 3300005578 Bacteria 851
120 Ga0068856_100579425 3300005614 Bacteria 1143
121 Ga0068856_101565361 3300005614 Bacteria 672
122 Ga0070702_100244862 3300005615 Bacteria 1212
123 Ga0070702_100968243 3300005615 Bacteria 671
124 Ga0068852_100080977 3300005616 Bacteria 2881
125 Ga0068852_100180785 3300005616 Bacteria 1983
126 Ga0068852_100607100 3300005616 Bacteria 1099
127 Ga0068852_100700147 3300005616 Bacteria 1023
128 Ga0068852_102194904 3300005616 Bacteria 574
129 Ga0068859_100063354 3300005617 Bacteria 3728
130 Ga0068859_100076736 3300005617 Bacteria 3382
131 Ga0068859_100134591 3300005617 Bacteria 2543
132 Ga0068859_100227856 3300005617 Bacteria 1952
133 Ga0068864_100002531 3300005618 Bacteria 15099
134 Ga0068864_100128875 3300005618 Bacteria 2270
135 Ga0068864_101370619 3300005618 Unclassified 708
136 Ga0068864_101411317 3300005618 Bacteria 698
137 Ga0068864_101899909 3300005618 Unclassified 601
138 Ga0068861_100028581 3300005719 Bacteria 4070
139 Ga0068861_100477771 3300005719 Unclassified 1122
140 Ga0068861_101973436 3300005719 Bacteria 582
141 Ga0068861_102352491 3300005719 Bacteria 535
142 Ga0068851_10199488 3300005834 Bacteria 1116
143 Ga0068851_10203737 3300005834 Unclassified 1105
144 Ga0068851_10859275 3300005834 Unclassified 566
145 Ga0068851_10907477 3300005834 Bacteria 552
146 Ga0068863_100032677 3300005841 Bacteria 4959
147 Ga0068863_100296933 3300005841 Bacteria 1567
148 Ga0068863_100587921 3300005841 Bacteria 1101
149 Ga0068858_100374164 3300005842 Bacteria 1366
150 Ga0068860_100000029 3300005843 Bacteria 259192
151 Ga0068860_101008134 3300005843 Unclassified 851
152 Ga0068860_101420467 3300005843 Unclassified 715
153 Ga0068862_100862405 3300005844 Bacteria 888
154 Ga0070715_10129318 3300006163 Bacteria 1214
155 Ga0097621_100031989 3300006237 Bacteria 4179
156 Ga0097621_100130827 3300006237 Bacteria 2136
157 Ga0097621_100442904 3300006237 Bacteria 1169
158 Ga0075370_10092173 3300006353 Bacteria 1748
159 Ga0068871_100089275 3300006358 Bacteria 2565
160 Ga0068871_100202020 3300006358 Bacteria 1716
161 Ga0068871_100338583 3300006358 Bacteria 1328
162 Ga0068871_101405280 3300006358 Bacteria 658
163 Ga0068865_100053930 3300006881 Bacteria 2791
164 Ga0068865_100580498 3300006881 Unclassified 945
165 Ga0097620_100063358 3300006931 Bacteria 3728
166 Ga0097620_100076731 3300006931 Bacteria 3382
167 Ga0097620_100134605 3300006931 Bacteria 2543
168 Ga0097620_100227853 3300006931 Bacteria 1952
169 Ga0105251_10056649 3300009011 Bacteria 1855
170 Ga0105240_10016952 3300009093 Bacteria 9842
171 Ga0105240_10283133 3300009093 Bacteria 1903
172 Ga0105240_10367652 3300009093 Unclassified 1627
173 Ga0105245_10061178 3300009098 Bacteria 3393
174 Ga0105247_10214325 3300009101 Bacteria 1300
175 Ga0105241_10032972 3300009174 Bacteria 3885
176 Ga0105241_10885818 3300009174 Bacteria 828
177 Ga0105241_11035083 3300009174 Bacteria 770
178 Ga0105241_11741520 3300009174 Bacteria 607
179 Ga0105241_11843117 3300009174 Unclassified 591
180 Ga0105241_11891226 3300009174 Bacteria 585
181 Ga0105242_10117909 3300009176 Bacteria 2273
182 Ga0105248_10048177 3300009177 Bacteria 4780
183 Ga0105248_10439728 3300009177 Bacteria 1469
184 Ga0105248_10604362 3300009177 Bacteria 1237
185 Ga0105237_10577580 3300009545 Bacteria 1131
186 Ga0105237_11929436 3300009545 Unclassified 599
187 Ga0105238_10032963 3300009551 Bacteria 5272
188 Ga0105238_11103604 3300009551 Bacteria 816
189 Ga0105249_10024556 3300009553 Bacteria 5418
190 Ga0105249_12836241 3300009553 Bacteria 556
191 Ga0105239_10020511 3300010375 Bacteria 7289
192 Ga0105239_10064892 3300010375 Unclassified 4009
193 Ga0105239_10537236 3300010375 Bacteria 1331
194 Ga0105239_11632326 3300010375 Unclassified 746
195 Ga0105239_12712977 3300010375 Unclassified 578
196 Ga0105246_10042029 3300011119 Bacteria 3094
197 Ga0105246_10413660 3300011119 Unclassified 1123
198 Ga0157373_10251026 3300013100 Bacteria 1251
199 Ga0157373_10808967 3300013100 Bacteria 691
200 Ga0157371_10040616 3300013102 Bacteria 3322
201 Ga0157370_10001163 3300013104 Bacteria 32805
202 Ga0157370_10780671 3300013104 Bacteria 870
203 Ga0157369_10477211 3300013105 Bacteria 1291
204 Ga0157369_10723713 3300013105 Bacteria 1024
205 Ga0157369_11174950 3300013105 Bacteria 783
206 Ga0157369_12681929 3300013105 Unclassified 502
207 Ga0157374_10006069 3300013296 Bacteria 10225
208 Ga0157374_10091709 3300013296 Bacteria 2898
209 Ga0157374_10092143 3300013296 Bacteria 2891
210 Ga0157374_10120046 3300013296 Bacteria 2536
211 Ga0157374_10141265 3300013296 Bacteria 2338
212 Ga0157374_10340572 3300013296 Bacteria 1489
213 Ga0157374_10730489 3300013296 Bacteria 1004
214 Ga0157374_11348199 3300013296 Unclassified 736
215 Ga0157374_11488022 3300013296 Bacteria 700
216 Ga0157378_10000981 3300013297 Bacteria 26109
217 Ga0157378_10137169 3300013297 Bacteria 2269
218 Ga0157378_10308066 3300013297 Bacteria 1535
219 Ga0157378_10335702 3300013297 Bacteria 1472
220 Ga0157378_10733058 3300013297 Bacteria 1010
221 Ga0157378_11234220 3300013297 Unclassified 788
222 Ga0157378_11396494 3300013297 Bacteria 743
223 Ga0163162_10000038 3300013306 Bacteria 138065
224 Ga0163162_10002178 3300013306 Bacteria 18377
225 Ga0163162_10002730 3300013306 Bacteria 16751
226 Ga0163162_10003086 3300013306 Bacteria 15916
227 Ga0163162_10134788 3300013306 Bacteria 2580
228 Ga0163162_10147073 3300013306 Bacteria 2473
229 Ga0163162_10243148 3300013306 Bacteria 1931
230 Ga0163162_10338372 3300013306 Bacteria 1637
231 Ga0163162_13447134 3300013306 Bacteria 504
232 Ga0157372_10471168 3300013307 Bacteria 1464
233 Ga0157372_10574727 3300013307 Bacteria 1314
234 Ga0157372_10666972 3300013307 Bacteria 1211
235 Ga0157372_12059820 3300013307 Unclassified 656
236 Ga0157375_10002648 3300013308 Bacteria 15501
237 Ga0157375_10008218 3300013308 Bacteria 9133
238 Ga0157375_10106132 3300013308 Bacteria 2900
239 Ga0157375_10119101 3300013308 Bacteria 2747
240 Ga0157375_10322940 3300013308 Bacteria 1708
241 Ga0157375_12509908 3300013308 Bacteria 615
242 Ga0163163_10014243 3300014325 Bacteria 7308
243 Ga0163163_10017923 3300014325 Bacteria 6614
244 Ga0163163_10155766 3300014325 Unclassified 2329
245 Ga0163163_10612392 3300014325 Bacteria 1152
