F455799
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 238 | 496 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_100122224|Ga0070690_1001222242 |
| Length | 148 |
| Sequence | LKRSSSGRVLTFAVVNKYFKMRITFTSLLVDDQDKALKFYTNVLGFIKKTEIPMGKHKWLTVVSKEEQDGVELVLEPIAFEPAKVYQEELFKAGIPLTAFNVDDVDSEYERLVNLGVTFSMKPTEMGPTKLAVFSDTCGNNIQIFELL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 2 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 3 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 4 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 5 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 6 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 7 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 151 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 152 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 157 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 158 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 159 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 216 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 218 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 220 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 223 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 224 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 226 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 228 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 230 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 231 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 234 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 235 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 236 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 237 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 238 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.61 |
| Metatranscriptomes | 0 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.98 |
| Nodule | 0 |
| Rhizoplane | 3.19 |
| Rhizosphere | 89.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10039003 | 3300003316 | Unclassified | 3494 |
| 2 | rootH1_10039003 | 3300003323 | Bacteria | 2350 |
| 3 | rootL2_10074260 | 3300003322 | Bacteria | 18154 |
| 4 | rootH1_10034197 | 3300003323 | Bacteria | 19665 |
| 5 | rootH1_10071419 | 3300003323 | Bacteria | 2314 |
| 6 | Ga0065712_10190902 | 3300005290 | Bacteria | 1149 |
| 7 | Ga0065707_10318459 | 3300005295 | Bacteria | 971 |
| 8 | Ga0070658_10404778 | 3300005327 | Bacteria | 1172 |
| 9 | Ga0070676_10005217 | 3300005328 | Bacteria | 6907 |
| 10 | Ga0070676_10286009 | 3300005328 | Unclassified | 1113 |
| 11 | Ga0070676_10294802 | 3300005328 | Unclassified | 1097 |
| 12 | Ga0070683_100157311 | 3300005329 | Bacteria | 2156 |
| 13 | Ga0070683_100298060 | 3300005329 | Bacteria | 1534 |
| 14 | Ga0070690_100122224 | 3300005330 | Bacteria | 1748 |
| 15 | Ga0070690_100173196 | 3300005330 | Bacteria | 1486 |
| 16 | Ga0070690_100244489 | 3300005330 | Bacteria | 1267 |
| 17 | Ga0070670_100043725 | 3300005331 | Bacteria | 3850 |
| 18 | Ga0070670_100107374 | 3300005331 | Bacteria | 2406 |
| 19 | Ga0070670_100215468 | 3300005331 | Bacteria | 1670 |
| 20 | Ga0070670_100273613 | 3300005331 | Bacteria | 1474 |
| 21 | Ga0070670_100305355 | 3300005331 | Bacteria | 1392 |
| 22 | Ga0070670_100335359 | 3300005331 | Unclassified | 1327 |
| 23 | Ga0070670_100431325 | 3300005331 | Bacteria | 1166 |
| 24 | Ga0070670_100804839 | 3300005331 | Bacteria | 849 |
| 25 | Ga0070677_10820656 | 3300005333 | Bacteria | 532 |
| 26 | Ga0068869_100004070 | 3300005334 | Bacteria | 9050 |
| 27 | Ga0068869_100035028 | 3300005334 | Bacteria | 3556 |
| 28 | Ga0068869_100106052 | 3300005334 | Bacteria | 2132 |
| 29 | Ga0068869_100177717 | 3300005334 | Bacteria | 1667 |
| 30 | Ga0070666_10022917 | 3300005335 | Bacteria | 4061 |
| 31 | Ga0070666_10039776 | 3300005335 | Bacteria | 3136 |
| 32 | Ga0070666_10175843 | 3300005335 | Unclassified | 1501 |
| 33 | Ga0070666_10234752 | 3300005335 | Bacteria | 1296 |
| 34 | Ga0070682_100169719 | 3300005337 | Bacteria | 1515 |
| 35 | Ga0068868_100005165 | 3300005338 | Bacteria | 9164 |
| 36 | Ga0068868_100011564 | 3300005338 | Bacteria | 6428 |
| 37 | Ga0068868_100330759 | 3300005338 | Bacteria | 1300 |
| 38 | Ga0068868_100617364 | 3300005338 | Bacteria | 962 |
| 39 | Ga0068868_100680520 | 3300005338 | Bacteria | 919 |
| 40 | Ga0068868_101122057 | 3300005338 | Bacteria | 724 |
| 41 | Ga0070660_101611408 | 3300005339 | Bacteria | 552 |
| 42 | Ga0070660_101715141 | 3300005339 | Bacteria | 535 |
| 43 | Ga0070689_100004075 | 3300005340 | Bacteria | 9839 |
| 44 | Ga0070689_100021838 | 3300005340 | Bacteria | 4771 |
| 45 | Ga0070689_100782419 | 3300005340 | Bacteria | 838 |
| 46 | Ga0070689_101885846 | 3300005340 | Bacteria | 546 |
| 47 | Ga0070661_100018669 | 3300005344 | Bacteria | 4934 |
| 48 | Ga0070661_100065166 | 3300005344 | Bacteria | 2677 |
| 49 | Ga0070668_102017879 | 3300005347 | Unclassified | 532 |
| 50 | Ga0070669_101206045 | 3300005353 | Bacteria | 654 |
| 51 | Ga0070675_100204633 | 3300005354 | Unclassified | 1714 |
| 52 | Ga0070675_100221674 | 3300005354 | Bacteria | 1647 |
| 53 | Ga0070675_100642576 | 3300005354 | Bacteria | 964 |
| 54 | Ga0070671_100020886 | 3300005355 | Bacteria | 5341 |
| 55 | Ga0070671_100041838 | 3300005355 | Bacteria | 3808 |
| 56 | Ga0070671_100257010 | 3300005355 | Unclassified | 1484 |
| 57 | Ga0070671_100403644 | 3300005355 | Bacteria | 1169 |
| 58 | Ga0070671_101727270 | 3300005355 | Bacteria | 556 |
| 59 | Ga0070674_100047158 | 3300005356 | Bacteria | 2950 |
| 60 | Ga0070674_101419079 | 3300005356 | Unclassified | 622 |
| 61 | Ga0070673_100059631 | 3300005364 | Bacteria | 3022 |
| 62 | Ga0070673_100167375 | 3300005364 | Bacteria | 1874 |
| 63 | Ga0070673_100283449 | 3300005364 | Bacteria | 1454 |
| 64 | Ga0070673_100534566 | 3300005364 | Bacteria | 1063 |
| 65 | Ga0070688_100077834 | 3300005365 | Bacteria | 2138 |
| 66 | Ga0070688_100673686 | 3300005365 | Bacteria | 798 |
| 67 | Ga0070659_101101444 | 3300005366 | Bacteria | 700 |
| 68 | Ga0070667_100032022 | 3300005367 | Bacteria | 4384 |
| 69 | Ga0070667_100197965 | 3300005367 | Bacteria | 1782 |
| 70 | Ga0070667_100448838 | 3300005367 | Bacteria | 1178 |
| 71 | Ga0070713_101473003 | 3300005436 | Unclassified | 660 |
| 72 | Ga0070663_100191327 | 3300005455 | Bacteria | 1592 |
| 73 | Ga0070663_100314430 | 3300005455 | Unclassified | 1258 |
| 74 | Ga0070663_100394644 | 3300005455 | Bacteria | 1130 |
| 75 | Ga0070678_100033638 | 3300005456 | Bacteria | 3561 |
| 76 | Ga0070678_100280731 | 3300005456 | Bacteria | 1408 |
| 77 | Ga0070678_100379718 | 3300005456 | Bacteria | 1222 |
| 78 | Ga0070678_101264429 | 3300005456 | Bacteria | 686 |
| 79 | Ga0070662_100020905 | 3300005457 | Bacteria | 4464 |
| 80 | Ga0070662_100025032 | 3300005457 | Bacteria | 4118 |
| 81 | Ga0070662_100057988 | 3300005457 | Bacteria | 2816 |
| 82 | Ga0070662_100169800 | 3300005457 | Bacteria | 1712 |
| 83 | Ga0070662_100232341 | 3300005457 | Bacteria | 1476 |
| 84 | Ga0070681_10768921 | 3300005458 | Bacteria | 880 |
| 85 | Ga0068867_100016164 | 3300005459 | Bacteria | 5300 |
| 86 | Ga0068867_100076883 | 3300005459 | Bacteria | 2507 |
| 87 | Ga0068867_100109862 | 3300005459 | Bacteria | 2117 |
| 88 | Ga0070685_10061056 | 3300005466 | Bacteria | 2206 |
| 89 | Ga0070685_10188230 | 3300005466 | Bacteria | 1333 |
| 90 | Ga0070684_100005000 | 3300005535 | Bacteria | 10126 |
| 91 | Ga0070684_100233161 | 3300005535 | Bacteria | 1681 |
| 92 | Ga0070684_101024998 | 3300005535 | Bacteria | 775 |
| 93 | Ga0068853_100269331 | 3300005539 | Bacteria | 1568 |
| 94 | Ga0068853_101567151 | 3300005539 | Unclassified | 638 |
| 95 | Ga0068853_101567461 | 3300005539 | Bacteria | 638 |
| 96 | Ga0070672_100068140 | 3300005543 | Bacteria | 2822 |
| 97 | Ga0070672_100089614 | 3300005543 | Bacteria | 2479 |
| 98 | Ga0070672_101476486 | 3300005543 | Bacteria | 609 |
| 99 | Ga0070686_100026141 | 3300005544 | Bacteria | 3520 |
| 100 | Ga0070686_100450676 | 3300005544 | Bacteria | 989 |
| 101 | Ga0070686_100942016 | 3300005544 | Bacteria | 705 |
| 102 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 103 | Ga0070665_100334474 | 3300005548 | Bacteria | 1519 |
| 104 | Ga0070665_100426877 | 3300005548 | Bacteria | 1334 |
| 105 | Ga0070665_101013335 | 3300005548 | Bacteria | 843 |
| 106 | Ga0070704_101274860 | 3300005549 | Bacteria | 672 |
| 107 | Ga0068855_100000724 | 3300005563 | Bacteria | 40544 |
| 108 | Ga0068855_100000927 | 3300005563 | Bacteria | 36472 |
| 109 | Ga0068855_100383806 | 3300005563 | Bacteria | 1542 |
| 110 | Ga0068855_101869408 | 3300005563 | Unclassified | 609 |
| 111 | Ga0068855_101922025 | 3300005563 | Bacteria | 599 |