246 Ga0163163_11313968 3300014325 Unclassified 785
247 Ga0157380_10087741 3300014326 Bacteria 2558
248 Ga0157377_10066663 3300014745 Bacteria 2070
249 Ga0157377_10250097 3300014745 Bacteria 1148
250 Ga0157377_11337933 3300014745 Bacteria 562
251 Ga0157379_10179828 3300014968 Bacteria 1911
252 Ga0157379_10479891 3300014968 Bacteria 1150
253 Ga0157376_10030234 3300014969 Bacteria 4323
254 Ga0157376_10077146 3300014969 Bacteria 2849
255 Ga0157376_10141895 3300014969 Bacteria 2156
256 Ga0157376_10293111 3300014969 Bacteria 1537
257 Ga0157376_11457918 3300014969 Unclassified 717
258 Ga0182006_1192757 3300015261 Bacteria 677
259 Ga0163161_10020433 3300017792 Bacteria 4646
260 Ga0163161_10163616 3300017792 Bacteria 1698
261 Ga0163161_10191387 3300017792 Bacteria 1573
262 Ga0207713_1056328 3300025735 Bacteria 1528
263 Ga0207680_10018300 3300025903 Bacteria 3721
264 Ga0207680_10145462 3300025903 Bacteria 1575
265 Ga0207680_10153916 3300025903 Unclassified 1535
266 Ga0207680_10372233 3300025903 Bacteria 1006
267 Ga0207680_10646889 3300025903 Bacteria 757
268 Ga0207647_10005536 3300025904 Bacteria 9246
269 Ga0207685_10134973 3300025905 Bacteria 1100
270 Ga0207645_10017210 3300025907 Bacteria 4775
271 Ga0207645_10142060 3300025907 Bacteria 1565
272 Ga0207645_10173772 3300025907 Bacteria 1412
273 Ga0207654_10004350 3300025911 Bacteria 7138
274 Ga0207654_10029732 3300025911 Bacteria 2994
275 Ga0207695_10001773 3300025913 Bacteria 34055
276 Ga0207671_10010815 3300025914 Bacteria 7488
277 Ga0207671_10616759 3300025914 Bacteria 864
278 Ga0207657_10050681 3300025919 Bacteria 3612
279 Ga0207649_10081692 3300025920 Bacteria 2093
280 Ga0207649_10084381 3300025920 Bacteria 2065
281 Ga0207649_10913209 3300025920 Bacteria 689
282 Ga0207681_10285448 3300025923 Bacteria 1301
283 Ga0207681_11409538 3300025923 Bacteria 585
284 Ga0207650_10030710 3300025925 Bacteria 3873
285 Ga0207650_10193114 3300025925 Bacteria 1628
286 Ga0207650_10299560 3300025925 Bacteria 1313
287 Ga0207650_10303307 3300025925 Bacteria 1305
288 Ga0207650_10697187 3300025925 Bacteria 858
289 Ga0207659_10061762 3300025926 Bacteria 2702
290 Ga0207659_10132492 3300025926 Bacteria 1926
291 Ga0207659_10245139 3300025926 Bacteria 1451
292 Ga0207659_10663951 3300025926 Bacteria 891
293 Ga0207644_10098240 3300025931 Bacteria 2194
294 Ga0207644_10118440 3300025931 Bacteria 2012
295 Ga0207644_10178889 3300025931 Bacteria 1661
296 Ga0207644_10277410 3300025931 Bacteria 1345
297 Ga0207644_10292559 3300025931 Bacteria 1310
298 Ga0207644_11020904 3300025931 Bacteria 694
299 Ga0207690_10844183 3300025932 Bacteria 758
300 Ga0207706_10026986 3300025933 Bacteria 5138
301 Ga0207706_10208788 3300025933 Bacteria 1712
302 Ga0207706_10313103 3300025933 Bacteria 1366
303 Ga0207706_10565519 3300025933 Bacteria 978
304 Ga0207706_10571176 3300025933 Bacteria 973
305 Ga0207706_10730336 3300025933 Unclassified 845
306 Ga0207686_10090031 3300025934 Bacteria 2023
307 Ga0207670_10008906 3300025936 Bacteria 5690
308 Ga0207670_10161540 3300025936 Bacteria 1672
309 Ga0207670_10530886 3300025936 Bacteria 959
310 Ga0207669_10393893 3300025937 Unclassified 1083
311 Ga0207669_11191313 3300025937 Unclassified 645
312 Ga0207704_11183402 3300025938 Bacteria 651
313 Ga0207704_11199536 3300025938 Unclassified 647
314 Ga0207691_10357650 3300025940 Bacteria 1249
315 Ga0207691_11358904 3300025940 Unclassified 585
316 Ga0207711_10342514 3300025941 Bacteria 1384
317 Ga0207711_10644403 3300025941 Bacteria 988
318 Ga0207689_10008125 3300025942 Bacteria 9153
319 Ga0207689_10026642 3300025942 Bacteria 4842
320 Ga0207689_10126297 3300025942 Bacteria 2104
321 Ga0207689_10190613 3300025942 Bacteria 1691
322 Ga0207661_10189206 3300025944 Bacteria 1803
323 Ga0207661_10764161 3300025944 Bacteria 890
324 Ga0207679_10002211 3300025945 Bacteria 12015
325 Ga0207679_10130127 3300025945 Bacteria 2018
326 Ga0207679_10147013 3300025945 Bacteria 1913
327 Ga0207679_10924362 3300025945 Unclassified 798
328 Ga0207667_10000015 3300025949 Bacteria 417534
329 Ga0207667_10006803 3300025949 Bacteria 13811
330 Ga0207667_10180531 3300025949 Bacteria 2168
331 Ga0207651_10097934 3300025960 Bacteria 2167
332 Ga0207651_10685806 3300025960 Bacteria 901
333 Ga0207668_11655755 3300025972 Unclassified 578
334 Ga0207640_10172678 3300025981 Bacteria 1612
335 Ga0207640_10267080 3300025981 Unclassified 1336
336 Ga0207658_10017481 3300025986 Bacteria 4943
337 Ga0207658_10229298 3300025986 Bacteria 1567
338 Ga0207658_10631843 3300025986 Unclassified 964
339 Ga0207677_10008694 3300026023 Bacteria 5686
340 Ga0207677_10121414 3300026023 Bacteria 1966
341 Ga0207677_10407263 3300026023 Unclassified 1155
342 Ga0207677_11177313 3300026023 Bacteria 701
343 Ga0207703_10095267 3300026035 Unclassified 2511
344 Ga0207703_10362109 3300026035 Bacteria 1338
345 Ga0207703_11144896 3300026035 Bacteria 748
346 Ga0207703_12174932 3300026035 Bacteria 531
347 Ga0207639_10174851 3300026041 Bacteria 1822
348 Ga0207639_10812685 3300026041 Bacteria 871
349 Ga0207639_10850373 3300026041 Unclassified 852
350 Ga0207678_10017432 3300026067 Bacteria 6308
351 Ga0207678_10197864 3300026067 Bacteria 1718
352 Ga0207678_10214961 3300026067 Bacteria 1645
353 Ga0207678_10822234 3300026067 Bacteria 820
354 Ga0207702_10081671 3300026078 Bacteria 2808
355 Ga0207702_10389345 3300026078 Bacteria 1342
356 Ga0207702_10842469 3300026078 Bacteria 907
357 Ga0207641_10024670 3300026088 Bacteria 4956
358 Ga0207641_10034573 3300026088 Bacteria 4206
359 Ga0207641_10375519 3300026088 Bacteria 1360
360 Ga0207648_10077055 3300026089 Bacteria 2906
361 Ga0207648_10159417 3300026089 Bacteria 1993
362 Ga0207648_10180304 3300026089 Bacteria 1869
363 Ga0207648_10297057 3300026089 Bacteria 1448
364 Ga0207648_11905501 3300026089 Bacteria 556
365 Ga0207676_10030348 3300026095 Bacteria 4057
366 Ga0207676_10118637 3300026095 Bacteria 2227
367 Ga0207676_10242959 3300026095 Bacteria 1616
368 Ga0207676_11090285 3300026095 Bacteria 789
369 Ga0207674_10006730 3300026116 Bacteria 13496
370 Ga0207674_10108465 3300026116 Bacteria 2753
371 Ga0207674_10403510 3300026116 Unclassified 1321
372 Ga0207675_100039339 3300026118 Bacteria 4414
373 Ga0207675_100386879 3300026118 Bacteria 1376
374 Ga0207675_100836956 3300026118 Unclassified 935
375 Ga0207675_101478152 3300026118 Bacteria 700
376 Ga0207683_10044988 3300026121 Bacteria 3860
377 Ga0207683_10073154 3300026121 Bacteria 3032
378 Ga0207683_10462282 3300026121 Bacteria 1170
379 Ga0207683_10569040 3300026121 Bacteria 1048
380 Ga0207683_10897055 3300026121 Bacteria 823
381 Ga0207698_10094903 3300026142 Bacteria 2454
382 Ga0207698_10302461 3300026142 Bacteria 1489
383 Ga0207698_10351447 3300026142 Unclassified 1392
384 Ga0268266_10000016 3300028379 Bacteria 629101
385 Ga0268266_10255479 3300028379 Bacteria 1622
386 Ga0268266_10488813 3300028379 Bacteria 1174
387 Ga0268265_10102663 3300028380 Bacteria 2314
388 Ga0268264_10000072 3300028381 Bacteria 260791
389 Ga0268264_12226470 3300028381 Unclassified 556
390 Ga0268264_12702543 3300028381 Unclassified 500
391 Ga0307515_10367712 3300028794 Bacteria 1076
392 Ga0265327_10000117 3300031251 Bacteria 173075
393 Ga0307509_10201505 3300031507 Bacteria 1826
394 Ga0373934_0009251 3300035086 Bacteria 3688
395 Ga0373944_0158590 3300035089 Bacteria 801
396 Ga0373923_0057494 3300035111 Bacteria 1645
397 Ga0373953_0178281 3300035117 Bacteria 916
398 Ga0373956_0135708 3300035119 Bacteria 1154
399 Ga0373957_0069756 3300035120 Bacteria 1373
400 Ga0373955_0004601 3300035172 Bacteria 6115
401 Ga0373924_0005807 3300035410 Bacteria 4392
402 Ga0373933_0015285 3300035724 Bacteria 4279
403 Ga0373937_0002667 3300036401 Bacteria 14878
404 Ga0451800_1372933 3300041459 Bacteria 574
405 Ga0451853_3096197 3300041512 Bacteria 569
406 Ga0439458_0210098 3300042157 Unclassified 534
407 Ga0451577_0437202 3300042876 Bacteria 1188
408 Ga0466972_0006105 3300044658 Bacteria 6052
409 Ga0466972_0011616 3300044658 Bacteria 4422
410 Ga0466964_0302008 3300044706 Bacteria 807
411 Ga0453684_0261181 3300044712 Unclassified 1983
412 Ga0466968_0070228 3300044735 Bacteria 1523
413 Ga0466957_0285595 3300044842 Bacteria 1105
414 Ga0466960_0461659 3300044901 Bacteria 739
415 Ga0466959_0189649 3300045049 Bacteria 1435
416 Ga0451576_0752992 3300045051 Unclassified 1023
417 Ga0466967_0957546 3300045976 Bacteria 852
418 Ga0495592_0022738 3300046454 Bacteria 4769
419 Ga0495638_0016710 3300046460 Bacteria 4908
420 Ga0495651_0210869 3300046462 Bacteria 1352
421 Ga0495651_0330618 3300046462 Unclassified 1013
422 Ga0495650_0011785 3300046471 Bacteria 4753
423 Ga0495606_0020255 3300046507 Bacteria 4913
424 Ga0495610_0032347 3300046512 Bacteria 2718
425 Ga0495616_0001600 3300046513 Bacteria 15514
426 Ga0495620_0026142 3300046515 Bacteria 2748
427 Ga0495628_0276315 3300046516 Bacteria 1248
428 Ga0495630_0008167 3300046517 Bacteria 7518
429 Ga0495631_0000007 3300046518 Bacteria 130158
430 Ga0495637_0039018 3300046520 Bacteria 2053
431 Ga0495640_0444630 3300046533 Bacteria 792
432 Ga0495586_0441547 3300046535 Bacteria 750
433 Ga0495587_0077260 3300046536 Bacteria 1933
434 Ga0495621_0007383 3300046539 Bacteria 3253
435 Ga0495597_0085074 3300046542 Bacteria 1348
436 Ga0495645_0783366 3300046543 Unclassified 573
437 Ga0495667_0681738 3300046559 Bacteria 637
438 Ga0495634_0119377 3300046642 Bacteria 1689
439 Ga0495634_0705340 3300046642 Unclassified 580
440 Ga0495611_0094833 3300046648 Bacteria 1381
441 Ga0495625_0067055 3300046660 Bacteria 2527
442 Ga0495625_0275377 3300046660 Bacteria 1084
443 Ga0495588_0026645 3300046674 Bacteria 2888
444 Ga0495599_0803272 3300046678 Bacteria 537
445 Ga0495646_0197678 3300046680 Bacteria 1096
446 Ga0495658_0015908 3300046683 Bacteria 3867
447 Ga0495670_0040627 3300046691 Bacteria 2320
448 Ga0495600_0327829 3300046809 Bacteria 962
449 Ga0495600_0555319 3300046809 Bacteria 701
450 Ga0495604_0048545 3300047317 Bacteria 3302
451 Ga0495676_0000324 3300047321 Bacteria 38811
452 Ga0495680_0110530 3300047322 Bacteria 2037
453 Ga0495687_000004 3300047443 Bacteria 779298
454 Ga0495684_0029757 3300047471 Bacteria 4191
455 Ga0495593_0000712 3300047673 Bacteria 19228
456 Ga0495614_0010806 3300048089 Bacteria 4019
457 Ga0496100_0213824 3300048903 Bacteria 1412
458 Ga0496101_0337650 3300048904 Bacteria 1183
459 Ga0496104_0335971 3300048907 Bacteria 1424
460 Ga0496104_0819159 3300048907 Bacteria 837
461 Ga0496105_0829423 3300048908 Unclassified 701
462 Ga0496106_0583575 3300048909 Unclassified 896
463 Ga0496107_0631611 3300048910 Bacteria 790
464 Ga0496108_0277242 3300048911 Bacteria 1460
465 Ga0496109_0796285 3300048912 Bacteria 883
466 Ga0496110_0334733 3300048913 Bacteria 1379
467 Ga0496111_0050742 3300048914 Bacteria 2994
468 Ga0496114_1328830 3300048917 Bacteria 606
469 Ga0496125_0035667 3300048928 Bacteria 4357
470 Ga0496126_0170186 3300048929 Bacteria 1856
471 Ga0501042_0469638 3300049578 Bacteria 913
472 Ga0501202_090235 3300049652 Bacteria 732
473 Ga0495619_0046338 3300053085 Bacteria 2859
474 Ga0500578_0526566 3300053086 Unclassified 661
475 Ga0500643_007846 3300053087 Bacteria 4252
476 Ga0500651_0000044 3300053093 Bacteria 86444
477 Ga0500566_0085802 3300053094 Bacteria 1746
478 Ga0500562_026722 3300053108 Bacteria 1513
479 Ga0500571_000243 3300053110 Bacteria 20532
480 Ga0500608_025168 3300053122 Bacteria 2784
481 Ga0500618_095548 3300053125 Bacteria 668
482 Ga0500655_000060 3300053133 Bacteria 30372
483 Ga0500658_0000028 3300053134 Bacteria 105688
484 Ga0500658_0000094 3300053134 Bacteria 40740
485 Ga0500659_0272912 3300053135 Bacteria 773
486 Ga0500559_0052491 3300053136 Bacteria 1802
487 Ga0500559_0053746 3300053136 Bacteria 1783
488 Ga0500564_046316 3300053138 Bacteria 1995
489 Ga0500568_0002455 3300053139 Bacteria 10900
490 Ga0500573_0389791 3300053140 Bacteria 663
491 Ga0500574_000124 3300053141 Bacteria 8468
492 Ga0500619_262384 3300053154 Bacteria 566
493 Ga0500619_273969 3300053154 Bacteria 550
494 Ga0500624_017481 3300053157 Bacteria 1119
495 Ga0500634_0019199 3300053161 Bacteria 3680
496 Ga0500638_154335 3300053162 Bacteria 1017

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10404778 Ga0070658_104047782 119
2 3300005339 Ga0070660_101611408 Ga0070660_1016114081 119
3 3300005340 Ga0070689_101885846 Ga0070689_1018858461 119
4 3300005563 Ga0068855_101869408 Ga0068855_1018694082 119