| 112 | Ga0070664_100098480 | 3300005564 | Bacteria | 2540 |
| 113 | Ga0070664_100675260 | 3300005564 | Bacteria | 961 |
| 114 | Ga0068857_100019122 | 3300005577 | Bacteria | 6012 |
| 115 | Ga0068857_100158203 | 3300005577 | Bacteria | 2055 |
| 116 | Ga0068857_100255065 | 3300005577 | Bacteria | 1609 |
| 117 | Ga0068854_100120839 | 3300005578 | Bacteria | 1989 |
| 118 | Ga0068854_100171997 | 3300005578 | Unclassified | 1686 |
| 119 | Ga0068854_100741350 | 3300005578 | Bacteria | 851 |
| 120 | Ga0068856_100579425 | 3300005614 | Bacteria | 1143 |
| 121 | Ga0068856_101565361 | 3300005614 | Bacteria | 672 |
| 122 | Ga0070702_100244862 | 3300005615 | Bacteria | 1212 |
| 123 | Ga0070702_100968243 | 3300005615 | Bacteria | 671 |
| 124 | Ga0068852_100080977 | 3300005616 | Bacteria | 2881 |
| 125 | Ga0068852_100180785 | 3300005616 | Bacteria | 1983 |
| 126 | Ga0068852_100607100 | 3300005616 | Bacteria | 1099 |
| 127 | Ga0068852_100700147 | 3300005616 | Bacteria | 1023 |
| 128 | Ga0068852_102194904 | 3300005616 | Bacteria | 574 |
| 129 | Ga0068859_100063354 | 3300005617 | Bacteria | 3728 |
| 130 | Ga0068859_100076736 | 3300005617 | Bacteria | 3382 |
| 131 | Ga0068859_100134591 | 3300005617 | Bacteria | 2543 |
| 132 | Ga0068859_100227856 | 3300005617 | Bacteria | 1952 |
| 133 | Ga0068864_100002531 | 3300005618 | Bacteria | 15099 |
| 134 | Ga0068864_100128875 | 3300005618 | Bacteria | 2270 |
| 135 | Ga0068864_101370619 | 3300005618 | Unclassified | 708 |
| 136 | Ga0068864_101411317 | 3300005618 | Bacteria | 698 |
| 137 | Ga0068864_101899909 | 3300005618 | Unclassified | 601 |
| 138 | Ga0068861_100028581 | 3300005719 | Bacteria | 4070 |
| 139 | Ga0068861_100477771 | 3300005719 | Unclassified | 1122 |
| 140 | Ga0068861_101973436 | 3300005719 | Bacteria | 582 |
| 141 | Ga0068861_102352491 | 3300005719 | Bacteria | 535 |
| 142 | Ga0068851_10199488 | 3300005834 | Bacteria | 1116 |
| 143 | Ga0068851_10203737 | 3300005834 | Unclassified | 1105 |
| 144 | Ga0068851_10859275 | 3300005834 | Unclassified | 566 |
| 145 | Ga0068851_10907477 | 3300005834 | Bacteria | 552 |
| 146 | Ga0068863_100032677 | 3300005841 | Bacteria | 4959 |
| 147 | Ga0068863_100296933 | 3300005841 | Bacteria | 1567 |
| 148 | Ga0068863_100587921 | 3300005841 | Bacteria | 1101 |
| 149 | Ga0068858_100374164 | 3300005842 | Bacteria | 1366 |
| 150 | Ga0068860_100000029 | 3300005843 | Bacteria | 259192 |
| 151 | Ga0068860_101008134 | 3300005843 | Unclassified | 851 |
| 152 | Ga0068860_101420467 | 3300005843 | Unclassified | 715 |
| 153 | Ga0068862_100862405 | 3300005844 | Bacteria | 888 |
| 154 | Ga0070715_10129318 | 3300006163 | Bacteria | 1214 |
| 155 | Ga0097621_100031989 | 3300006237 | Bacteria | 4179 |
| 156 | Ga0097621_100130827 | 3300006237 | Bacteria | 2136 |
| 157 | Ga0097621_100442904 | 3300006237 | Bacteria | 1169 |
| 158 | Ga0075370_10092173 | 3300006353 | Bacteria | 1748 |
| 159 | Ga0068871_100089275 | 3300006358 | Bacteria | 2565 |
| 160 | Ga0068871_100202020 | 3300006358 | Bacteria | 1716 |
| 161 | Ga0068871_100338583 | 3300006358 | Bacteria | 1328 |
| 162 | Ga0068871_101405280 | 3300006358 | Bacteria | 658 |
| 163 | Ga0068865_100053930 | 3300006881 | Bacteria | 2791 |
| 164 | Ga0068865_100580498 | 3300006881 | Unclassified | 945 |
| 165 | Ga0097620_100063358 | 3300006931 | Bacteria | 3728 |
| 166 | Ga0097620_100076731 | 3300006931 | Bacteria | 3382 |
| 167 | Ga0097620_100134605 | 3300006931 | Bacteria | 2543 |
| 168 | Ga0097620_100227853 | 3300006931 | Bacteria | 1952 |
| 169 | Ga0105251_10056649 | 3300009011 | Bacteria | 1855 |
| 170 | Ga0105240_10016952 | 3300009093 | Bacteria | 9842 |
| 171 | Ga0105240_10283133 | 3300009093 | Bacteria | 1903 |
| 172 | Ga0105240_10367652 | 3300009093 | Unclassified | 1627 |
| 173 | Ga0105245_10061178 | 3300009098 | Bacteria | 3393 |
| 174 | Ga0105247_10214325 | 3300009101 | Bacteria | 1300 |
| 175 | Ga0105241_10032972 | 3300009174 | Bacteria | 3885 |
| 176 | Ga0105241_10885818 | 3300009174 | Bacteria | 828 |
| 177 | Ga0105241_11035083 | 3300009174 | Bacteria | 770 |
| 178 | Ga0105241_11741520 | 3300009174 | Bacteria | 607 |
| 179 | Ga0105241_11843117 | 3300009174 | Unclassified | 591 |
| 180 | Ga0105241_11891226 | 3300009174 | Bacteria | 585 |
| 181 | Ga0105242_10117909 | 3300009176 | Bacteria | 2273 |
| 182 | Ga0105248_10048177 | 3300009177 | Bacteria | 4780 |
| 183 | Ga0105248_10439728 | 3300009177 | Bacteria | 1469 |
| 184 | Ga0105248_10604362 | 3300009177 | Bacteria | 1237 |
| 185 | Ga0105237_10577580 | 3300009545 | Bacteria | 1131 |
| 186 | Ga0105237_11929436 | 3300009545 | Unclassified | 599 |
| 187 | Ga0105238_10032963 | 3300009551 | Bacteria | 5272 |
| 188 | Ga0105238_11103604 | 3300009551 | Bacteria | 816 |
| 189 | Ga0105249_10024556 | 3300009553 | Bacteria | 5418 |
| 190 | Ga0105249_12836241 | 3300009553 | Bacteria | 556 |
| 191 | Ga0105239_10020511 | 3300010375 | Bacteria | 7289 |
| 192 | Ga0105239_10064892 | 3300010375 | Unclassified | 4009 |
| 193 | Ga0105239_10537236 | 3300010375 | Bacteria | 1331 |
| 194 | Ga0105239_11632326 | 3300010375 | Unclassified | 746 |
| 195 | Ga0105239_12712977 | 3300010375 | Unclassified | 578 |
| 196 | Ga0105246_10042029 | 3300011119 | Bacteria | 3094 |
| 197 | Ga0105246_10413660 | 3300011119 | Unclassified | 1123 |
| 198 | Ga0157373_10251026 | 3300013100 | Bacteria | 1251 |
| 199 | Ga0157373_10808967 | 3300013100 | Bacteria | 691 |
| 200 | Ga0157371_10040616 | 3300013102 | Bacteria | 3322 |
| 201 | Ga0157370_10001163 | 3300013104 | Bacteria | 32805 |
| 202 | Ga0157370_10780671 | 3300013104 | Bacteria | 870 |
| 203 | Ga0157369_10477211 | 3300013105 | Bacteria | 1291 |
| 204 | Ga0157369_10723713 | 3300013105 | Bacteria | 1024 |
| 205 | Ga0157369_11174950 | 3300013105 | Bacteria | 783 |
| 206 | Ga0157369_12681929 | 3300013105 | Unclassified | 502 |
| 207 | Ga0157374_10006069 | 3300013296 | Bacteria | 10225 |
| 208 | Ga0157374_10091709 | 3300013296 | Bacteria | 2898 |
| 209 | Ga0157374_10092143 | 3300013296 | Bacteria | 2891 |
| 210 | Ga0157374_10120046 | 3300013296 | Bacteria | 2536 |
| 211 | Ga0157374_10141265 | 3300013296 | Bacteria | 2338 |
| 212 | Ga0157374_10340572 | 3300013296 | Bacteria | 1489 |
| 213 | Ga0157374_10730489 | 3300013296 | Bacteria | 1004 |
| 214 | Ga0157374_11348199 | 3300013296 | Unclassified | 736 |
| 215 | Ga0157374_11488022 | 3300013296 | Bacteria | 700 |
| 216 | Ga0157378_10000981 | 3300013297 | Bacteria | 26109 |
| 217 | Ga0157378_10137169 | 3300013297 | Bacteria | 2269 |
| 218 | Ga0157378_10308066 | 3300013297 | Bacteria | 1535 |
| 219 | Ga0157378_10335702 | 3300013297 | Bacteria | 1472 |
| 220 | Ga0157378_10733058 | 3300013297 | Bacteria | 1010 |
| 221 | Ga0157378_11234220 | 3300013297 | Unclassified | 788 |
| 222 | Ga0157378_11396494 | 3300013297 | Bacteria | 743 |
| 223 | Ga0163162_10000038 | 3300013306 | Bacteria | 138065 |
| 224 | Ga0163162_10002178 | 3300013306 | Bacteria | 18377 |
| 225 | Ga0163162_10002730 | 3300013306 | Bacteria | 16751 |
| 226 | Ga0163162_10003086 | 3300013306 | Bacteria | 15916 |
| 227 | Ga0163162_10134788 | 3300013306 | Bacteria | 2580 |
| 228 | Ga0163162_10147073 | 3300013306 | Bacteria | 2473 |
| 229 | Ga0163162_10243148 | 3300013306 | Bacteria | 1931 |
| 230 | Ga0163162_10338372 | 3300013306 | Bacteria | 1637 |
| 231 | Ga0163162_13447134 | 3300013306 | Bacteria | 504 |
| 232 | Ga0157372_10471168 | 3300013307 | Bacteria | 1464 |
| 233 | Ga0157372_10574727 | 3300013307 | Bacteria | 1314 |
| 234 | Ga0157372_10666972 | 3300013307 | Bacteria | 1211 |
| 235 | Ga0157372_12059820 | 3300013307 | Unclassified | 656 |
| 236 | Ga0157375_10002648 | 3300013308 | Bacteria | 15501 |
| 237 | Ga0157375_10008218 | 3300013308 | Bacteria | 9133 |
| 238 | Ga0157375_10106132 | 3300013308 | Bacteria | 2900 |
| 239 | Ga0157375_10119101 | 3300013308 | Bacteria | 2747 |
| 240 | Ga0157375_10322940 | 3300013308 | Bacteria | 1708 |
| 241 | Ga0157375_12509908 | 3300013308 | Bacteria | 615 |
| 242 | Ga0163163_10014243 | 3300014325 | Bacteria | 7308 |
| 243 | Ga0163163_10017923 | 3300014325 | Bacteria | 6614 |
| 244 | Ga0163163_10155766 | 3300014325 | Unclassified | 2329 |
| 245 | Ga0163163_10612392 | 3300014325 | Bacteria | 1152 |
| 246 | Ga0163163_11313968 | 3300014325 | Unclassified | 785 |
| 247 | Ga0157380_10087741 | 3300014326 | Bacteria | 2558 |
| 248 | Ga0157377_10066663 | 3300014745 | Bacteria | 2070 |
| 249 | Ga0157377_10250097 | 3300014745 | Bacteria | 1148 |
| 250 | Ga0157377_11337933 | 3300014745 | Bacteria | 562 |
| 251 | Ga0157379_10179828 | 3300014968 | Bacteria | 1911 |
| 252 | Ga0157379_10479891 | 3300014968 | Bacteria | 1150 |
| 253 | Ga0157376_10030234 | 3300014969 | Bacteria | 4323 |