5 3300005578 Ga0068854_100741350 Ga0068854_1007413502 119
6 3300005618 Ga0068864_101899909 Ga0068864_1018999092 119
7 3300005834 Ga0068851_10859275 Ga0068851_108592752 119
8 3300009174 Ga0105241_11741520 Ga0105241_117415201 119
9 3300010375 Ga0105239_10064892 Ga0105239_100648925 119
10 3300013297 Ga0157378_10137169 Ga0157378_101371691 119
11 3300013308 Ga0157375_12509908 Ga0157375_125099081 119
12 3300025925 Ga0207650_10697187 Ga0207650_106971873 119
13 3300025944 Ga0207661_10764161 Ga0207661_107641611 119
14 3300025945 Ga0207679_10147013 Ga0207679_101470132 119
15 3300025986 Ga0207658_10229298 Ga0207658_102292982 119
16 3300025911 Ga0207654_10029732 Ga0207654_100297323 122
17 iso_pu_bacteria 2599185214 2599625846 122
18 iso_pu_bacteria 2599185226 2599675072 122
19 iso_pu_bacteria 2599185227 2599683966 122
20 iso_pu_bacteria 2599185229 2599695431 122
21 iso_pu_bacteria 2928070936 2928076393 122
22 iso_pu_bacteria 2928084124 2928090609 122
23 iso_pu_bacteria 2945945610 2945948498 122
24 3300026067 Ga0207678_10822234 Ga0207678_108222342 124
25 3300003323 rootH1_10071419 rootH1_100714192 126
26 3300005295 Ga0065707_10318459 Ga0065707_103184591 126
27 3300005331 Ga0070670_100305355 Ga0070670_1003053552 126
28 3300005457 Ga0070662_100057988 Ga0070662_1000579881 126
29 3300006353 Ga0075370_10092173 Ga0075370_100921732 126
30 3300011119 Ga0105246_10042029 Ga0105246_100420294 126
31 3300013100 Ga0157373_10251026 Ga0157373_102510262 126
32 3300013104 Ga0157370_10001163 Ga0157370_1000116331 126
33 3300015261 Ga0182006_1192757 Ga0182006_11927571 126
34 3300017792 Ga0163161_10020433 Ga0163161_100204333 126
35 3300025933 Ga0207706_10571176 Ga0207706_105711762 126
36 3300028794 Ga0307515_10367712 Ga0307515_103677122 126
37 3300041459 Ga0451800_1372933 Ga0451800_1372933_60_446 126
38 3300044706 Ga0466964_0302008 Ga0466964_0302008_55_447 126
39 3300046460 Ga0495638_0016710 Ga0495638_0016710_3026_3415 126
40 3300046471 Ga0495650_0011785 Ga0495650_0011785_141_557 126
41 3300046512 Ga0495610_0032347 Ga0495610_0032347_273_662 126
42 3300046513 Ga0495616_0001600 Ga0495616_0001600_6362_6751 126
43 3300046515 Ga0495620_0026142 Ga0495620_0026142_506_895 126
44 3300046518 Ga0495631_0000007 Ga0495631_0000007_105167_105556 126
45 3300046520 Ga0495637_0039018 Ga0495637_0039018_916_1305 126
46 3300046539 Ga0495621_0007383 Ga0495621_0007383_1277_1666 126
47 3300046660 Ga0495625_0275377 Ga0495625_0275377_245_634 126
48 3300046674 Ga0495588_0026645 Ga0495588_0026645_2418_2807 126
49 3300046683 Ga0495658_0015908 Ga0495658_0015908_96_485 126
50 3300046691 Ga0495670_0040627 Ga0495670_0040627_1162_1551 126
51 3300046809 Ga0495600_0555319 Ga0495600_0555319_76_465 126
52 3300047321 Ga0495676_0000324 Ga0495676_0000324_18194_18583 126
53 3300047673 Ga0495593_0000712 Ga0495593_0000712_12421_12810 126
54 3300048089 Ga0495614_0010806 Ga0495614_0010806_1228_1617 126
55 3300048910 Ga0496107_0631611 Ga0496107_0631611_297_686 126
56 3300048928 Ga0496125_0035667 Ga0496125_0035667_3813_4202 126
57 3300048929 Ga0496126_0170186 Ga0496126_0170186_1078_1467 126
58 3300049578 Ga0501042_0469638 Ga0501042_0469638_134_523 126
59 3300053087 Ga0500643_007846 Ga0500643_007846_1592_1981 126
60 3300053093 Ga0500651_0000044 Ga0500651_0000044_37080_37469 126
61 3300053094 Ga0500566_0085802 Ga0500566_0085802_399_788 126
62 3300053108 Ga0500562_026722 Ga0500562_026722_102_491 126
63 3300053110 Ga0500571_000243 Ga0500571_000243_8031_8420 126
64 3300053122 Ga0500608_025168 Ga0500608_025168_1284_1673 126
65 3300053125 Ga0500618_095548 Ga0500618_095548_262_651 126
66 3300053133 Ga0500655_000060 Ga0500655_000060_820_1209 126
67 3300053134 Ga0500658_0000028 Ga0500658_0000028_23017_23406 126
68 3300053134 Ga0500658_0000094 Ga0500658_0000094_15677_16066 126
69 3300053135 Ga0500659_0272912 Ga0500659_0272912_232_621 126
70 3300053136 Ga0500559_0052491 Ga0500559_0052491_153_542 126
71 3300053136 Ga0500559_0053746 Ga0500559_0053746_496_882 126
72 3300053138 Ga0500564_046316 Ga0500564_046316_347_733 126
73 3300053139 Ga0500568_0002455 Ga0500568_0002455_6398_6787 126
74 3300053140 Ga0500573_0389791 Ga0500573_0389791_175_564 126
75 3300053141 Ga0500574_000124 Ga0500574_000124_4355_4744 126
76 3300053154 Ga0500619_262384 Ga0500619_262384_62_448 126
77 3300053154 Ga0500619_273969 Ga0500619_273969_28_417 126
78 3300053157 Ga0500624_017481 Ga0500624_017481_147_536 126
79 3300053161 Ga0500634_0019199 Ga0500634_0019199_2293_2682 126
80 3300053162 Ga0500638_154335 Ga0500638_154335_309_698 126
81 3300003316 rootH1_10039003 rootH1_100390033 127
82 3300003322 rootL2_10074260 rootL2_1007426017 127
83 3300003323 rootH1_10034197 rootH1_1003419717 127
84 3300005290 Ga0065712_10190902 Ga0065712_101909022 127
85 3300005328 Ga0070676_10005217 Ga0070676_100052176 127
86 3300005328 Ga0070676_10286009 Ga0070676_102860091 127
87 3300005328 Ga0070676_10294802 Ga0070676_102948022 127
88 3300005329 Ga0070683_100157311 Ga0070683_1001573113 127
89 3300005329 Ga0070683_100298060 Ga0070683_1002980603 127
90 3300005330 Ga0070690_100122224 Ga0070690_1001222242 127
91 3300005330 Ga0070690_100173196 Ga0070690_1001731962 127
92 3300005330 Ga0070690_100244489 Ga0070690_1002444891 127
93 3300005331 Ga0070670_100043725 Ga0070670_1000437254 127
94 3300005331 Ga0070670_100107374 Ga0070670_1001073742 127
95 3300005331 Ga0070670_100215468 Ga0070670_1002154683 127
96 3300005331 Ga0070670_100273613 Ga0070670_1002736134 127
97 3300005331 Ga0070670_100335359 Ga0070670_1003353592 127
98 3300005331 Ga0070670_100431325 Ga0070670_1004313252 127
99 3300005331 Ga0070670_100804839 Ga0070670_1008048392 127
100 3300005333 Ga0070677_10820656 Ga0070677_108206561 127
101 3300005334 Ga0068869_100004070 Ga0068869_1000040703 127
102 3300005334 Ga0068869_100035028 Ga0068869_1000350283 127
103 3300005334 Ga0068869_100106052 Ga0068869_1001060523 127
104 3300005334 Ga0068869_100177717 Ga0068869_1001777172 127
105 3300005335 Ga0070666_10022917 Ga0070666_100229173 127
106 3300005335 Ga0070666_10039776 Ga0070666_100397763 127
107 3300005335 Ga0070666_10175843 Ga0070666_101758432 127
108 3300005335 Ga0070666_10234752 Ga0070666_102347522 127
109 3300005337 Ga0070682_100169719 Ga0070682_1001697191 127