| 254 | Ga0157376_10077146 | 3300014969 | Bacteria | 2849 |
| 255 | Ga0157376_10141895 | 3300014969 | Bacteria | 2156 |
| 256 | Ga0157376_10293111 | 3300014969 | Bacteria | 1537 |
| 257 | Ga0157376_11457918 | 3300014969 | Unclassified | 717 |
| 258 | Ga0182006_1192757 | 3300015261 | Bacteria | 677 |
| 259 | Ga0163161_10020433 | 3300017792 | Bacteria | 4646 |
| 260 | Ga0163161_10163616 | 3300017792 | Bacteria | 1698 |
| 261 | Ga0163161_10191387 | 3300017792 | Bacteria | 1573 |
| 262 | Ga0207713_1056328 | 3300025735 | Bacteria | 1528 |
| 263 | Ga0207680_10018300 | 3300025903 | Bacteria | 3721 |
| 264 | Ga0207680_10145462 | 3300025903 | Bacteria | 1575 |
| 265 | Ga0207680_10153916 | 3300025903 | Unclassified | 1535 |
| 266 | Ga0207680_10372233 | 3300025903 | Bacteria | 1006 |
| 267 | Ga0207680_10646889 | 3300025903 | Bacteria | 757 |
| 268 | Ga0207647_10005536 | 3300025904 | Bacteria | 9246 |
| 269 | Ga0207685_10134973 | 3300025905 | Bacteria | 1100 |
| 270 | Ga0207645_10017210 | 3300025907 | Bacteria | 4775 |
| 271 | Ga0207645_10142060 | 3300025907 | Bacteria | 1565 |
| 272 | Ga0207645_10173772 | 3300025907 | Bacteria | 1412 |
| 273 | Ga0207654_10004350 | 3300025911 | Bacteria | 7138 |
| 274 | Ga0207654_10029732 | 3300025911 | Bacteria | 2994 |
| 275 | Ga0207695_10001773 | 3300025913 | Bacteria | 34055 |
| 276 | Ga0207671_10010815 | 3300025914 | Bacteria | 7488 |
| 277 | Ga0207671_10616759 | 3300025914 | Bacteria | 864 |
| 278 | Ga0207657_10050681 | 3300025919 | Bacteria | 3612 |
| 279 | Ga0207649_10081692 | 3300025920 | Bacteria | 2093 |
| 280 | Ga0207649_10084381 | 3300025920 | Bacteria | 2065 |
| 281 | Ga0207649_10913209 | 3300025920 | Bacteria | 689 |
| 282 | Ga0207681_10285448 | 3300025923 | Bacteria | 1301 |
| 283 | Ga0207681_11409538 | 3300025923 | Bacteria | 585 |
| 284 | Ga0207650_10030710 | 3300025925 | Bacteria | 3873 |
| 285 | Ga0207650_10193114 | 3300025925 | Bacteria | 1628 |
| 286 | Ga0207650_10299560 | 3300025925 | Bacteria | 1313 |
| 287 | Ga0207650_10303307 | 3300025925 | Bacteria | 1305 |
| 288 | Ga0207650_10697187 | 3300025925 | Bacteria | 858 |
| 289 | Ga0207659_10061762 | 3300025926 | Bacteria | 2702 |
| 290 | Ga0207659_10132492 | 3300025926 | Bacteria | 1926 |
| 291 | Ga0207659_10245139 | 3300025926 | Bacteria | 1451 |
| 292 | Ga0207659_10663951 | 3300025926 | Bacteria | 891 |
| 293 | Ga0207644_10098240 | 3300025931 | Bacteria | 2194 |
| 294 | Ga0207644_10118440 | 3300025931 | Bacteria | 2012 |
| 295 | Ga0207644_10178889 | 3300025931 | Bacteria | 1661 |
| 296 | Ga0207644_10277410 | 3300025931 | Bacteria | 1345 |
| 297 | Ga0207644_10292559 | 3300025931 | Bacteria | 1310 |
| 298 | Ga0207644_11020904 | 3300025931 | Bacteria | 694 |
| 299 | Ga0207690_10844183 | 3300025932 | Bacteria | 758 |
| 300 | Ga0207706_10026986 | 3300025933 | Bacteria | 5138 |
| 301 | Ga0207706_10208788 | 3300025933 | Bacteria | 1712 |
| 302 | Ga0207706_10313103 | 3300025933 | Bacteria | 1366 |
| 303 | Ga0207706_10565519 | 3300025933 | Bacteria | 978 |
| 304 | Ga0207706_10571176 | 3300025933 | Bacteria | 973 |
| 305 | Ga0207706_10730336 | 3300025933 | Unclassified | 845 |
| 306 | Ga0207686_10090031 | 3300025934 | Bacteria | 2023 |
| 307 | Ga0207670_10008906 | 3300025936 | Bacteria | 5690 |
| 308 | Ga0207670_10161540 | 3300025936 | Bacteria | 1672 |
| 309 | Ga0207670_10530886 | 3300025936 | Bacteria | 959 |
| 310 | Ga0207669_10393893 | 3300025937 | Unclassified | 1083 |
| 311 | Ga0207669_11191313 | 3300025937 | Unclassified | 645 |
| 312 | Ga0207704_11183402 | 3300025938 | Bacteria | 651 |
| 313 | Ga0207704_11199536 | 3300025938 | Unclassified | 647 |
| 314 | Ga0207691_10357650 | 3300025940 | Bacteria | 1249 |
| 315 | Ga0207691_11358904 | 3300025940 | Unclassified | 585 |
| 316 | Ga0207711_10342514 | 3300025941 | Bacteria | 1384 |
| 317 | Ga0207711_10644403 | 3300025941 | Bacteria | 988 |
| 318 | Ga0207689_10008125 | 3300025942 | Bacteria | 9153 |
| 319 | Ga0207689_10026642 | 3300025942 | Bacteria | 4842 |
| 320 | Ga0207689_10126297 | 3300025942 | Bacteria | 2104 |
| 321 | Ga0207689_10190613 | 3300025942 | Bacteria | 1691 |
| 322 | Ga0207661_10189206 | 3300025944 | Bacteria | 1803 |
| 323 | Ga0207661_10764161 | 3300025944 | Bacteria | 890 |
| 324 | Ga0207679_10002211 | 3300025945 | Bacteria | 12015 |
| 325 | Ga0207679_10130127 | 3300025945 | Bacteria | 2018 |
| 326 | Ga0207679_10147013 | 3300025945 | Bacteria | 1913 |
| 327 | Ga0207679_10924362 | 3300025945 | Unclassified | 798 |
| 328 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 329 | Ga0207667_10006803 | 3300025949 | Bacteria | 13811 |
| 330 | Ga0207667_10180531 | 3300025949 | Bacteria | 2168 |
| 331 | Ga0207651_10097934 | 3300025960 | Bacteria | 2167 |
| 332 | Ga0207651_10685806 | 3300025960 | Bacteria | 901 |
| 333 | Ga0207668_11655755 | 3300025972 | Unclassified | 578 |
| 334 | Ga0207640_10172678 | 3300025981 | Bacteria | 1612 |
| 335 | Ga0207640_10267080 | 3300025981 | Unclassified | 1336 |
| 336 | Ga0207658_10017481 | 3300025986 | Bacteria | 4943 |
| 337 | Ga0207658_10229298 | 3300025986 | Bacteria | 1567 |
| 338 | Ga0207658_10631843 | 3300025986 | Unclassified | 964 |
| 339 | Ga0207677_10008694 | 3300026023 | Bacteria | 5686 |
| 340 | Ga0207677_10121414 | 3300026023 | Bacteria | 1966 |
| 341 | Ga0207677_10407263 | 3300026023 | Unclassified | 1155 |
| 342 | Ga0207677_11177313 | 3300026023 | Bacteria | 701 |
| 343 | Ga0207703_10095267 | 3300026035 | Unclassified | 2511 |
| 344 | Ga0207703_10362109 | 3300026035 | Bacteria | 1338 |
| 345 | Ga0207703_11144896 | 3300026035 | Bacteria | 748 |
| 346 | Ga0207703_12174932 | 3300026035 | Bacteria | 531 |
| 347 | Ga0207639_10174851 | 3300026041 | Bacteria | 1822 |
| 348 | Ga0207639_10812685 | 3300026041 | Bacteria | 871 |
| 349 | Ga0207639_10850373 | 3300026041 | Unclassified | 852 |
| 350 | Ga0207678_10017432 | 3300026067 | Bacteria | 6308 |
| 351 | Ga0207678_10197864 | 3300026067 | Bacteria | 1718 |
| 352 | Ga0207678_10214961 | 3300026067 | Bacteria | 1645 |
| 353 | Ga0207678_10822234 | 3300026067 | Bacteria | 820 |
| 354 | Ga0207702_10081671 | 3300026078 | Bacteria | 2808 |
| 355 | Ga0207702_10389345 | 3300026078 | Bacteria | 1342 |
| 356 | Ga0207702_10842469 | 3300026078 | Bacteria | 907 |
| 357 | Ga0207641_10024670 | 3300026088 | Bacteria | 4956 |
| 358 | Ga0207641_10034573 | 3300026088 | Bacteria | 4206 |
| 359 | Ga0207641_10375519 | 3300026088 | Bacteria | 1360 |
| 360 | Ga0207648_10077055 | 3300026089 | Bacteria | 2906 |
| 361 | Ga0207648_10159417 | 3300026089 | Bacteria | 1993 |
| 362 | Ga0207648_10180304 | 3300026089 | Bacteria | 1869 |
| 363 | Ga0207648_10297057 | 3300026089 | Bacteria | 1448 |
| 364 | Ga0207648_11905501 | 3300026089 | Bacteria | 556 |
| 365 | Ga0207676_10030348 | 3300026095 | Bacteria | 4057 |
| 366 | Ga0207676_10118637 | 3300026095 | Bacteria | 2227 |
| 367 | Ga0207676_10242959 | 3300026095 | Bacteria | 1616 |
| 368 | Ga0207676_11090285 | 3300026095 | Bacteria | 789 |
| 369 | Ga0207674_10006730 | 3300026116 | Bacteria | 13496 |
| 370 | Ga0207674_10108465 | 3300026116 | Bacteria | 2753 |
| 371 | Ga0207674_10403510 | 3300026116 | Unclassified | 1321 |
| 372 | Ga0207675_100039339 | 3300026118 | Bacteria | 4414 |
| 373 | Ga0207675_100386879 | 3300026118 | Bacteria | 1376 |
| 374 | Ga0207675_100836956 | 3300026118 | Unclassified | 935 |
| 375 | Ga0207675_101478152 | 3300026118 | Bacteria | 700 |
| 376 | Ga0207683_10044988 | 3300026121 | Bacteria | 3860 |
| 377 | Ga0207683_10073154 | 3300026121 | Bacteria | 3032 |
| 378 | Ga0207683_10462282 | 3300026121 | Bacteria | 1170 |
| 379 | Ga0207683_10569040 | 3300026121 | Bacteria | 1048 |
| 380 | Ga0207683_10897055 | 3300026121 | Bacteria | 823 |
| 381 | Ga0207698_10094903 | 3300026142 | Bacteria | 2454 |
| 382 | Ga0207698_10302461 | 3300026142 | Bacteria | 1489 |
| 383 | Ga0207698_10351447 | 3300026142 | Unclassified | 1392 |
| 384 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 385 | Ga0268266_10255479 | 3300028379 | Bacteria | 1622 |
| 386 | Ga0268266_10488813 | 3300028379 | Bacteria | 1174 |
| 387 | Ga0268265_10102663 | 3300028380 | Bacteria | 2314 |
| 388 | Ga0268264_10000072 | 3300028381 | Bacteria | 260791 |
| 389 | Ga0268264_12226470 | 3300028381 | Unclassified | 556 |
| 390 | Ga0268264_12702543 | 3300028381 | Unclassified | 500 |
| 391 | Ga0307515_10367712 | 3300028794 | Bacteria | 1076 |
| 392 | Ga0265327_10000117 | 3300031251 | Bacteria | 173075 |
| 393 | Ga0307509_10201505 | 3300031507 | Bacteria | 1826 |
| 394 | Ga0373934_0009251 | 3300035086 | Bacteria | 3688 |
| 395 | Ga0373944_0158590 | 3300035089 | Bacteria | 801 |
| 396 | Ga0373923_0057494 | 3300035111 | Bacteria | 1645 |