110 3300005338 Ga0068868_100005165 Ga0068868_10000516511 127
111 3300005338 Ga0068868_100011564 Ga0068868_1000115644 127
112 3300005338 Ga0068868_100330759 Ga0068868_1003307592 127
113 3300005338 Ga0068868_100617364 Ga0068868_1006173642 127
114 3300005338 Ga0068868_100680520 Ga0068868_1006805201 127
115 3300005338 Ga0068868_101122057 Ga0068868_1011220572 127
116 3300005339 Ga0070660_101715141 Ga0070660_1017151411 127
117 3300005340 Ga0070689_100004075 Ga0070689_1000040753 127
118 3300005340 Ga0070689_100021838 Ga0070689_1000218382 127
119 3300005340 Ga0070689_100782419 Ga0070689_1007824191 127
120 3300005344 Ga0070661_100018669 Ga0070661_1000186694 127
121 3300005344 Ga0070661_100065166 Ga0070661_1000651663 127
122 3300005347 Ga0070668_102017879 Ga0070668_1020178791 127
123 3300005353 Ga0070669_101206045 Ga0070669_1012060451 127
124 3300005354 Ga0070675_100204633 Ga0070675_1002046333 127
125 3300005354 Ga0070675_100221674 Ga0070675_1002216742 127
126 3300005354 Ga0070675_100642576 Ga0070675_1006425762 127
127 3300005355 Ga0070671_100020886 Ga0070671_1000208863 127
128 3300005355 Ga0070671_100041838 Ga0070671_1000418382 127
129 3300005355 Ga0070671_100257010 Ga0070671_1002570102 127
130 3300005355 Ga0070671_100403644 Ga0070671_1004036442 127
131 3300005355 Ga0070671_101727270 Ga0070671_1017272701 127
132 3300005356 Ga0070674_100047158 Ga0070674_1000471582 127
133 3300005356 Ga0070674_101419079 Ga0070674_1014190791 127
134 3300005364 Ga0070673_100059631 Ga0070673_1000596313 127
135 3300005364 Ga0070673_100167375 Ga0070673_1001673753 127
136 3300005364 Ga0070673_100283449 Ga0070673_1002834491 127
137 3300005364 Ga0070673_100534566 Ga0070673_1005345661 127
138 3300005365 Ga0070688_100077834 Ga0070688_1000778343 127
139 3300005365 Ga0070688_100673686 Ga0070688_1006736862 127
140 3300005366 Ga0070659_101101444 Ga0070659_1011014442 127
141 3300005367 Ga0070667_100032022 Ga0070667_1000320225 127
142 3300005367 Ga0070667_100197965 Ga0070667_1001979652 127
143 3300005367 Ga0070667_100448838 Ga0070667_1004488382 127
144 3300005436 Ga0070713_101473003 Ga0070713_1014730031 127
145 3300005455 Ga0070663_100191327 Ga0070663_1001913272 127
146 3300005455 Ga0070663_100314430 Ga0070663_1003144302 127
147 3300005455 Ga0070663_100394644 Ga0070663_1003946442 127
148 3300005456 Ga0070678_100033638 Ga0070678_1000336382 127
149 3300005456 Ga0070678_100280731 Ga0070678_1002807312 127
150 3300005456 Ga0070678_100379718 Ga0070678_1003797182 127
151 3300005456 Ga0070678_101264429 Ga0070678_1012644291 127
152 3300005457 Ga0070662_100020905 Ga0070662_1000209055 127
153 3300005457 Ga0070662_100025032 Ga0070662_1000250323 127
154 3300005457 Ga0070662_100169800 Ga0070662_1001698003 127
155 3300005457 Ga0070662_100232341 Ga0070662_1002323411 127
156 3300005458 Ga0070681_10768921 Ga0070681_107689212 127
157 3300005459 Ga0068867_100016164 Ga0068867_1000161642 127
158 3300005459 Ga0068867_100076883 Ga0068867_1000768833 127
159 3300005459 Ga0068867_100109862 Ga0068867_1001098623 127
160 3300005466 Ga0070685_10061056 Ga0070685_100610562 127
161 3300005466 Ga0070685_10188230 Ga0070685_101882302 127
162 3300005535 Ga0070684_100005000 Ga0070684_1000050004 127
163 3300005535 Ga0070684_100233161 Ga0070684_1002331612 127
164 3300005535 Ga0070684_101024998 Ga0070684_1010249982 127
165 3300005539 Ga0068853_100269331 Ga0068853_1002693311 127
166 3300005539 Ga0068853_101567151 Ga0068853_1015671512 127
167 3300005539 Ga0068853_101567461 Ga0068853_1015674612 127
168 3300005543 Ga0070672_100068140 Ga0070672_1000681402 127
169 3300005543 Ga0070672_100089614 Ga0070672_1000896143 127
170 3300005543 Ga0070672_101476486 Ga0070672_1014764861 127
171 3300005544 Ga0070686_100026141 Ga0070686_1000261413 127
172 3300005544 Ga0070686_100450676 Ga0070686_1004506762 127
173 3300005544 Ga0070686_100942016 Ga0070686_1009420162 127
174 3300005548 Ga0070665_100000008 Ga0070665_100000008276 127
175 3300005548 Ga0070665_100334474 Ga0070665_1003344742 127
176 3300005548 Ga0070665_100426877 Ga0070665_1004268773 127
177 3300005548 Ga0070665_101013335 Ga0070665_1010133352 127
178 3300005549 Ga0070704_101274860 Ga0070704_1012748602 127
179 3300005563 Ga0068855_100000724 Ga0068855_10000072417 127
180 3300005563 Ga0068855_100000927 Ga0068855_10000092723 127
181 3300005563 Ga0068855_100383806 Ga0068855_1003838062 127
182 3300005563 Ga0068855_101922025 Ga0068855_1019220251 127
183 3300005564 Ga0070664_100098480 Ga0070664_1000984803 127
184 3300005564 Ga0070664_100675260 Ga0070664_1006752602 127
185 3300005577 Ga0068857_100019122 Ga0068857_1000191225 127
186 3300005577 Ga0068857_100158203 Ga0068857_1001582033 127
187 3300005577 Ga0068857_100255065 Ga0068857_1002550652 127
188 3300005578 Ga0068854_100120839 Ga0068854_1001208392 127
189 3300005578 Ga0068854_100171997 Ga0068854_1001719972 127
190 3300005614 Ga0068856_100579425 Ga0068856_1005794252 127
191 3300005614 Ga0068856_101565361 Ga0068856_1015653611 127
192 3300005615 Ga0070702_100244862 Ga0070702_1002448623 127
193 3300005615 Ga0070702_100968243 Ga0070702_1009682431 127
194 3300005616 Ga0068852_100080977 Ga0068852_1000809772 127
195 3300005616 Ga0068852_100180785 Ga0068852_1001807853 127
196 3300005616 Ga0068852_100607100 Ga0068852_1006071003 127
197 3300005616 Ga0068852_100700147 Ga0068852_1007001472 127
198 3300005616 Ga0068852_102194904 Ga0068852_1021949041 127
199 3300005617 Ga0068859_100063354 Ga0068859_1000633543 127
200 3300005617 Ga0068859_100076736 Ga0068859_1000767363 127
201 3300005617 Ga0068859_100134591 Ga0068859_1001345912 127
202 3300005617 Ga0068859_100227856 Ga0068859_1002278561 127
203 3300005618 Ga0068864_100002531 Ga0068864_1000025313 127
204 3300005618 Ga0068864_100128875 Ga0068864_1001288754 127
205 3300005618 Ga0068864_101370619 Ga0068864_1013706192 127
206 3300005618 Ga0068864_101411317 Ga0068864_1014113172 127
207 3300005719 Ga0068861_100028581 Ga0068861_1000285814 127
208 3300005719 Ga0068861_100477771 Ga0068861_1004777712 127
209 3300005719 Ga0068861_101973436 Ga0068861_1019734361 127
210 3300005719 Ga0068861_102352491 Ga0068861_1023524912 127
211 3300005834 Ga0068851_10199488 Ga0068851_101994881 127
212 3300005834 Ga0068851_10203737 Ga0068851_102037372 127
213 3300005834 Ga0068851_10907477 Ga0068851_109074772 127
214 3300005841 Ga0068863_100032677 Ga0068863_1000326772 127
215 3300005841 Ga0068863_100296933 Ga0068863_1002969332 127
216 3300005841 Ga0068863_100587921 Ga0068863_1005879212 127
217 3300005842 Ga0068858_100374164 Ga0068858_1003741643 127
218 3300005843 Ga0068860_100000029 Ga0068860_100000029122 127
219 3300005843 Ga0068860_101008134 Ga0068860_1010081341 127
220 3300005843 Ga0068860_101420467 Ga0068860_1014204671 127
221 3300005844 Ga0068862_100862405 Ga0068862_1008624052 127
222 3300006163 Ga0070715_10129318 Ga0070715_101293182 127
223 3300006237 Ga0097621_100031989 Ga0097621_1000319893 127
224 3300006237 Ga0097621_100130827 Ga0097621_1001308272 127
225 3300006237 Ga0097621_100442904 Ga0097621_1004429041 127
226 3300006358 Ga0068871_100089275 Ga0068871_1000892753 127
227 3300006358 Ga0068871_100202020 Ga0068871_1002020202 127
228 3300006358 Ga0068871_100338583 Ga0068871_1003385832 127
229 3300006358 Ga0068871_101405280 Ga0068871_1014052801 127
230 3300006881 Ga0068865_100053930 Ga0068865_1000539304 127
231 3300006881 Ga0068865_100580498 Ga0068865_1005804982 127
232 3300006931 Ga0097620_100063358 Ga0097620_1000633583 127
233 3300006931 Ga0097620_100076731 Ga0097620_1000767313 127
234 3300006931 Ga0097620_100134605 Ga0097620_1001346052 127
235 3300006931 Ga0097620_100227853 Ga0097620_1002278533 127
236 3300009011 Ga0105251_10056649 Ga0105251_100566492 127
237 3300009093 Ga0105240_10016952 Ga0105240_100169526 127
238 3300009093 Ga0105240_10283133 Ga0105240_102831333 127
239 3300009093 Ga0105240_10367652 Ga0105240_103676521 127
240 3300009098 Ga0105245_10061178 Ga0105245_100611782 127
241 3300009101 Ga0105247_10214325 Ga0105247_102143252 127
242 3300009174 Ga0105241_10032972 Ga0105241_100329725 127
243 3300009174 Ga0105241_10885818 Ga0105241_108858182 127
244 3300009174 Ga0105241_11035083 Ga0105241_110350832 127
245 3300009174 Ga0105241_11843117 Ga0105241_118431172 127
246 3300009174 Ga0105241_11891226 Ga0105241_118912261 127
247 3300009176 Ga0105242_10117909 Ga0105242_101179093 127
248 3300009177 Ga0105248_10048177 Ga0105248_100481777 127
249 3300009177 Ga0105248_10439728 Ga0105248_104397283 127
250 3300009177 Ga0105248_10604362 Ga0105248_106043622 127
251 3300009545 Ga0105237_10577580 Ga0105237_105775802 127
252 3300009545 Ga0105237_11929436 Ga0105237_119294362 127
253 3300009551 Ga0105238_10032963 Ga0105238_100329632 127
254 3300009551 Ga0105238_11103604 Ga0105238_111036042 127
255 3300009553 Ga0105249_10024556 Ga0105249_100245564 127
256 3300009553 Ga0105249_12836241 Ga0105249_128362411 127
257 3300010375 Ga0105239_10020511 Ga0105239_100205118 127
258 3300010375 Ga0105239_10537236 Ga0105239_105372361 127
259 3300010375 Ga0105239_11632326 Ga0105239_116323261 127
260 3300010375 Ga0105239_12712977 Ga0105239_127129772 127
261 3300011119 Ga0105246_10413660 Ga0105246_104136601 127
262 3300013100 Ga0157373_10808967 Ga0157373_108089671 127
263 3300013102 Ga0157371_10040616 Ga0157371_100406163 127
264 3300013104 Ga0157370_10780671 Ga0157370_107806712 127
265 3300013105 Ga0157369_10477211 Ga0157369_104772113 127
266 3300013105 Ga0157369_10723713 Ga0157369_107237132 127
267 3300013105 Ga0157369_11174950 Ga0157369_111749501 127
268 3300013105 Ga0157369_12681929 Ga0157369_126819291 127
269 3300013296 Ga0157374_10006069 Ga0157374_100060696 127
270 3300013296 Ga0157374_10091709 Ga0157374_100917092 127
271 3300013296 Ga0157374_10092143 Ga0157374_100921434 127
272 3300013296 Ga0157374_10120046 Ga0157374_101200463 127
273 3300013296 Ga0157374_10141265 Ga0157374_101412653 127
274 3300013296 Ga0157374_10340572 Ga0157374_103405722 127
275 3300013296 Ga0157374_10730489 Ga0157374_107304891 127
276 3300013296 Ga0157374_11348199 Ga0157374_113481991 127
277 3300013296 Ga0157374_11488022 Ga0157374_114880221 127
278 3300013297 Ga0157378_10000981 Ga0157378_1000098127 127
279 3300013297 Ga0157378_10308066 Ga0157378_103080661 127
280 3300013297 Ga0157378_10335702 Ga0157378_103357023 127
281 3300013297 Ga0157378_10733058 Ga0157378_107330582 127
282 3300013297 Ga0157378_11234220 Ga0157378_112342201 127
283 3300013297 Ga0157378_11396494 Ga0157378_113964941 127
284 3300013306 Ga0163162_10000038 Ga0163162_1000003898 127
285 3300013306 Ga0163162_10002178 Ga0163162_100021782 127
286 3300013306 Ga0163162_10002730 Ga0163162_100027309 127
287 3300013306 Ga0163162_10003086 Ga0163162_1000308614 127
288 3300013306 Ga0163162_10134788 Ga0163162_101347883 127
289 3300013306 Ga0163162_10147073 Ga0163162_101470732 127
290 3300013306 Ga0163162_10243148 Ga0163162_102431482 127
291 3300013306 Ga0163162_10338372 Ga0163162_103383723 127
292 3300013306 Ga0163162_13447134 Ga0163162_134471342 127
293 3300013307 Ga0157372_10471168 Ga0157372_104711682 127
294 3300013307 Ga0157372_10574727 Ga0157372_105747273 127
295 3300013307 Ga0157372_10666972 Ga0157372_106669721 127
296 3300013307 Ga0157372_12059820 Ga0157372_120598202 127
297 3300013308 Ga0157375_10002648 Ga0157375_1000264813 127
298 3300013308 Ga0157375_10008218 Ga0157375_100082184 127
299 3300013308 Ga0157375_10106132 Ga0157375_101061323 127
300 3300013308 Ga0157375_10119101 Ga0157375_101191012 127
301 3300013308 Ga0157375_10322940 Ga0157375_103229402 127
302 3300014325 Ga0163163_10014243 Ga0163163_100142437 127
303 3300014325 Ga0163163_10017923 Ga0163163_1001792310 127
304 3300014325 Ga0163163_10155766 Ga0163163_101557662 127
305 3300014325 Ga0163163_10612392 Ga0163163_106123922 127
306 3300014325 Ga0163163_11313968 Ga0163163_113139681 127
307 3300014326 Ga0157380_10087741 Ga0157380_100877413 127
308 3300014745 Ga0157377_10066663 Ga0157377_100666632 127
309 3300014745 Ga0157377_10250097 Ga0157377_102500972 127
310 3300014745 Ga0157377_11337933 Ga0157377_113379331 127
311 3300014968 Ga0157379_10179828 Ga0157379_101798283 127
312 3300014968 Ga0157379_10479891 Ga0157379_104798912 127
313 3300014969 Ga0157376_10030234 Ga0157376_100302345 127
314 3300014969 Ga0157376_10077146 Ga0157376_100771464 127
315 3300014969 Ga0157376_10141895 Ga0157376_101418952 127
316 3300014969 Ga0157376_10293111 Ga0157376_102931112 127
317 3300014969 Ga0157376_11457918 Ga0157376_114579182 127