| 397 | Ga0373953_0178281 | 3300035117 | Bacteria | 916 |
| 398 | Ga0373956_0135708 | 3300035119 | Bacteria | 1154 |
| 399 | Ga0373957_0069756 | 3300035120 | Bacteria | 1373 |
| 400 | Ga0373955_0004601 | 3300035172 | Bacteria | 6115 |
| 401 | Ga0373924_0005807 | 3300035410 | Bacteria | 4392 |
| 402 | Ga0373933_0015285 | 3300035724 | Bacteria | 4279 |
| 403 | Ga0373937_0002667 | 3300036401 | Bacteria | 14878 |
| 404 | Ga0451800_1372933 | 3300041459 | Bacteria | 574 |
| 405 | Ga0451853_3096197 | 3300041512 | Bacteria | 569 |
| 406 | Ga0439458_0210098 | 3300042157 | Unclassified | 534 |
| 407 | Ga0451577_0437202 | 3300042876 | Bacteria | 1188 |
| 408 | Ga0466972_0006105 | 3300044658 | Bacteria | 6052 |
| 409 | Ga0466972_0011616 | 3300044658 | Bacteria | 4422 |
| 410 | Ga0466964_0302008 | 3300044706 | Bacteria | 807 |
| 411 | Ga0453684_0261181 | 3300044712 | Unclassified | 1983 |
| 412 | Ga0466968_0070228 | 3300044735 | Bacteria | 1523 |
| 413 | Ga0466957_0285595 | 3300044842 | Bacteria | 1105 |
| 414 | Ga0466960_0461659 | 3300044901 | Bacteria | 739 |
| 415 | Ga0466959_0189649 | 3300045049 | Bacteria | 1435 |
| 416 | Ga0451576_0752992 | 3300045051 | Unclassified | 1023 |
| 417 | Ga0466967_0957546 | 3300045976 | Bacteria | 852 |
| 418 | Ga0495592_0022738 | 3300046454 | Bacteria | 4769 |
| 419 | Ga0495638_0016710 | 3300046460 | Bacteria | 4908 |
| 420 | Ga0495651_0210869 | 3300046462 | Bacteria | 1352 |
| 421 | Ga0495651_0330618 | 3300046462 | Unclassified | 1013 |
| 422 | Ga0495650_0011785 | 3300046471 | Bacteria | 4753 |
| 423 | Ga0495606_0020255 | 3300046507 | Bacteria | 4913 |
| 424 | Ga0495610_0032347 | 3300046512 | Bacteria | 2718 |
| 425 | Ga0495616_0001600 | 3300046513 | Bacteria | 15514 |
| 426 | Ga0495620_0026142 | 3300046515 | Bacteria | 2748 |
| 427 | Ga0495628_0276315 | 3300046516 | Bacteria | 1248 |
| 428 | Ga0495630_0008167 | 3300046517 | Bacteria | 7518 |
| 429 | Ga0495631_0000007 | 3300046518 | Bacteria | 130158 |
| 430 | Ga0495637_0039018 | 3300046520 | Bacteria | 2053 |
| 431 | Ga0495640_0444630 | 3300046533 | Bacteria | 792 |
| 432 | Ga0495586_0441547 | 3300046535 | Bacteria | 750 |
| 433 | Ga0495587_0077260 | 3300046536 | Bacteria | 1933 |
| 434 | Ga0495621_0007383 | 3300046539 | Bacteria | 3253 |
| 435 | Ga0495597_0085074 | 3300046542 | Bacteria | 1348 |
| 436 | Ga0495645_0783366 | 3300046543 | Unclassified | 573 |
| 437 | Ga0495667_0681738 | 3300046559 | Bacteria | 637 |
| 438 | Ga0495634_0119377 | 3300046642 | Bacteria | 1689 |
| 439 | Ga0495634_0705340 | 3300046642 | Unclassified | 580 |
| 440 | Ga0495611_0094833 | 3300046648 | Bacteria | 1381 |
| 441 | Ga0495625_0067055 | 3300046660 | Bacteria | 2527 |
| 442 | Ga0495625_0275377 | 3300046660 | Bacteria | 1084 |
| 443 | Ga0495588_0026645 | 3300046674 | Bacteria | 2888 |
| 444 | Ga0495599_0803272 | 3300046678 | Bacteria | 537 |
| 445 | Ga0495646_0197678 | 3300046680 | Bacteria | 1096 |
| 446 | Ga0495658_0015908 | 3300046683 | Bacteria | 3867 |
| 447 | Ga0495670_0040627 | 3300046691 | Bacteria | 2320 |
| 448 | Ga0495600_0327829 | 3300046809 | Bacteria | 962 |
| 449 | Ga0495600_0555319 | 3300046809 | Bacteria | 701 |
| 450 | Ga0495604_0048545 | 3300047317 | Bacteria | 3302 |
| 451 | Ga0495676_0000324 | 3300047321 | Bacteria | 38811 |
| 452 | Ga0495680_0110530 | 3300047322 | Bacteria | 2037 |
| 453 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 454 | Ga0495684_0029757 | 3300047471 | Bacteria | 4191 |
| 455 | Ga0495593_0000712 | 3300047673 | Bacteria | 19228 |
| 456 | Ga0495614_0010806 | 3300048089 | Bacteria | 4019 |
| 457 | Ga0496100_0213824 | 3300048903 | Bacteria | 1412 |
| 458 | Ga0496101_0337650 | 3300048904 | Bacteria | 1183 |
| 459 | Ga0496104_0335971 | 3300048907 | Bacteria | 1424 |
| 460 | Ga0496104_0819159 | 3300048907 | Bacteria | 837 |
| 461 | Ga0496105_0829423 | 3300048908 | Unclassified | 701 |
| 462 | Ga0496106_0583575 | 3300048909 | Unclassified | 896 |
| 463 | Ga0496107_0631611 | 3300048910 | Bacteria | 790 |
| 464 | Ga0496108_0277242 | 3300048911 | Bacteria | 1460 |
| 465 | Ga0496109_0796285 | 3300048912 | Bacteria | 883 |
| 466 | Ga0496110_0334733 | 3300048913 | Bacteria | 1379 |
| 467 | Ga0496111_0050742 | 3300048914 | Bacteria | 2994 |
| 468 | Ga0496114_1328830 | 3300048917 | Bacteria | 606 |
| 469 | Ga0496125_0035667 | 3300048928 | Bacteria | 4357 |
| 470 | Ga0496126_0170186 | 3300048929 | Bacteria | 1856 |
| 471 | Ga0501042_0469638 | 3300049578 | Bacteria | 913 |
| 472 | Ga0501202_090235 | 3300049652 | Bacteria | 732 |
| 473 | Ga0495619_0046338 | 3300053085 | Bacteria | 2859 |
| 474 | Ga0500578_0526566 | 3300053086 | Unclassified | 661 |
| 475 | Ga0500643_007846 | 3300053087 | Bacteria | 4252 |
| 476 | Ga0500651_0000044 | 3300053093 | Bacteria | 86444 |
| 477 | Ga0500566_0085802 | 3300053094 | Bacteria | 1746 |
| 478 | Ga0500562_026722 | 3300053108 | Bacteria | 1513 |
| 479 | Ga0500571_000243 | 3300053110 | Bacteria | 20532 |
| 480 | Ga0500608_025168 | 3300053122 | Bacteria | 2784 |
| 481 | Ga0500618_095548 | 3300053125 | Bacteria | 668 |
| 482 | Ga0500655_000060 | 3300053133 | Bacteria | 30372 |
| 483 | Ga0500658_0000028 | 3300053134 | Bacteria | 105688 |
| 484 | Ga0500658_0000094 | 3300053134 | Bacteria | 40740 |
| 485 | Ga0500659_0272912 | 3300053135 | Bacteria | 773 |
| 486 | Ga0500559_0052491 | 3300053136 | Bacteria | 1802 |
| 487 | Ga0500559_0053746 | 3300053136 | Bacteria | 1783 |
| 488 | Ga0500564_046316 | 3300053138 | Bacteria | 1995 |
| 489 | Ga0500568_0002455 | 3300053139 | Bacteria | 10900 |
| 490 | Ga0500573_0389791 | 3300053140 | Bacteria | 663 |
| 491 | Ga0500574_000124 | 3300053141 | Bacteria | 8468 |
| 492 | Ga0500619_262384 | 3300053154 | Bacteria | 566 |
| 493 | Ga0500619_273969 | 3300053154 | Bacteria | 550 |
| 494 | Ga0500624_017481 | 3300053157 | Bacteria | 1119 |
| 495 | Ga0500634_0019199 | 3300053161 | Bacteria | 3680 |
| 496 | Ga0500638_154335 | 3300053162 | Bacteria | 1017 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10404778 | Ga0070658_104047782 | 119 |
| 2 | 3300005339 | Ga0070660_101611408 | Ga0070660_1016114081 | 119 |
| 3 | 3300005340 | Ga0070689_101885846 | Ga0070689_1018858461 | 119 |
| 4 | 3300005563 | Ga0068855_101869408 | Ga0068855_1018694082 | 119 |
| 5 | 3300005578 | Ga0068854_100741350 | Ga0068854_1007413502 | 119 |
| 6 | 3300005618 | Ga0068864_101899909 | Ga0068864_1018999092 | 119 |
| 7 | 3300005834 | Ga0068851_10859275 | Ga0068851_108592752 | 119 |
| 8 | 3300009174 | Ga0105241_11741520 | Ga0105241_117415201 | 119 |
| 9 | 3300010375 | Ga0105239_10064892 | Ga0105239_100648925 | 119 |
| 10 | 3300013297 | Ga0157378_10137169 | Ga0157378_101371691 | 119 |
| 11 | 3300013308 | Ga0157375_12509908 | Ga0157375_125099081 | 119 |
| 12 | 3300025925 | Ga0207650_10697187 | Ga0207650_106971873 | 119 |
| 13 | 3300025944 | Ga0207661_10764161 | Ga0207661_107641611 | 119 |
| 14 | 3300025945 | Ga0207679_10147013 | Ga0207679_101470132 | 119 |
| 15 | 3300025986 | Ga0207658_10229298 | Ga0207658_102292982 | 119 |
| 16 | 3300025911 | Ga0207654_10029732 | Ga0207654_100297323 | 122 |
| 17 | iso_pu_bacteria | 2599185214 | 2599625846 | 122 |
| 18 | iso_pu_bacteria | 2599185226 | 2599675072 | 122 |
| 19 | iso_pu_bacteria | 2599185227 | 2599683966 | 122 |
| 20 | iso_pu_bacteria | 2599185229 | 2599695431 | 122 |
| 21 | iso_pu_bacteria | 2928070936 | 2928076393 | 122 |
| 22 | iso_pu_bacteria | 2928084124 | 2928090609 | 122 |
| 23 | iso_pu_bacteria | 2945945610 | 2945948498 | 122 |
| 24 | 3300026067 | Ga0207678_10822234 | Ga0207678_108222342 | 124 |
| 25 | 3300003323 | rootH1_10071419 | rootH1_100714192 | 126 |
| 26 | 3300005295 | Ga0065707_10318459 | Ga0065707_103184591 | 126 |
| 27 | 3300005331 | Ga0070670_100305355 | Ga0070670_1003053552 | 126 |
| 28 | 3300005457 | Ga0070662_100057988 | Ga0070662_1000579881 | 126 |
| 29 | 3300006353 | Ga0075370_10092173 | Ga0075370_100921732 | 126 |
| 30 | 3300011119 | Ga0105246_10042029 | Ga0105246_100420294 | 126 |
| 31 | 3300013100 | Ga0157373_10251026 | Ga0157373_102510262 | 126 |
| 32 | 3300013104 | Ga0157370_10001163 | Ga0157370_1000116331 | 126 |
| 33 | 3300015261 | Ga0182006_1192757 | Ga0182006_11927571 | 126 |
| 34 | 3300017792 | Ga0163161_10020433 | Ga0163161_100204333 | 126 |
| 35 | 3300025933 | Ga0207706_10571176 | Ga0207706_105711762 | 126 |
| 36 | 3300028794 | Ga0307515_10367712 | Ga0307515_103677122 | 126 |
| 37 | 3300041459 | Ga0451800_1372933 | Ga0451800_1372933_60_446 | 126 |
| 38 | 3300044706 | Ga0466964_0302008 | Ga0466964_0302008_55_447 | 126 |
| 39 | 3300046460 | Ga0495638_0016710 | Ga0495638_0016710_3026_3415 | 126 |
| 40 | 3300046471 | Ga0495650_0011785 | Ga0495650_0011785_141_557 | 126 |
| 41 | 3300046512 | Ga0495610_0032347 | Ga0495610_0032347_273_662 | 126 |
| 42 | 3300046513 | Ga0495616_0001600 | Ga0495616_0001600_6362_6751 | 126 |
| 43 | 3300046515 | Ga0495620_0026142 | Ga0495620_0026142_506_895 | 126 |
| 44 | 3300046518 | Ga0495631_0000007 | Ga0495631_0000007_105167_105556 | 126 |
| 45 | 3300046520 | Ga0495637_0039018 | Ga0495637_0039018_916_1305 | 126 |
| 46 | 3300046539 | Ga0495621_0007383 | Ga0495621_0007383_1277_1666 | 126 |
| 47 | 3300046660 | Ga0495625_0275377 | Ga0495625_0275377_245_634 | 126 |
| 48 | 3300046674 | Ga0495588_0026645 | Ga0495588_0026645_2418_2807 | 126 |
| 49 | 3300046683 | Ga0495658_0015908 | Ga0495658_0015908_96_485 | 126 |
| 50 | 3300046691 | Ga0495670_0040627 | Ga0495670_0040627_1162_1551 | 126 |
| 51 | 3300046809 | Ga0495600_0555319 | Ga0495600_0555319_76_465 | 126 |
| 52 | 3300047321 | Ga0495676_0000324 | Ga0495676_0000324_18194_18583 | 126 |
| 53 | 3300047673 | Ga0495593_0000712 | Ga0495593_0000712_12421_12810 | 126 |
| 54 | 3300048089 | Ga0495614_0010806 | Ga0495614_0010806_1228_1617 | 126 |
| 55 | 3300048910 | Ga0496107_0631611 | Ga0496107_0631611_297_686 | 126 |
| 56 | 3300048928 | Ga0496125_0035667 | Ga0496125_0035667_3813_4202 | 126 |
| 57 | 3300048929 | Ga0496126_0170186 | Ga0496126_0170186_1078_1467 | 126 |
| 58 | 3300049578 | Ga0501042_0469638 | Ga0501042_0469638_134_523 | 126 |
| 59 | 3300053087 | Ga0500643_007846 | Ga0500643_007846_1592_1981 | 126 |
| 60 | 3300053093 | Ga0500651_0000044 | Ga0500651_0000044_37080_37469 | 126 |
| 61 | 3300053094 | Ga0500566_0085802 | Ga0500566_0085802_399_788 | 126 |
| 62 | 3300053108 | Ga0500562_026722 | Ga0500562_026722_102_491 | 126 |
| 63 | 3300053110 | Ga0500571_000243 | Ga0500571_000243_8031_8420 | 126 |
| 64 | 3300053122 | Ga0500608_025168 | Ga0500608_025168_1284_1673 | 126 |
| 65 | 3300053125 | Ga0500618_095548 | Ga0500618_095548_262_651 | 126 |
| 66 | 3300053133 | Ga0500655_000060 | Ga0500655_000060_820_1209 | 126 |
| 67 | 3300053134 | Ga0500658_0000028 | Ga0500658_0000028_23017_23406 | 126 |
| 68 | 3300053134 | Ga0500658_0000094 | Ga0500658_0000094_15677_16066 | 126 |
| 69 | 3300053135 | Ga0500659_0272912 | Ga0500659_0272912_232_621 | 126 |
| 70 | 3300053136 | Ga0500559_0052491 | Ga0500559_0052491_153_542 | 126 |
| 71 | 3300053136 | Ga0500559_0053746 | Ga0500559_0053746_496_882 | 126 |
| 72 | 3300053138 | Ga0500564_046316 | Ga0500564_046316_347_733 | 126 |
| 73 | 3300053139 | Ga0500568_0002455 | Ga0500568_0002455_6398_6787 | 126 |
| 74 | 3300053140 | Ga0500573_0389791 | Ga0500573_0389791_175_564 | 126 |
| 75 | 3300053141 | Ga0500574_000124 | Ga0500574_000124_4355_4744 | 126 |
| 76 | 3300053154 | Ga0500619_262384 | Ga0500619_262384_62_448 | 126 |
| 77 | 3300053154 | Ga0500619_273969 | Ga0500619_273969_28_417 | 126 |
| 78 | 3300053157 | Ga0500624_017481 | Ga0500624_017481_147_536 | 126 |
| 79 | 3300053161 | Ga0500634_0019199 | Ga0500634_0019199_2293_2682 | 126 |
| 80 | 3300053162 | Ga0500638_154335 | Ga0500638_154335_309_698 | 126 |
| 81 | 3300003316 | rootH1_10039003 | rootH1_100390033 | 127 |
| 82 | 3300003322 | rootL2_10074260 | rootL2_1007426017 | 127 |
| 83 | 3300003323 | rootH1_10034197 | rootH1_1003419717 | 127 |
| 84 | 3300005290 | Ga0065712_10190902 | Ga0065712_101909022 | 127 |
| 85 | 3300005328 | Ga0070676_10005217 | Ga0070676_100052176 | 127 |
| 86 | 3300005328 | Ga0070676_10286009 | Ga0070676_102860091 | 127 |
| 87 | 3300005328 | Ga0070676_10294802 | Ga0070676_102948022 | 127 |
| 88 | 3300005329 | Ga0070683_100157311 | Ga0070683_1001573113 | 127 |
| 89 | 3300005329 | Ga0070683_100298060 | Ga0070683_1002980603 | 127 |
| 90 | 3300005330 | Ga0070690_100122224 | Ga0070690_1001222242 | 127 |
| 91 | 3300005330 | Ga0070690_100173196 | Ga0070690_1001731962 | 127 |
| 92 | 3300005330 | Ga0070690_100244489 | Ga0070690_1002444891 | 127 |
| 93 | 3300005331 | Ga0070670_100043725 | Ga0070670_1000437254 | 127 |
| 94 | 3300005331 | Ga0070670_100107374 | Ga0070670_1001073742 | 127 |
| 95 | 3300005331 | Ga0070670_100215468 | Ga0070670_1002154683 | 127 |
| 96 | 3300005331 | Ga0070670_100273613 | Ga0070670_1002736134 | 127 |
| 97 | 3300005331 | Ga0070670_100335359 | Ga0070670_1003353592 | 127 |
| 98 | 3300005331 | Ga0070670_100431325 | Ga0070670_1004313252 | 127 |
| 99 | 3300005331 | Ga0070670_100804839 | Ga0070670_1008048392 | 127 |
| 100 | 3300005333 | Ga0070677_10820656 | Ga0070677_108206561 | 127 |
| 101 | 3300005334 | Ga0068869_100004070 | Ga0068869_1000040703 | 127 |
| 102 | 3300005334 | Ga0068869_100035028 | Ga0068869_1000350283 | 127 |
| 103 | 3300005334 | Ga0068869_100106052 | Ga0068869_1001060523 | 127 |
| 104 | 3300005334 | Ga0068869_100177717 | Ga0068869_1001777172 | 127 |
| 105 | 3300005335 | Ga0070666_10022917 | Ga0070666_100229173 | 127 |
| 106 | 3300005335 | Ga0070666_10039776 | Ga0070666_100397763 | 127 |
| 107 | 3300005335 | Ga0070666_10175843 | Ga0070666_101758432 | 127 |
| 108 | 3300005335 | Ga0070666_10234752 | Ga0070666_102347522 | 127 |
| 109 | 3300005337 | Ga0070682_100169719 | Ga0070682_1001697191 | 127 |
| 110 | 3300005338 | Ga0068868_100005165 | Ga0068868_10000516511 | 127 |
| 111 | 3300005338 | Ga0068868_100011564 | Ga0068868_1000115644 | 127 |
| 112 | 3300005338 | Ga0068868_100330759 | Ga0068868_1003307592 | 127 |
| 113 | 3300005338 | Ga0068868_100617364 | Ga0068868_1006173642 | 127 |
| 114 | 3300005338 | Ga0068868_100680520 | Ga0068868_1006805201 | 127 |
| 115 | 3300005338 | Ga0068868_101122057 | Ga0068868_1011220572 | 127 |
| 116 | 3300005339 | Ga0070660_101715141 | Ga0070660_1017151411 | 127 |
| 117 | 3300005340 | Ga0070689_100004075 | Ga0070689_1000040753 | 127 |
| 118 | 3300005340 | Ga0070689_100021838 | Ga0070689_1000218382 | 127 |
| 119 | 3300005340 | Ga0070689_100782419 | Ga0070689_1007824191 | 127 |
| 120 | 3300005344 | Ga0070661_100018669 | Ga0070661_1000186694 | 127 |
| 121 | 3300005344 | Ga0070661_100065166 | Ga0070661_1000651663 | 127 |
| 122 | 3300005347 | Ga0070668_102017879 | Ga0070668_1020178791 | 127 |
| 123 | 3300005353 | Ga0070669_101206045 | Ga0070669_1012060451 | 127 |
| 124 | 3300005354 | Ga0070675_100204633 | Ga0070675_1002046333 | 127 |
| 125 | 3300005354 | Ga0070675_100221674 | Ga0070675_1002216742 | 127 |
| 126 | 3300005354 | Ga0070675_100642576 | Ga0070675_1006425762 | 127 |
| 127 | 3300005355 | Ga0070671_100020886 | Ga0070671_1000208863 | 127 |
| 128 | 3300005355 | Ga0070671_100041838 | Ga0070671_1000418382 | 127 |
| 129 | 3300005355 | Ga0070671_100257010 | Ga0070671_1002570102 | 127 |
| 130 | 3300005355 | Ga0070671_100403644 | Ga0070671_1004036442 | 127 |
| 131 | 3300005355 | Ga0070671_101727270 | Ga0070671_1017272701 | 127 |
| 132 | 3300005356 | Ga0070674_100047158 | Ga0070674_1000471582 | 127 |
| 133 | 3300005356 | Ga0070674_101419079 | Ga0070674_1014190791 | 127 |
| 134 | 3300005364 | Ga0070673_100059631 | Ga0070673_1000596313 | 127 |
| 135 | 3300005364 | Ga0070673_100167375 | Ga0070673_1001673753 | 127 |
| 136 | 3300005364 | Ga0070673_100283449 | Ga0070673_1002834491 | 127 |
| 137 | 3300005364 | Ga0070673_100534566 | Ga0070673_1005345661 | 127 |
| 138 | 3300005365 | Ga0070688_100077834 | Ga0070688_1000778343 | 127 |
| 139 | 3300005365 | Ga0070688_100673686 | Ga0070688_1006736862 | 127 |
| 140 | 3300005366 | Ga0070659_101101444 | Ga0070659_1011014442 | 127 |
| 141 | 3300005367 | Ga0070667_100032022 | Ga0070667_1000320225 | 127 |
| 142 | 3300005367 | Ga0070667_100197965 | Ga0070667_1001979652 | 127 |
| 143 | 3300005367 | Ga0070667_100448838 | Ga0070667_1004488382 | 127 |
| 144 | 3300005436 | Ga0070713_101473003 | Ga0070713_1014730031 | 127 |
| 145 | 3300005455 | Ga0070663_100191327 | Ga0070663_1001913272 | 127 |
| 146 | 3300005455 | Ga0070663_100314430 | Ga0070663_1003144302 | 127 |
| 147 | 3300005455 | Ga0070663_100394644 | Ga0070663_1003946442 | 127 |
| 148 | 3300005456 | Ga0070678_100033638 | Ga0070678_1000336382 | 127 |
| 149 | 3300005456 | Ga0070678_100280731 | Ga0070678_1002807312 | 127 |
| 150 | 3300005456 | Ga0070678_100379718 | Ga0070678_1003797182 | 127 |
| 151 | 3300005456 | Ga0070678_101264429 | Ga0070678_1012644291 | 127 |
| 152 | 3300005457 | Ga0070662_100020905 | Ga0070662_1000209055 | 127 |
| 153 | 3300005457 | Ga0070662_100025032 | Ga0070662_1000250323 | 127 |
| 154 | 3300005457 | Ga0070662_100169800 | Ga0070662_1001698003 | 127 |
| 155 | 3300005457 | Ga0070662_100232341 | Ga0070662_1002323411 | 127 |
| 156 | 3300005458 | Ga0070681_10768921 | Ga0070681_107689212 | 127 |
| 157 | 3300005459 | Ga0068867_100016164 | Ga0068867_1000161642 | 127 |
| 158 | 3300005459 | Ga0068867_100076883 | Ga0068867_1000768833 | 127 |
| 159 | 3300005459 | Ga0068867_100109862 | Ga0068867_1001098623 | 127 |
| 160 | 3300005466 | Ga0070685_10061056 | Ga0070685_100610562 | 127 |