318 3300017792 Ga0163161_10163616 Ga0163161_101636162 127
319 3300017792 Ga0163161_10191387 Ga0163161_101913873 127
320 3300025735 Ga0207713_1056328 Ga0207713_10563282 127
321 3300025903 Ga0207680_10018300 Ga0207680_100183002 127
322 3300025903 Ga0207680_10145462 Ga0207680_101454621 127
323 3300025903 Ga0207680_10153916 Ga0207680_101539162 127
324 3300025903 Ga0207680_10372233 Ga0207680_103722332 127
325 3300025903 Ga0207680_10646889 Ga0207680_106468892 127
326 3300025904 Ga0207647_10005536 Ga0207647_100055367 127
327 3300025905 Ga0207685_10134973 Ga0207685_101349732 127
328 3300025907 Ga0207645_10017210 Ga0207645_100172103 127
329 3300025907 Ga0207645_10142060 Ga0207645_101420601 127
330 3300025907 Ga0207645_10173772 Ga0207645_101737721 127
331 3300025911 Ga0207654_10004350 Ga0207654_100043503 127
332 3300025913 Ga0207695_10001773 Ga0207695_1000177328 127
333 3300025914 Ga0207671_10010815 Ga0207671_100108153 127
334 3300025914 Ga0207671_10616759 Ga0207671_106167591 127
335 3300025919 Ga0207657_10050681 Ga0207657_100506813 127
336 3300025920 Ga0207649_10081692 Ga0207649_100816923 127
337 3300025920 Ga0207649_10084381 Ga0207649_100843812 127
338 3300025920 Ga0207649_10913209 Ga0207649_109132092 127
339 3300025923 Ga0207681_10285448 Ga0207681_102854482 127
340 3300025923 Ga0207681_11409538 Ga0207681_114095381 127
341 3300025925 Ga0207650_10030710 Ga0207650_100307102 127
342 3300025925 Ga0207650_10193114 Ga0207650_101931142 127
343 3300025925 Ga0207650_10299560 Ga0207650_102995603 127
344 3300025925 Ga0207650_10303307 Ga0207650_103033073 127
345 3300025926 Ga0207659_10061762 Ga0207659_100617622 127
346 3300025926 Ga0207659_10132492 Ga0207659_101324922 127
347 3300025926 Ga0207659_10245139 Ga0207659_102451393 127
348 3300025926 Ga0207659_10663951 Ga0207659_106639512 127
349 3300025931 Ga0207644_10098240 Ga0207644_100982403 127
350 3300025931 Ga0207644_10118440 Ga0207644_101184402 127
351 3300025931 Ga0207644_10178889 Ga0207644_101788893 127
352 3300025931 Ga0207644_10277410 Ga0207644_102774102 127
353 3300025931 Ga0207644_10292559 Ga0207644_102925592 127
354 3300025931 Ga0207644_11020904 Ga0207644_110209041 127
355 3300025932 Ga0207690_10844183 Ga0207690_108441831 127
356 3300025933 Ga0207706_10026986 Ga0207706_100269864 127
357 3300025933 Ga0207706_10208788 Ga0207706_102087881 127
358 3300025933 Ga0207706_10313103 Ga0207706_103131032 127
359 3300025933 Ga0207706_10565519 Ga0207706_105655192 127
360 3300025933 Ga0207706_10730336 Ga0207706_107303362 127
361 3300025934 Ga0207686_10090031 Ga0207686_100900313 127
362 3300025936 Ga0207670_10008906 Ga0207670_100089067 127
363 3300025936 Ga0207670_10161540 Ga0207670_101615403 127
364 3300025936 Ga0207670_10530886 Ga0207670_105308862 127
365 3300025937 Ga0207669_10393893 Ga0207669_103938932 127
366 3300025937 Ga0207669_11191313 Ga0207669_111913132 127
367 3300025938 Ga0207704_11183402 Ga0207704_111834022 127
368 3300025938 Ga0207704_11199536 Ga0207704_111995362 127
369 3300025940 Ga0207691_10357650 Ga0207691_103576502 127
370 3300025940 Ga0207691_11358904 Ga0207691_113589042 127
371 3300025941 Ga0207711_10342514 Ga0207711_103425143 127
372 3300025941 Ga0207711_10644403 Ga0207711_106444032 127
373 3300025942 Ga0207689_10008125 Ga0207689_100081252 127
374 3300025942 Ga0207689_10026642 Ga0207689_100266425 127
375 3300025942 Ga0207689_10126297 Ga0207689_101262973 127
376 3300025942 Ga0207689_10190613 Ga0207689_101906132 127
377 3300025944 Ga0207661_10189206 Ga0207661_101892062 127
378 3300025945 Ga0207679_10002211 Ga0207679_100022114 127
379 3300025945 Ga0207679_10130127 Ga0207679_101301272 127
380 3300025945 Ga0207679_10924362 Ga0207679_109243621 127
381 3300025949 Ga0207667_10000015 Ga0207667_10000015210 127
382 3300025949 Ga0207667_10006803 Ga0207667_100068033 127
383 3300025949 Ga0207667_10180531 Ga0207667_101805313 127
384 3300025960 Ga0207651_10097934 Ga0207651_100979344 127
385 3300025960 Ga0207651_10685806 Ga0207651_106858062 127
386 3300025972 Ga0207668_11655755 Ga0207668_116557551 127
387 3300025981 Ga0207640_10172678 Ga0207640_101726781 127
388 3300025981 Ga0207640_10267080 Ga0207640_102670803 127
389 3300025986 Ga0207658_10017481 Ga0207658_100174814 127
390 3300025986 Ga0207658_10631843 Ga0207658_106318432 127
391 3300026023 Ga0207677_10008694 Ga0207677_100086944 127
392 3300026023 Ga0207677_10121414 Ga0207677_101214142 127
393 3300026023 Ga0207677_10407263 Ga0207677_104072631 127
394 3300026023 Ga0207677_11177313 Ga0207677_111773131 127
395 3300026035 Ga0207703_10095267 Ga0207703_100952673 127
396 3300026035 Ga0207703_10362109 Ga0207703_103621092 127
397 3300026035 Ga0207703_11144896 Ga0207703_111448962 127
398 3300026035 Ga0207703_12174932 Ga0207703_121749321 127
399 3300026041 Ga0207639_10174851 Ga0207639_101748513 127
400 3300026041 Ga0207639_10812685 Ga0207639_108126852 127
401 3300026041 Ga0207639_10850373 Ga0207639_108503732 127
402 3300026067 Ga0207678_10017432 Ga0207678_100174322 127
403 3300026067 Ga0207678_10197864 Ga0207678_101978642 127
404 3300026067 Ga0207678_10214961 Ga0207678_102149612 127
405 3300026078 Ga0207702_10081671 Ga0207702_100816712 127
406 3300026078 Ga0207702_10389345 Ga0207702_103893453 127
407 3300026078 Ga0207702_10842469 Ga0207702_108424692 127
408 3300026088 Ga0207641_10024670 Ga0207641_100246707 127
409 3300026088 Ga0207641_10034573 Ga0207641_100345733 127
410 3300026088 Ga0207641_10375519 Ga0207641_103755191 127
411 3300026089 Ga0207648_10077055 Ga0207648_100770554 127
412 3300026089 Ga0207648_10159417 Ga0207648_101594172 127
413 3300026089 Ga0207648_10180304 Ga0207648_101803042 127
414 3300026089 Ga0207648_10297057 Ga0207648_102970572 127
415 3300026089 Ga0207648_11905501 Ga0207648_119055011 127
416 3300026095 Ga0207676_10030348 Ga0207676_100303483 127
417 3300026095 Ga0207676_10118637 Ga0207676_101186374 127
418 3300026095 Ga0207676_10242959 Ga0207676_102429592 127
419 3300026095 Ga0207676_11090285 Ga0207676_110902852 127
420 3300026116 Ga0207674_10006730 Ga0207674_100067304 127
421 3300026116 Ga0207674_10108465 Ga0207674_101084653 127
422 3300026116 Ga0207674_10403510 Ga0207674_104035102 127
423 3300026118 Ga0207675_100039339 Ga0207675_1000393394 127