| 161 | 3300005466 | Ga0070685_10188230 | Ga0070685_101882302 | 127 |
| 162 | 3300005535 | Ga0070684_100005000 | Ga0070684_1000050004 | 127 |
| 163 | 3300005535 | Ga0070684_100233161 | Ga0070684_1002331612 | 127 |
| 164 | 3300005535 | Ga0070684_101024998 | Ga0070684_1010249982 | 127 |
| 165 | 3300005539 | Ga0068853_100269331 | Ga0068853_1002693311 | 127 |
| 166 | 3300005539 | Ga0068853_101567151 | Ga0068853_1015671512 | 127 |
| 167 | 3300005539 | Ga0068853_101567461 | Ga0068853_1015674612 | 127 |
| 168 | 3300005543 | Ga0070672_100068140 | Ga0070672_1000681402 | 127 |
| 169 | 3300005543 | Ga0070672_100089614 | Ga0070672_1000896143 | 127 |
| 170 | 3300005543 | Ga0070672_101476486 | Ga0070672_1014764861 | 127 |
| 171 | 3300005544 | Ga0070686_100026141 | Ga0070686_1000261413 | 127 |
| 172 | 3300005544 | Ga0070686_100450676 | Ga0070686_1004506762 | 127 |
| 173 | 3300005544 | Ga0070686_100942016 | Ga0070686_1009420162 | 127 |
| 174 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008276 | 127 |
| 175 | 3300005548 | Ga0070665_100334474 | Ga0070665_1003344742 | 127 |
| 176 | 3300005548 | Ga0070665_100426877 | Ga0070665_1004268773 | 127 |
| 177 | 3300005548 | Ga0070665_101013335 | Ga0070665_1010133352 | 127 |
| 178 | 3300005549 | Ga0070704_101274860 | Ga0070704_1012748602 | 127 |
| 179 | 3300005563 | Ga0068855_100000724 | Ga0068855_10000072417 | 127 |
| 180 | 3300005563 | Ga0068855_100000927 | Ga0068855_10000092723 | 127 |
| 181 | 3300005563 | Ga0068855_100383806 | Ga0068855_1003838062 | 127 |
| 182 | 3300005563 | Ga0068855_101922025 | Ga0068855_1019220251 | 127 |
| 183 | 3300005564 | Ga0070664_100098480 | Ga0070664_1000984803 | 127 |
| 184 | 3300005564 | Ga0070664_100675260 | Ga0070664_1006752602 | 127 |
| 185 | 3300005577 | Ga0068857_100019122 | Ga0068857_1000191225 | 127 |
| 186 | 3300005577 | Ga0068857_100158203 | Ga0068857_1001582033 | 127 |
| 187 | 3300005577 | Ga0068857_100255065 | Ga0068857_1002550652 | 127 |
| 188 | 3300005578 | Ga0068854_100120839 | Ga0068854_1001208392 | 127 |
| 189 | 3300005578 | Ga0068854_100171997 | Ga0068854_1001719972 | 127 |
| 190 | 3300005614 | Ga0068856_100579425 | Ga0068856_1005794252 | 127 |
| 191 | 3300005614 | Ga0068856_101565361 | Ga0068856_1015653611 | 127 |
| 192 | 3300005615 | Ga0070702_100244862 | Ga0070702_1002448623 | 127 |
| 193 | 3300005615 | Ga0070702_100968243 | Ga0070702_1009682431 | 127 |
| 194 | 3300005616 | Ga0068852_100080977 | Ga0068852_1000809772 | 127 |
| 195 | 3300005616 | Ga0068852_100180785 | Ga0068852_1001807853 | 127 |
| 196 | 3300005616 | Ga0068852_100607100 | Ga0068852_1006071003 | 127 |
| 197 | 3300005616 | Ga0068852_100700147 | Ga0068852_1007001472 | 127 |
| 198 | 3300005616 | Ga0068852_102194904 | Ga0068852_1021949041 | 127 |
| 199 | 3300005617 | Ga0068859_100063354 | Ga0068859_1000633543 | 127 |
| 200 | 3300005617 | Ga0068859_100076736 | Ga0068859_1000767363 | 127 |
| 201 | 3300005617 | Ga0068859_100134591 | Ga0068859_1001345912 | 127 |
| 202 | 3300005617 | Ga0068859_100227856 | Ga0068859_1002278561 | 127 |
| 203 | 3300005618 | Ga0068864_100002531 | Ga0068864_1000025313 | 127 |
| 204 | 3300005618 | Ga0068864_100128875 | Ga0068864_1001288754 | 127 |
| 205 | 3300005618 | Ga0068864_101370619 | Ga0068864_1013706192 | 127 |
| 206 | 3300005618 | Ga0068864_101411317 | Ga0068864_1014113172 | 127 |
| 207 | 3300005719 | Ga0068861_100028581 | Ga0068861_1000285814 | 127 |
| 208 | 3300005719 | Ga0068861_100477771 | Ga0068861_1004777712 | 127 |
| 209 | 3300005719 | Ga0068861_101973436 | Ga0068861_1019734361 | 127 |
| 210 | 3300005719 | Ga0068861_102352491 | Ga0068861_1023524912 | 127 |
| 211 | 3300005834 | Ga0068851_10199488 | Ga0068851_101994881 | 127 |
| 212 | 3300005834 | Ga0068851_10203737 | Ga0068851_102037372 | 127 |
| 213 | 3300005834 | Ga0068851_10907477 | Ga0068851_109074772 | 127 |
| 214 | 3300005841 | Ga0068863_100032677 | Ga0068863_1000326772 | 127 |
| 215 | 3300005841 | Ga0068863_100296933 | Ga0068863_1002969332 | 127 |
| 216 | 3300005841 | Ga0068863_100587921 | Ga0068863_1005879212 | 127 |
| 217 | 3300005842 | Ga0068858_100374164 | Ga0068858_1003741643 | 127 |
| 218 | 3300005843 | Ga0068860_100000029 | Ga0068860_100000029122 | 127 |
| 219 | 3300005843 | Ga0068860_101008134 | Ga0068860_1010081341 | 127 |
| 220 | 3300005843 | Ga0068860_101420467 | Ga0068860_1014204671 | 127 |
| 221 | 3300005844 | Ga0068862_100862405 | Ga0068862_1008624052 | 127 |
| 222 | 3300006163 | Ga0070715_10129318 | Ga0070715_101293182 | 127 |
| 223 | 3300006237 | Ga0097621_100031989 | Ga0097621_1000319893 | 127 |
| 224 | 3300006237 | Ga0097621_100130827 | Ga0097621_1001308272 | 127 |
| 225 | 3300006237 | Ga0097621_100442904 | Ga0097621_1004429041 | 127 |
| 226 | 3300006358 | Ga0068871_100089275 | Ga0068871_1000892753 | 127 |
| 227 | 3300006358 | Ga0068871_100202020 | Ga0068871_1002020202 | 127 |
| 228 | 3300006358 | Ga0068871_100338583 | Ga0068871_1003385832 | 127 |
| 229 | 3300006358 | Ga0068871_101405280 | Ga0068871_1014052801 | 127 |
| 230 | 3300006881 | Ga0068865_100053930 | Ga0068865_1000539304 | 127 |
| 231 | 3300006881 | Ga0068865_100580498 | Ga0068865_1005804982 | 127 |
| 232 | 3300006931 | Ga0097620_100063358 | Ga0097620_1000633583 | 127 |
| 233 | 3300006931 | Ga0097620_100076731 | Ga0097620_1000767313 | 127 |
| 234 | 3300006931 | Ga0097620_100134605 | Ga0097620_1001346052 | 127 |
| 235 | 3300006931 | Ga0097620_100227853 | Ga0097620_1002278533 | 127 |
| 236 | 3300009011 | Ga0105251_10056649 | Ga0105251_100566492 | 127 |
| 237 | 3300009093 | Ga0105240_10016952 | Ga0105240_100169526 | 127 |
| 238 | 3300009093 | Ga0105240_10283133 | Ga0105240_102831333 | 127 |
| 239 | 3300009093 | Ga0105240_10367652 | Ga0105240_103676521 | 127 |
| 240 | 3300009098 | Ga0105245_10061178 | Ga0105245_100611782 | 127 |
| 241 | 3300009101 | Ga0105247_10214325 | Ga0105247_102143252 | 127 |
| 242 | 3300009174 | Ga0105241_10032972 | Ga0105241_100329725 | 127 |
| 243 | 3300009174 | Ga0105241_10885818 | Ga0105241_108858182 | 127 |
| 244 | 3300009174 | Ga0105241_11035083 | Ga0105241_110350832 | 127 |
| 245 | 3300009174 | Ga0105241_11843117 | Ga0105241_118431172 | 127 |
| 246 | 3300009174 | Ga0105241_11891226 | Ga0105241_118912261 | 127 |
| 247 | 3300009176 | Ga0105242_10117909 | Ga0105242_101179093 | 127 |
| 248 | 3300009177 | Ga0105248_10048177 | Ga0105248_100481777 | 127 |
| 249 | 3300009177 | Ga0105248_10439728 | Ga0105248_104397283 | 127 |
| 250 | 3300009177 | Ga0105248_10604362 | Ga0105248_106043622 | 127 |
| 251 | 3300009545 | Ga0105237_10577580 | Ga0105237_105775802 | 127 |
| 252 | 3300009545 | Ga0105237_11929436 | Ga0105237_119294362 | 127 |
| 253 | 3300009551 | Ga0105238_10032963 | Ga0105238_100329632 | 127 |
| 254 | 3300009551 | Ga0105238_11103604 | Ga0105238_111036042 | 127 |
| 255 | 3300009553 | Ga0105249_10024556 | Ga0105249_100245564 | 127 |
| 256 | 3300009553 | Ga0105249_12836241 | Ga0105249_128362411 | 127 |
| 257 | 3300010375 | Ga0105239_10020511 | Ga0105239_100205118 | 127 |
| 258 | 3300010375 | Ga0105239_10537236 | Ga0105239_105372361 | 127 |
| 259 | 3300010375 | Ga0105239_11632326 | Ga0105239_116323261 | 127 |
| 260 | 3300010375 | Ga0105239_12712977 | Ga0105239_127129772 | 127 |
| 261 | 3300011119 | Ga0105246_10413660 | Ga0105246_104136601 | 127 |
| 262 | 3300013100 | Ga0157373_10808967 | Ga0157373_108089671 | 127 |
| 263 | 3300013102 | Ga0157371_10040616 | Ga0157371_100406163 | 127 |
| 264 | 3300013104 | Ga0157370_10780671 | Ga0157370_107806712 | 127 |
| 265 | 3300013105 | Ga0157369_10477211 | Ga0157369_104772113 | 127 |
| 266 | 3300013105 | Ga0157369_10723713 | Ga0157369_107237132 | 127 |
| 267 | 3300013105 | Ga0157369_11174950 | Ga0157369_111749501 | 127 |
| 268 | 3300013105 | Ga0157369_12681929 | Ga0157369_126819291 | 127 |
| 269 | 3300013296 | Ga0157374_10006069 | Ga0157374_100060696 | 127 |
| 270 | 3300013296 | Ga0157374_10091709 | Ga0157374_100917092 | 127 |
| 271 | 3300013296 | Ga0157374_10092143 | Ga0157374_100921434 | 127 |
| 272 | 3300013296 | Ga0157374_10120046 | Ga0157374_101200463 | 127 |
| 273 | 3300013296 | Ga0157374_10141265 | Ga0157374_101412653 | 127 |
| 274 | 3300013296 | Ga0157374_10340572 | Ga0157374_103405722 | 127 |
| 275 | 3300013296 | Ga0157374_10730489 | Ga0157374_107304891 | 127 |
| 276 | 3300013296 | Ga0157374_11348199 | Ga0157374_113481991 | 127 |
| 277 | 3300013296 | Ga0157374_11488022 | Ga0157374_114880221 | 127 |
| 278 | 3300013297 | Ga0157378_10000981 | Ga0157378_1000098127 | 127 |
| 279 | 3300013297 | Ga0157378_10308066 | Ga0157378_103080661 | 127 |
| 280 | 3300013297 | Ga0157378_10335702 | Ga0157378_103357023 | 127 |
| 281 | 3300013297 | Ga0157378_10733058 | Ga0157378_107330582 | 127 |
| 282 | 3300013297 | Ga0157378_11234220 | Ga0157378_112342201 | 127 |
| 283 | 3300013297 | Ga0157378_11396494 | Ga0157378_113964941 | 127 |
| 284 | 3300013306 | Ga0163162_10000038 | Ga0163162_1000003898 | 127 |
| 285 | 3300013306 | Ga0163162_10002178 | Ga0163162_100021782 | 127 |
| 286 | 3300013306 | Ga0163162_10002730 | Ga0163162_100027309 | 127 |
| 287 | 3300013306 | Ga0163162_10003086 | Ga0163162_1000308614 | 127 |
| 288 | 3300013306 | Ga0163162_10134788 | Ga0163162_101347883 | 127 |
| 289 | 3300013306 | Ga0163162_10147073 | Ga0163162_101470732 | 127 |
| 290 | 3300013306 | Ga0163162_10243148 | Ga0163162_102431482 | 127 |
| 291 | 3300013306 | Ga0163162_10338372 | Ga0163162_103383723 | 127 |
| 292 | 3300013306 | Ga0163162_13447134 | Ga0163162_134471342 | 127 |
| 293 | 3300013307 | Ga0157372_10471168 | Ga0157372_104711682 | 127 |
| 294 | 3300013307 | Ga0157372_10574727 | Ga0157372_105747273 | 127 |
| 295 | 3300013307 | Ga0157372_10666972 | Ga0157372_106669721 | 127 |
| 296 | 3300013307 | Ga0157372_12059820 | Ga0157372_120598202 | 127 |
| 297 | 3300013308 | Ga0157375_10002648 | Ga0157375_1000264813 | 127 |
| 298 | 3300013308 | Ga0157375_10008218 | Ga0157375_100082184 | 127 |
| 299 | 3300013308 | Ga0157375_10106132 | Ga0157375_101061323 | 127 |
| 300 | 3300013308 | Ga0157375_10119101 | Ga0157375_101191012 | 127 |
| 301 | 3300013308 | Ga0157375_10322940 | Ga0157375_103229402 | 127 |
| 302 | 3300014325 | Ga0163163_10014243 | Ga0163163_100142437 | 127 |
| 303 | 3300014325 | Ga0163163_10017923 | Ga0163163_1001792310 | 127 |
| 304 | 3300014325 | Ga0163163_10155766 | Ga0163163_101557662 | 127 |
| 305 | 3300014325 | Ga0163163_10612392 | Ga0163163_106123922 | 127 |
| 306 | 3300014325 | Ga0163163_11313968 | Ga0163163_113139681 | 127 |
| 307 | 3300014326 | Ga0157380_10087741 | Ga0157380_100877413 | 127 |
| 308 | 3300014745 | Ga0157377_10066663 | Ga0157377_100666632 | 127 |
| 309 | 3300014745 | Ga0157377_10250097 | Ga0157377_102500972 | 127 |
| 310 | 3300014745 | Ga0157377_11337933 | Ga0157377_113379331 | 127 |
| 311 | 3300014968 | Ga0157379_10179828 | Ga0157379_101798283 | 127 |
| 312 | 3300014968 | Ga0157379_10479891 | Ga0157379_104798912 | 127 |
| 313 | 3300014969 | Ga0157376_10030234 | Ga0157376_100302345 | 127 |
| 314 | 3300014969 | Ga0157376_10077146 | Ga0157376_100771464 | 127 |
| 315 | 3300014969 | Ga0157376_10141895 | Ga0157376_101418952 | 127 |
| 316 | 3300014969 | Ga0157376_10293111 | Ga0157376_102931112 | 127 |
| 317 | 3300014969 | Ga0157376_11457918 | Ga0157376_114579182 | 127 |
| 318 | 3300017792 | Ga0163161_10163616 | Ga0163161_101636162 | 127 |
| 319 | 3300017792 | Ga0163161_10191387 | Ga0163161_101913873 | 127 |
| 320 | 3300025735 | Ga0207713_1056328 | Ga0207713_10563282 | 127 |
| 321 | 3300025903 | Ga0207680_10018300 | Ga0207680_100183002 | 127 |
| 322 | 3300025903 | Ga0207680_10145462 | Ga0207680_101454621 | 127 |
| 323 | 3300025903 | Ga0207680_10153916 | Ga0207680_101539162 | 127 |
| 324 | 3300025903 | Ga0207680_10372233 | Ga0207680_103722332 | 127 |
| 325 | 3300025903 | Ga0207680_10646889 | Ga0207680_106468892 | 127 |
| 326 | 3300025904 | Ga0207647_10005536 | Ga0207647_100055367 | 127 |
| 327 | 3300025905 | Ga0207685_10134973 | Ga0207685_101349732 | 127 |
| 328 | 3300025907 | Ga0207645_10017210 | Ga0207645_100172103 | 127 |
| 329 | 3300025907 | Ga0207645_10142060 | Ga0207645_101420601 | 127 |
| 330 | 3300025907 | Ga0207645_10173772 | Ga0207645_101737721 | 127 |
| 331 | 3300025911 | Ga0207654_10004350 | Ga0207654_100043503 | 127 |
| 332 | 3300025913 | Ga0207695_10001773 | Ga0207695_1000177328 | 127 |
| 333 | 3300025914 | Ga0207671_10010815 | Ga0207671_100108153 | 127 |
| 334 | 3300025914 | Ga0207671_10616759 | Ga0207671_106167591 | 127 |
| 335 | 3300025919 | Ga0207657_10050681 | Ga0207657_100506813 | 127 |
| 336 | 3300025920 | Ga0207649_10081692 | Ga0207649_100816923 | 127 |
| 337 | 3300025920 | Ga0207649_10084381 | Ga0207649_100843812 | 127 |
| 338 | 3300025920 | Ga0207649_10913209 | Ga0207649_109132092 | 127 |
| 339 | 3300025923 | Ga0207681_10285448 | Ga0207681_102854482 | 127 |
| 340 | 3300025923 | Ga0207681_11409538 | Ga0207681_114095381 | 127 |
| 341 | 3300025925 | Ga0207650_10030710 | Ga0207650_100307102 | 127 |
| 342 | 3300025925 | Ga0207650_10193114 | Ga0207650_101931142 | 127 |
| 343 | 3300025925 | Ga0207650_10299560 | Ga0207650_102995603 | 127 |
| 344 | 3300025925 | Ga0207650_10303307 | Ga0207650_103033073 | 127 |
| 345 | 3300025926 | Ga0207659_10061762 | Ga0207659_100617622 | 127 |
| 346 | 3300025926 | Ga0207659_10132492 | Ga0207659_101324922 | 127 |
| 347 | 3300025926 | Ga0207659_10245139 | Ga0207659_102451393 | 127 |
| 348 | 3300025926 | Ga0207659_10663951 | Ga0207659_106639512 | 127 |
| 349 | 3300025931 | Ga0207644_10098240 | Ga0207644_100982403 | 127 |
| 350 | 3300025931 | Ga0207644_10118440 | Ga0207644_101184402 | 127 |
| 351 | 3300025931 | Ga0207644_10178889 | Ga0207644_101788893 | 127 |
| 352 | 3300025931 | Ga0207644_10277410 | Ga0207644_102774102 | 127 |
| 353 | 3300025931 | Ga0207644_10292559 | Ga0207644_102925592 | 127 |
| 354 | 3300025931 | Ga0207644_11020904 | Ga0207644_110209041 | 127 |
| 355 | 3300025932 | Ga0207690_10844183 | Ga0207690_108441831 | 127 |
| 356 | 3300025933 | Ga0207706_10026986 | Ga0207706_100269864 | 127 |
| 357 | 3300025933 | Ga0207706_10208788 | Ga0207706_102087881 | 127 |
| 358 | 3300025933 | Ga0207706_10313103 | Ga0207706_103131032 | 127 |
| 359 | 3300025933 | Ga0207706_10565519 | Ga0207706_105655192 | 127 |
| 360 | 3300025933 | Ga0207706_10730336 | Ga0207706_107303362 | 127 |
| 361 | 3300025934 | Ga0207686_10090031 | Ga0207686_100900313 | 127 |
| 362 | 3300025936 | Ga0207670_10008906 | Ga0207670_100089067 | 127 |
| 363 | 3300025936 | Ga0207670_10161540 | Ga0207670_101615403 | 127 |
| 364 | 3300025936 | Ga0207670_10530886 | Ga0207670_105308862 | 127 |
| 365 | 3300025937 | Ga0207669_10393893 | Ga0207669_103938932 | 127 |
| 366 | 3300025937 | Ga0207669_11191313 | Ga0207669_111913132 | 127 |
| 367 | 3300025938 | Ga0207704_11183402 | Ga0207704_111834022 | 127 |
| 368 | 3300025938 | Ga0207704_11199536 | Ga0207704_111995362 | 127 |
| 369 | 3300025940 | Ga0207691_10357650 | Ga0207691_103576502 | 127 |
| 370 | 3300025940 | Ga0207691_11358904 | Ga0207691_113589042 | 127 |
| 371 | 3300025941 | Ga0207711_10342514 | Ga0207711_103425143 | 127 |
| 372 | 3300025941 | Ga0207711_10644403 | Ga0207711_106444032 | 127 |
| 373 | 3300025942 | Ga0207689_10008125 | Ga0207689_100081252 | 127 |
| 374 | 3300025942 | Ga0207689_10026642 | Ga0207689_100266425 | 127 |
| 375 | 3300025942 | Ga0207689_10126297 | Ga0207689_101262973 | 127 |
| 376 | 3300025942 | Ga0207689_10190613 | Ga0207689_101906132 | 127 |
| 377 | 3300025944 | Ga0207661_10189206 | Ga0207661_101892062 | 127 |
| 378 | 3300025945 | Ga0207679_10002211 | Ga0207679_100022114 | 127 |
| 379 | 3300025945 | Ga0207679_10130127 | Ga0207679_101301272 | 127 |
| 380 | 3300025945 | Ga0207679_10924362 | Ga0207679_109243621 | 127 |
| 381 | 3300025949 | Ga0207667_10000015 | Ga0207667_10000015210 | 127 |
| 382 | 3300025949 | Ga0207667_10006803 | Ga0207667_100068033 | 127 |
| 383 | 3300025949 | Ga0207667_10180531 | Ga0207667_101805313 | 127 |
| 384 | 3300025960 | Ga0207651_10097934 | Ga0207651_100979344 | 127 |
| 385 | 3300025960 | Ga0207651_10685806 | Ga0207651_106858062 | 127 |
| 386 | 3300025972 | Ga0207668_11655755 | Ga0207668_116557551 | 127 |
| 387 | 3300025981 | Ga0207640_10172678 | Ga0207640_101726781 | 127 |
| 388 | 3300025981 | Ga0207640_10267080 | Ga0207640_102670803 | 127 |
| 389 | 3300025986 | Ga0207658_10017481 | Ga0207658_100174814 | 127 |
| 390 | 3300025986 | Ga0207658_10631843 | Ga0207658_106318432 | 127 |
| 391 | 3300026023 | Ga0207677_10008694 | Ga0207677_100086944 | 127 |
| 392 | 3300026023 | Ga0207677_10121414 | Ga0207677_101214142 | 127 |
| 393 | 3300026023 | Ga0207677_10407263 | Ga0207677_104072631 | 127 |
| 394 | 3300026023 | Ga0207677_11177313 | Ga0207677_111773131 | 127 |
| 395 | 3300026035 | Ga0207703_10095267 | Ga0207703_100952673 | 127 |
| 396 | 3300026035 | Ga0207703_10362109 | Ga0207703_103621092 | 127 |
| 397 | 3300026035 | Ga0207703_11144896 | Ga0207703_111448962 | 127 |
| 398 | 3300026035 | Ga0207703_12174932 | Ga0207703_121749321 | 127 |
| 399 | 3300026041 | Ga0207639_10174851 | Ga0207639_101748513 | 127 |
| 400 | 3300026041 | Ga0207639_10812685 | Ga0207639_108126852 | 127 |
| 401 | 3300026041 | Ga0207639_10850373 | Ga0207639_108503732 | 127 |
| 402 | 3300026067 | Ga0207678_10017432 | Ga0207678_100174322 | 127 |
| 403 | 3300026067 | Ga0207678_10197864 | Ga0207678_101978642 | 127 |
| 404 | 3300026067 | Ga0207678_10214961 | Ga0207678_102149612 | 127 |