424 3300026118 Ga0207675_100386879 Ga0207675_1003868792 127
425 3300026118 Ga0207675_100836956 Ga0207675_1008369562 127
426 3300026118 Ga0207675_101478152 Ga0207675_1014781522 127
427 3300026121 Ga0207683_10044988 Ga0207683_100449883 127
428 3300026121 Ga0207683_10073154 Ga0207683_100731543 127
429 3300026121 Ga0207683_10462282 Ga0207683_104622821 127
430 3300026121 Ga0207683_10569040 Ga0207683_105690402 127
431 3300026121 Ga0207683_10897055 Ga0207683_108970552 127
432 3300026142 Ga0207698_10094903 Ga0207698_100949033 127
433 3300026142 Ga0207698_10302461 Ga0207698_103024612 127
434 3300026142 Ga0207698_10351447 Ga0207698_103514472 127
435 3300028379 Ga0268266_10000016 Ga0268266_10000016274 127
436 3300028379 Ga0268266_10255479 Ga0268266_102554792 127
437 3300028379 Ga0268266_10488813 Ga0268266_104888132 127
438 3300028380 Ga0268265_10102663 Ga0268265_101026633 127
439 3300028381 Ga0268264_10000072 Ga0268264_10000072123 127
440 3300028381 Ga0268264_12226470 Ga0268264_122264702 127
441 3300028381 Ga0268264_12702543 Ga0268264_127025431 127
442 3300031251 Ga0265327_10000117 Ga0265327_1000011733 127
443 3300031507 Ga0307509_10201505 Ga0307509_102015052 127
444 3300035086 Ga0373934_0009251 Ga0373934_0009251_1427_1813 127
445 3300035089 Ga0373944_0158590 Ga0373944_0158590_355_741 127
446 3300035111 Ga0373923_0057494 Ga0373923_0057494_1122_1508 127
447 3300035117 Ga0373953_0178281 Ga0373953_0178281_333_719 127
448 3300035119 Ga0373956_0135708 Ga0373956_0135708_734_1120 127
449 3300035120 Ga0373957_0069756 Ga0373957_0069756_558_944 127
450 3300035172 Ga0373955_0004601 Ga0373955_0004601_3807_4193 127
451 3300035410 Ga0373924_0005807 Ga0373924_0005807_1477_1863 127
452 3300035724 Ga0373933_0015285 Ga0373933_0015285_3372_3758 127
453 3300036401 Ga0373937_0002667 Ga0373937_0002667_3461_3847 127
454 3300041512 Ga0451853_3096197 Ga0451853_3096197_103_489 127
455 3300042157 Ga0439458_0210098 Ga0439458_0210098_66_452 127
456 3300042876 Ga0451577_0437202 Ga0451577_0437202_41_427 127
457 3300044658 Ga0466972_0006105 Ga0466972_0006105_2986_3369 127
458 3300044658 Ga0466972_0011616 Ga0466972_0011616_505_900 127
459 3300044712 Ga0453684_0261181 Ga0453684_0261181_1288_1674 127
460 3300044735 Ga0466968_0070228 Ga0466968_0070228_212_595 127
461 3300044842 Ga0466957_0285595 Ga0466957_0285595_536_931 127
462 3300044901 Ga0466960_0461659 Ga0466960_0461659_46_429 127
463 3300045049 Ga0466959_0189649 Ga0466959_0189649_230_625 127
464 3300045051 Ga0451576_0752992 Ga0451576_0752992_550_936 127
465 3300045976 Ga0466967_0957546 Ga0466967_0957546_147_542 127
466 3300046454 Ga0495592_0022738 Ga0495592_0022738_354_740 127
467 3300046462 Ga0495651_0210869 Ga0495651_0210869_654_1037 127
468 3300046462 Ga0495651_0330618 Ga0495651_0330618_530_931 127
469 3300046507 Ga0495606_0020255 Ga0495606_0020255_354_752 127
470 3300046516 Ga0495628_0276315 Ga0495628_0276315_422_808 127
471 3300046517 Ga0495630_0008167 Ga0495630_0008167_3680_4066 127
472 3300046533 Ga0495640_0444630 Ga0495640_0444630_287_673 127
473 3300046535 Ga0495586_0441547 Ga0495586_0441547_126_512 127
474 3300046536 Ga0495587_0077260 Ga0495587_0077260_709_1095 127
475 3300046542 Ga0495597_0085074 Ga0495597_0085074_741_1124 127
476 3300046543 Ga0495645_0783366 Ga0495645_0783366_63_452 127
477 3300046559 Ga0495667_0681738 Ga0495667_0681738_124_510 127
478 3300046642 Ga0495634_0119377 Ga0495634_0119377_663_1049 127
479 3300046642 Ga0495634_0705340 Ga0495634_0705340_127_528 127
480 3300046648 Ga0495611_0094833 Ga0495611_0094833_793_1176 127
481 3300046660 Ga0495625_0067055 Ga0495625_0067055_210_593 127
482 3300046678 Ga0495599_0803272 Ga0495599_0803272_30_425 127
483 3300046680 Ga0495646_0197678 Ga0495646_0197678_465_851 127
484 3300046809 Ga0495600_0327829 Ga0495600_0327829_92_478 127
485 3300047317 Ga0495604_0048545 Ga0495604_0048545_2334_2720 127
486 3300047322 Ga0495680_0110530 Ga0495680_0110530_144_530 127
487 3300047443 Ga0495687_000004 Ga0495687_000004_398492_398875 127
488 3300047471 Ga0495684_0029757 Ga0495684_0029757_1969_2355 127
489 3300048903 Ga0496100_0213824 Ga0496100_0213824_244_630 127
490 3300048904 Ga0496101_0337650 Ga0496101_0337650_458_844 127
491 3300048907 Ga0496104_0335971 Ga0496104_0335971_212_613 127
492 3300048907 Ga0496104_0819159 Ga0496104_0819159_348_734 127
493 3300048908 Ga0496105_0829423 Ga0496105_0829423_231_623 127
494 3300048909 Ga0496106_0583575 Ga0496106_0583575_130_528 127
495 3300048911 Ga0496108_0277242 Ga0496108_0277242_689_1075 127
496 3300048912 Ga0496109_0796285 Ga0496109_0796285_197_583 127
497 3300048913 Ga0496110_0334733 Ga0496110_0334733_827_1213 127
498 3300048914 Ga0496111_0050742 Ga0496111_0050742_1865_2251 127
499 3300048917 Ga0496114_1328830 Ga0496114_1328830_206_592 127
500 3300049652 Ga0501202_090235 Ga0501202_090235_273_668 127
501 3300053085 Ga0495619_0046338 Ga0495619_0046338_86_472 127
502 3300053086 Ga0500578_0526566 Ga0500578_0526566_227_610 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

144

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9541 1 127
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9468 1 127
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8201 1 125
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8149 1 126
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8034 1 126
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9608 2 127 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9384 2 127 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9312 79 124 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8933 78 126 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8752 78 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A3S8S1R5-F1-model_v4 VOC family protein 0.9924 6 127
AF-A0A0B5D3C8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9906 12 126 GO:0051213
AF-A0A1B1NDE3-F1-model_v4 Lactoylglutathione lyase 0.9863 6 127 GO:0004462
GO:0046872
AF-A0A1H4CK38-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.986 74 126 GO:0051213
AF-V6L1F7-F1-model_v4 VOC domain-containing protein 0.9859 24 126

Feature Viewer

pLDDT pTM Quality
97.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map