| 405 | 3300026078 | Ga0207702_10081671 | Ga0207702_100816712 | 127 |
| 406 | 3300026078 | Ga0207702_10389345 | Ga0207702_103893453 | 127 |
| 407 | 3300026078 | Ga0207702_10842469 | Ga0207702_108424692 | 127 |
| 408 | 3300026088 | Ga0207641_10024670 | Ga0207641_100246707 | 127 |
| 409 | 3300026088 | Ga0207641_10034573 | Ga0207641_100345733 | 127 |
| 410 | 3300026088 | Ga0207641_10375519 | Ga0207641_103755191 | 127 |
| 411 | 3300026089 | Ga0207648_10077055 | Ga0207648_100770554 | 127 |
| 412 | 3300026089 | Ga0207648_10159417 | Ga0207648_101594172 | 127 |
| 413 | 3300026089 | Ga0207648_10180304 | Ga0207648_101803042 | 127 |
| 414 | 3300026089 | Ga0207648_10297057 | Ga0207648_102970572 | 127 |
| 415 | 3300026089 | Ga0207648_11905501 | Ga0207648_119055011 | 127 |
| 416 | 3300026095 | Ga0207676_10030348 | Ga0207676_100303483 | 127 |
| 417 | 3300026095 | Ga0207676_10118637 | Ga0207676_101186374 | 127 |
| 418 | 3300026095 | Ga0207676_10242959 | Ga0207676_102429592 | 127 |
| 419 | 3300026095 | Ga0207676_11090285 | Ga0207676_110902852 | 127 |
| 420 | 3300026116 | Ga0207674_10006730 | Ga0207674_100067304 | 127 |
| 421 | 3300026116 | Ga0207674_10108465 | Ga0207674_101084653 | 127 |
| 422 | 3300026116 | Ga0207674_10403510 | Ga0207674_104035102 | 127 |
| 423 | 3300026118 | Ga0207675_100039339 | Ga0207675_1000393394 | 127 |
| 424 | 3300026118 | Ga0207675_100386879 | Ga0207675_1003868792 | 127 |
| 425 | 3300026118 | Ga0207675_100836956 | Ga0207675_1008369562 | 127 |
| 426 | 3300026118 | Ga0207675_101478152 | Ga0207675_1014781522 | 127 |
| 427 | 3300026121 | Ga0207683_10044988 | Ga0207683_100449883 | 127 |
| 428 | 3300026121 | Ga0207683_10073154 | Ga0207683_100731543 | 127 |
| 429 | 3300026121 | Ga0207683_10462282 | Ga0207683_104622821 | 127 |
| 430 | 3300026121 | Ga0207683_10569040 | Ga0207683_105690402 | 127 |
| 431 | 3300026121 | Ga0207683_10897055 | Ga0207683_108970552 | 127 |
| 432 | 3300026142 | Ga0207698_10094903 | Ga0207698_100949033 | 127 |
| 433 | 3300026142 | Ga0207698_10302461 | Ga0207698_103024612 | 127 |
| 434 | 3300026142 | Ga0207698_10351447 | Ga0207698_103514472 | 127 |
| 435 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016274 | 127 |
| 436 | 3300028379 | Ga0268266_10255479 | Ga0268266_102554792 | 127 |
| 437 | 3300028379 | Ga0268266_10488813 | Ga0268266_104888132 | 127 |
| 438 | 3300028380 | Ga0268265_10102663 | Ga0268265_101026633 | 127 |
| 439 | 3300028381 | Ga0268264_10000072 | Ga0268264_10000072123 | 127 |
| 440 | 3300028381 | Ga0268264_12226470 | Ga0268264_122264702 | 127 |
| 441 | 3300028381 | Ga0268264_12702543 | Ga0268264_127025431 | 127 |
| 442 | 3300031251 | Ga0265327_10000117 | Ga0265327_1000011733 | 127 |
| 443 | 3300031507 | Ga0307509_10201505 | Ga0307509_102015052 | 127 |
| 444 | 3300035086 | Ga0373934_0009251 | Ga0373934_0009251_1427_1813 | 127 |
| 445 | 3300035089 | Ga0373944_0158590 | Ga0373944_0158590_355_741 | 127 |
| 446 | 3300035111 | Ga0373923_0057494 | Ga0373923_0057494_1122_1508 | 127 |
| 447 | 3300035117 | Ga0373953_0178281 | Ga0373953_0178281_333_719 | 127 |
| 448 | 3300035119 | Ga0373956_0135708 | Ga0373956_0135708_734_1120 | 127 |
| 449 | 3300035120 | Ga0373957_0069756 | Ga0373957_0069756_558_944 | 127 |
| 450 | 3300035172 | Ga0373955_0004601 | Ga0373955_0004601_3807_4193 | 127 |
| 451 | 3300035410 | Ga0373924_0005807 | Ga0373924_0005807_1477_1863 | 127 |
| 452 | 3300035724 | Ga0373933_0015285 | Ga0373933_0015285_3372_3758 | 127 |
| 453 | 3300036401 | Ga0373937_0002667 | Ga0373937_0002667_3461_3847 | 127 |
| 454 | 3300041512 | Ga0451853_3096197 | Ga0451853_3096197_103_489 | 127 |
| 455 | 3300042157 | Ga0439458_0210098 | Ga0439458_0210098_66_452 | 127 |
| 456 | 3300042876 | Ga0451577_0437202 | Ga0451577_0437202_41_427 | 127 |
| 457 | 3300044658 | Ga0466972_0006105 | Ga0466972_0006105_2986_3369 | 127 |
| 458 | 3300044658 | Ga0466972_0011616 | Ga0466972_0011616_505_900 | 127 |
| 459 | 3300044712 | Ga0453684_0261181 | Ga0453684_0261181_1288_1674 | 127 |
| 460 | 3300044735 | Ga0466968_0070228 | Ga0466968_0070228_212_595 | 127 |
| 461 | 3300044842 | Ga0466957_0285595 | Ga0466957_0285595_536_931 | 127 |
| 462 | 3300044901 | Ga0466960_0461659 | Ga0466960_0461659_46_429 | 127 |
| 463 | 3300045049 | Ga0466959_0189649 | Ga0466959_0189649_230_625 | 127 |
| 464 | 3300045051 | Ga0451576_0752992 | Ga0451576_0752992_550_936 | 127 |
| 465 | 3300045976 | Ga0466967_0957546 | Ga0466967_0957546_147_542 | 127 |
| 466 | 3300046454 | Ga0495592_0022738 | Ga0495592_0022738_354_740 | 127 |
| 467 | 3300046462 | Ga0495651_0210869 | Ga0495651_0210869_654_1037 | 127 |
| 468 | 3300046462 | Ga0495651_0330618 | Ga0495651_0330618_530_931 | 127 |
| 469 | 3300046507 | Ga0495606_0020255 | Ga0495606_0020255_354_752 | 127 |
| 470 | 3300046516 | Ga0495628_0276315 | Ga0495628_0276315_422_808 | 127 |
| 471 | 3300046517 | Ga0495630_0008167 | Ga0495630_0008167_3680_4066 | 127 |
| 472 | 3300046533 | Ga0495640_0444630 | Ga0495640_0444630_287_673 | 127 |
| 473 | 3300046535 | Ga0495586_0441547 | Ga0495586_0441547_126_512 | 127 |
| 474 | 3300046536 | Ga0495587_0077260 | Ga0495587_0077260_709_1095 | 127 |
| 475 | 3300046542 | Ga0495597_0085074 | Ga0495597_0085074_741_1124 | 127 |
| 476 | 3300046543 | Ga0495645_0783366 | Ga0495645_0783366_63_452 | 127 |
| 477 | 3300046559 | Ga0495667_0681738 | Ga0495667_0681738_124_510 | 127 |
| 478 | 3300046642 | Ga0495634_0119377 | Ga0495634_0119377_663_1049 | 127 |
| 479 | 3300046642 | Ga0495634_0705340 | Ga0495634_0705340_127_528 | 127 |
| 480 | 3300046648 | Ga0495611_0094833 | Ga0495611_0094833_793_1176 | 127 |
| 481 | 3300046660 | Ga0495625_0067055 | Ga0495625_0067055_210_593 | 127 |
| 482 | 3300046678 | Ga0495599_0803272 | Ga0495599_0803272_30_425 | 127 |
| 483 | 3300046680 | Ga0495646_0197678 | Ga0495646_0197678_465_851 | 127 |
| 484 | 3300046809 | Ga0495600_0327829 | Ga0495600_0327829_92_478 | 127 |
| 485 | 3300047317 | Ga0495604_0048545 | Ga0495604_0048545_2334_2720 | 127 |
| 486 | 3300047322 | Ga0495680_0110530 | Ga0495680_0110530_144_530 | 127 |
| 487 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_398492_398875 | 127 |
| 488 | 3300047471 | Ga0495684_0029757 | Ga0495684_0029757_1969_2355 | 127 |
| 489 | 3300048903 | Ga0496100_0213824 | Ga0496100_0213824_244_630 | 127 |
| 490 | 3300048904 | Ga0496101_0337650 | Ga0496101_0337650_458_844 | 127 |
| 491 | 3300048907 | Ga0496104_0335971 | Ga0496104_0335971_212_613 | 127 |
| 492 | 3300048907 | Ga0496104_0819159 | Ga0496104_0819159_348_734 | 127 |
| 493 | 3300048908 | Ga0496105_0829423 | Ga0496105_0829423_231_623 | 127 |
| 494 | 3300048909 | Ga0496106_0583575 | Ga0496106_0583575_130_528 | 127 |
| 495 | 3300048911 | Ga0496108_0277242 | Ga0496108_0277242_689_1075 | 127 |
| 496 | 3300048912 | Ga0496109_0796285 | Ga0496109_0796285_197_583 | 127 |
| 497 | 3300048913 | Ga0496110_0334733 | Ga0496110_0334733_827_1213 | 127 |
| 498 | 3300048914 | Ga0496111_0050742 | Ga0496111_0050742_1865_2251 | 127 |
| 499 | 3300048917 | Ga0496114_1328830 | Ga0496114_1328830_206_592 | 127 |
| 500 | 3300049652 | Ga0501202_090235 | Ga0501202_090235_273_668 | 127 |
| 501 | 3300053085 | Ga0495619_0046338 | Ga0495619_0046338_86_472 | 127 |
| 502 | 3300053086 | Ga0500578_0526566 | Ga0500578_0526566_227_610 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4g6x-assembly1.cif.gz_A-2 | crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. | 0.9541 | 1 | 127 |
| 4g6x-assembly1.cif.gz_A-2 | crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. | 0.9468 | 1 | 127 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.8201 | 1 | 125 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8149 | 1 | 126 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8034 | 1 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4g6xA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9608 | 2 | 127 | 3.10.180.10 |
| 4g6xA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9384 | 2 | 127 | 3.10.180.10 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9312 | 79 | 124 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8933 | 78 | 126 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8752 | 78 | 127 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S8S1R5-F1-model_v4 | VOC family protein | 0.9924 | 6 | 127 |
|
| AF-A0A0B5D3C8-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9906 | 12 | 126 |
GO:0051213
|
| AF-A0A1B1NDE3-F1-model_v4 | Lactoylglutathione lyase | 0.9863 | 6 | 127 |
GO:0004462
GO:0046872 |
| AF-A0A1H4CK38-F1-model_v4 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein | 0.986 | 74 | 126 |
GO:0051213
|
| AF-V6L1F7-F1-model_v4 | VOC domain-containing protein | 0.9859 | 24 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar