F455804

General Info

Members Datasets Scaffolds Average Seq Length
502 225 1004 311

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100139213|Ga0068868_1001392132
Length 350
Sequence MASSPCRAERPGTKGIDIDTREREEAAGLDILAYGEPMVEFNQTGEGGGRLYLQGFGGDSSNFAIAAARQGARVGYFSALGDDGNGRMLRALWDEEGVDHGDVRNDAGAFTAVYFVTHGARGHEFHFFRNGSAASRITAADVPRGRIAAAKVLHLSGISLAISANACDAGYAAIEVARDAGVRVSFDTNLRLGLWSIDRARAVMSDVMQRADICLPSYDDVRAITGLDDDDALVDRCLRLGAKTVALKMGERGALVFDGERRVALAPHPCKPVDATGAGDTFGGSLLARLVAGDGLVEAASYAGVAAALSTEGYGAVEPIPLGEQVRAARAAQAPRPSGSTTPRSRPRSA

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
216 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
217 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
218 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
219 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
220 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
221 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
222 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
223 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
224 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
225 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.77
Nodule 0
Rhizoplane 3.98
Rhizosphere 87.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100139213 3300005338 Bacteria 1991
2 rootL2_10010606 3300003322 Bacteria 3977
3 Ga0055538_1000155 3300003751 Bacteria 46426
4 Ga0055539_1000205 3300003752 Bacteria 46426
5 Ga0055533_1000207 3300003756 Bacteria 46426
6 Ga0055525_1000284 3300003759 Bacteria 46426
7 Ga0055526_1019969 3300003771 Bacteria 2411
8 Ga0055524_1007305 3300003775 Bacteria 4712
9 Ga0055536_1006351 3300003781 Bacteria 5543
10 Ga0055541_1000133 3300003841 Bacteria 46426
11 Ga0070658_10053813 3300005327 Bacteria 3268
12 Ga0070658_10088303 3300005327 Bacteria 2553
13 Ga0070658_10198594 3300005327 Bacteria 1692
14 Ga0070676_10004086 3300005328 Bacteria 7676
15 Ga0070676_10010250 3300005328 Bacteria 5083
16 Ga0070683_100012316 3300005329 Bacteria 7429
17 Ga0070690_100018066 3300005330 Bacteria 4253
18 Ga0070670_100001996 3300005331 Bacteria 16678
19 Ga0070670_100025318 3300005331 Bacteria 5106
20 Ga0070670_100036389 3300005331 Bacteria 4236
21 Ga0070670_100046708 3300005331 Bacteria 3724
22 Ga0070670_100072838 3300005331 Bacteria 2951
23 Ga0070670_100092373 3300005331 Bacteria 2602
24 Ga0070677_10007604 3300005333 Bacteria 3623
25 Ga0070677_10012390 3300005333 Bacteria 2962
26 Ga0070677_10025038 3300005333 Bacteria 2224
27 Ga0068869_100002609 3300005334 Bacteria 10881
28 Ga0068869_100022167 3300005334 Bacteria 4373
29 Ga0070666_10003932 3300005335 Bacteria 9025
30 Ga0070666_10066303 3300005335 Bacteria 2450
31 Ga0070680_100006496 3300005336 Bacteria 8895
32 Ga0068868_100006084 3300005338 Bacteria 8521
33 Ga0068868_100012140 3300005338 Bacteria 6291
34 Ga0068868_100243628 3300005338 Bacteria 1511
35 Ga0070689_100022614 3300005340 Bacteria 4697
36 Ga0070689_100164536 3300005340 Bacteria 1795
37 Ga0070687_100013399 3300005343 Bacteria 3653
38 Ga0070661_100004582 3300005344 Bacteria 9506
39 Ga0070661_100106301 3300005344 Bacteria 2092
40 Ga0070661_100118925 3300005344 Bacteria 1977
41 Ga0070661_100330002 3300005344 Bacteria 1193
42 Ga0070668_100001912 3300005347 Bacteria 15233
43 Ga0070668_100074824 3300005347 Bacteria 2643
44 Ga0070668_100194344 3300005347 Bacteria 1663
45 Ga0070668_100268022 3300005347 Bacteria 1422
46 Ga0070669_100004154 3300005353 Bacteria 10502
47 Ga0070669_100005334 3300005353 Bacteria 9281
48 Ga0070669_100015849 3300005353 Bacteria 5376
49 Ga0070669_100049060 3300005353 Bacteria 3082
50 Ga0070675_100005905 3300005354 Bacteria 9377
51 Ga0070675_100008064 3300005354 Bacteria 8163
52 Ga0070675_100019464 3300005354 Bacteria 5411
53 Ga0070675_100021501 3300005354 Bacteria 5157
54 Ga0070675_100080988 3300005354 Bacteria 2707
55 Ga0070671_100009117 3300005355 Bacteria 7966
56 Ga0070671_100011396 3300005355 Bacteria 7148
57 Ga0070671_100034873 3300005355 Bacteria 4166
58 Ga0070671_100079188 3300005355 Bacteria 2746
59 Ga0070671_100187725 3300005355 Bacteria 1751
60 Ga0070671_100205355 3300005355 Bacteria 1671
61 Ga0070674_100000422 3300005356 Bacteria 21348
62 Ga0070674_100004419 3300005356 Bacteria 8016
63 Ga0070674_100009593 3300005356 Bacteria 5801
64 Ga0070673_100006380 3300005364 Bacteria 7665
65 Ga0070673_100014753 3300005364 Bacteria 5460
66 Ga0070673_100037703 3300005364 Bacteria 3685
67 Ga0070673_100117341 3300005364 Bacteria 2215
68 Ga0070673_100143955 3300005364 Bacteria 2013
69 Ga0070673_100245418 3300005364 Bacteria 1559
70 Ga0070659_100028246 3300005366 Bacteria 4330
71 Ga0070659_100071997 3300005366 Bacteria 2750
72 Ga0070667_100001966 3300005367 Bacteria 18245
73 Ga0070667_100013141 3300005367 Bacteria 6844
74 Ga0070667_100065294 3300005367 Bacteria 3090
75 Ga0070667_100516799 3300005367 Bacteria 1095
76 Ga0070701_10095368 3300005438 Bacteria 1638
77 Ga0070663_100024822 3300005455 Bacteria 4039
78 Ga0070663_100244078 3300005455 Bacteria 1419
79 Ga0070678_100000623 3300005456 Bacteria 17360
80 Ga0070678_100004960 3300005456 Bacteria 7620
81 Ga0070678_100008442 3300005456 Bacteria 6171
82 Ga0070678_100016066 3300005456 Bacteria 4775
83 Ga0070678_100114580 3300005456 Bacteria 2115
84 Ga0070678_100153827 3300005456 Bacteria 1856
85 Ga0070678_100222800 3300005456 Bacteria 1568
86 Ga0070662_100002386 3300005457 Bacteria 11541
87 Ga0070662_100006293 3300005457 Bacteria 7647
88 Ga0070662_100072632 3300005457 Bacteria 2541
89 Ga0070662_100120507 3300005457 Bacteria 2010
90 Ga0068867_100001767 3300005459 Bacteria 15038
91 Ga0068867_100005710 3300005459 Bacteria 8823
92 Ga0068867_100063221 3300005459 Bacteria 2751
93 Ga0068867_100179216 3300005459 Bacteria 1684
94 Ga0070679_100005291 3300005530 Bacteria 11945
95 Ga0070684_100018857 3300005535 Bacteria 5695
96 Ga0070684_100120860 3300005535 Bacteria 2356
97 Ga0068853_100019645 3300005539 Bacteria 5608
98 Ga0068853_100094673 3300005539 Bacteria 2632
99 Ga0070672_100002705 3300005543 Bacteria 11328
100 Ga0070672_100003225 3300005543 Bacteria 10557
101 Ga0070672_100006272 3300005543 Bacteria 7968
102 Ga0070672_100009849 3300005543 Bacteria 6605
103 Ga0070672_100011867 3300005543 Bacteria 6089
104 Ga0070672_100169157 3300005543 Bacteria 1817
105 Ga0070672_100173134 3300005543 Bacteria 1796
106 Ga0070672_100327272 3300005543 Bacteria 1303
107 Ga0070686_100255560 3300005544 Bacteria 1282
108 Ga0068855_100045864 3300005563 Bacteria 5168
109 Ga0068855_100094018 3300005563 Bacteria 3457
110 Ga0070664_100043522 3300005564 Bacteria 3788
111 Ga0070664_100220298 3300005564 Bacteria 1698
112 Ga0068857_100007335 3300005577 Bacteria 9495
113 Ga0068854_100010163 3300005578 Bacteria 6098
114 Ga0068854_100010945 3300005578 Bacteria 5887
115 Ga0068854_100046508 3300005578 Bacteria 3090
116 Ga0068854_100218539 3300005578 Bacteria 1506
117 Ga0068856_100021624 3300005614 Bacteria 6252
118 Ga0070702_100366960 3300005615 Bacteria 1019
119 Ga0068852_100011610 3300005616 Bacteria 6644
120 Ga0068852_100012671 3300005616 Bacteria 6413
121 Ga0068852_100032471 3300005616 Bacteria 4323
122 Ga0068852_100073244 3300005616 Bacteria 3013
123 Ga0068852_100115543 3300005616 Bacteria 2447
124 Ga0068852_100188692 3300005616 Bacteria 1943
125 Ga0068852_100270939 3300005616 Bacteria 1634
126 Ga0068859_100056963 3300005617 Bacteria 3936
127 Ga0068859_100227142 3300005617 Bacteria 1955
128 Ga0068864_100000817 3300005618 Bacteria 26204
129 Ga0068864_100001915 3300005618 Bacteria 17082
130 Ga0068864_100008913 3300005618 Bacteria 8269
131 Ga0068864_100013259 3300005618 Bacteria 6828
132 Ga0068864_100022083 3300005618 Bacteria 5334
133 Ga0068864_100066794 3300005618 Bacteria 3122
134 Ga0068864_100308726 3300005618 Bacteria 1483
135 Ga0068866_10027216 3300005718 Bacteria 2709
136 Ga0068866_10040147 3300005718 Bacteria 2315
137 Ga0068861_100003183 3300005719 Bacteria 10860
138 Ga0068861_100008700 3300005719 Bacteria 6983
139 Ga0068851_10017222 3300005834 Bacteria 3467
140 Ga0068870_10039892 3300005840 Bacteria 2432
141 Ga0068870_10055376 3300005840 Bacteria 2113
142 Ga0068863_100011347 3300005841 Bacteria 8627
143 Ga0068863_100012732 3300005841 Bacteria 8111
144 Ga0068863_100013120 3300005841 Bacteria 7995
145 Ga0068863_100058832 3300005841 Bacteria 3637
146 Ga0068858_100004486 3300005842 Bacteria 13686
147 Ga0068858_100004529 3300005842 Bacteria 13626
148 Ga0068858_100007226 3300005842 Bacteria 10764
149 Ga0068858_100038738 3300005842 Bacteria 4422
150 Ga0068858_100395114 3300005842 Bacteria 1328
151 Ga0068860_100002683 3300005843 Bacteria 18524
152 Ga0068860_100003994 3300005843 Bacteria 15140
153 Ga0068860_100217901 3300005843 Bacteria 1853
154 Ga0068862_100015060 3300005844 Bacteria 6423
155 Ga0068862_100219468 3300005844 Bacteria 1721
156 Ga0081538_10049508 3300005981 Bacteria 2548
157 Ga0075365_10003405 3300006038 Bacteria 8181
158 Ga0075368_10007521 3300006042 Bacteria 3844
159 Ga0075364_10009796 3300006051 Bacteria 5763
160 Ga0075366_10029651 3300006195 Bacteria 3215
161 Ga0097621_100003755 3300006237 Bacteria 10524
162 Ga0097621_100004171 3300006237 Bacteria 10025
163 Ga0097621_100004884 3300006237 Bacteria 9398
164 Ga0075370_10100444 3300006353 Bacteria 1674
165 Ga0068871_100001394 3300006358 Bacteria 16183
166 Ga0068871_100017063 3300006358 Bacteria 5486
167 Ga0068871_100017652 3300006358 Bacteria 5405
168 Ga0068871_100021820 3300006358 Bacteria 4929
169 Ga0068871_100123456 3300006358 Bacteria 2190
170 Ga0075434_100042804 3300006871 Bacteria 4491
171 Ga0068865_100008939 3300006881 Bacteria 6199
172 Ga0068865_100017013 3300006881 Bacteria 4667
173 Ga0068865_100027541 3300006881 Bacteria 3755
174 Ga0097620_100056960 3300006931 Bacteria 3936
175 Ga0097620_100227123 3300006931 Bacteria 1955
176 Ga0105240_10454650 3300009093 Bacteria 1432
177 Ga0105240_10652711 3300009093 Bacteria 1153
178 Ga0105245_10083198 3300009098 Bacteria 2929
179 Ga0105243_10264180 3300009148 Bacteria 1542
180 Ga0105241_10213294 3300009174 Bacteria 1619
181 Ga0105248_10010348 3300009177 Bacteria 10269
182 Ga0105248_10010604 3300009177 Bacteria 10158
183 Ga0105248_10012543 3300009177 Bacteria 9348
184 Ga0105248_10043854 3300009177 Bacteria 5016
185 Ga0105248_10085669 3300009177 Bacteria 3545
186 Ga0105248_10138163 3300009177 Bacteria 2749
187 Ga0105248_10417484 3300009177 Bacteria 1511
188 Ga0105248_10475689 3300009177 Bacteria 1408
189 Ga0105237_10035832 3300009545 Bacteria 5019
190 Ga0105237_10329799 3300009545 Bacteria 1530
191 Ga0105238_10001273 3300009551 Bacteria 25347
192 Ga0105238_10013227 3300009551 Bacteria 8326
193 Ga0105249_10053090 3300009553 Bacteria 3704
194 Ga0105239_10131252 3300010375 Bacteria 2787
195 Ga0105239_10186196 3300010375 Bacteria 2323
196 Ga0157373_10033739 3300013100 Bacteria 3679
197 Ga0157371_10066214 3300013102 Bacteria 2558
198 Ga0157369_10431707 3300013105 Bacteria 1365
199 Ga0157374_10007118 3300013296 Bacteria 9528
200 Ga0157374_10267039 3300013296 Bacteria 1687
201 Ga0163162_10001310 3300013306 Bacteria 23257
202 Ga0163162_10049801 3300013306 Bacteria 4200
203 Ga0163162_10187432 3300013306 Bacteria 2196
204 Ga0163162_10199922 3300013306 Bacteria 2127
205 Ga0163162_10404199 3300013306 Bacteria 1498
206 Ga0163162_10478460 3300013306 Bacteria 1377
207 Ga0157372_10006557 3300013307 Bacteria 12385
208 Ga0157372_10010659 3300013307 Bacteria 9778
209 Ga0157372_10710048 3300013307 Bacteria 1170
210 Ga0157375_10004510 3300013308 Bacteria 12107
211 Ga0157375_10005098 3300013308 Bacteria 11399
212 Ga0157375_10023842 3300013308 Bacteria 5653
213 Ga0157375_10034836 3300013308 Bacteria 4799
214 Ga0157375_10087018 3300013308 Bacteria 3176
215 Ga0163163_10002325 3300014325 Bacteria 16062
216 Ga0163163_10103317 3300014325 Bacteria 2874
217 Ga0163163_10133606 3300014325 Bacteria 2522
218 Ga0163163_10566906 3300014325 Bacteria 1198
219 Ga0157380_10002416 3300014326 Bacteria 12576
220 Ga0157380_10180794 3300014326 Bacteria 1853
221 Ga0157377_10004115 3300014745 Bacteria 6645
222 Ga0157379_10007020 3300014968 Bacteria 9733
223 Ga0157379_10025641 3300014968 Bacteria 5239
224 Ga0157379_10028945 3300014968 Bacteria 4926
225 Ga0157376_10005186 3300014969 Bacteria 9089
226 Ga0157376_10021803 3300014969 Bacteria 4979
227 Ga0157376_10022375 3300014969 Bacteria 4926
228 Ga0157376_10285474 3300014969 Bacteria 1556
229 Ga0157376_10516023 3300014969 Bacteria 1177
230 Ga0182006_1001264 3300015261 Bacteria 15627
231 Ga0163161_10005205 3300017792 Bacteria 9048
232 Ga0163161_10011133 3300017792 Bacteria 6233
233 Ga0163161_10032156 3300017792 Bacteria 3744
234 Ga0163161_10140462 3300017792 Bacteria 1829
235 Ga0213876_10016973 3300021384 Bacteria 3845
236 Ga0213876_10114968 3300021384 Bacteria 1428
237 Ga0209784_100002 3300025224 Bacteria 1753105
238 Ga0209566_100003 3300025225 Bacteria 1753105
239 Ga0209674_100004 3300025226 Bacteria 1753105
240 Ga0209563_100006 3300025230 Bacteria 1753105
241 Ga0209677_100003 3300025253 Bacteria 1753105
242 Ga0209675_1002614 3300025291 Bacteria 9124
243 Ga0209676_1000547 3300025292 Bacteria 57868
244 Ga0209025_1004773 3300025294 Bacteria 11508
245 Ga0209256_1004400 3300025299 Bacteria 8878
246 Ga0207656_10001853 3300025321 Bacteria 7030
247 Ga0207656_10091993 3300025321 Bacteria 1378
248 Ga0207682_10000414 3300025893 Bacteria 19591
249 Ga0207682_10005419 3300025893 Bacteria 5195
250 Ga0207682_10013852 3300025893 Bacteria 3140
251 Ga0207682_10033652 3300025893 Bacteria 2064
252 Ga0207642_10015183 3300025899 Bacteria 2862
253 Ga0207688_10070045 3300025901 Bacteria 1988
254 Ga0207688_10076066 3300025901 Bacteria 1911
255 Ga0207680_10014250 3300025903 Bacteria 4108
256 Ga0207680_10023176 3300025903 Bacteria 3386
257 Ga0207680_10144987 3300025903 Bacteria 1578
258 Ga0207645_10007675 3300025907 Bacteria 7602
259 Ga0207645_10014837 3300025907 Bacteria 5199
260 Ga0207645_10028965 3300025907 Bacteria 3571
261 Ga0207645_10074205 3300025907 Bacteria 2177
262 Ga0207705_10008377 3300025909 Bacteria 7549
263 Ga0207705_10372426 3300025909 Bacteria 1102
264 Ga0207707_10272856 3300025912 Bacteria 1466
265 Ga0207695_10002435 3300025913 Bacteria 27506
266 Ga0207695_10428935 3300025913 Bacteria 1206
267 Ga0207671_10008088 3300025914 Bacteria 8981
268 Ga0207662_10005054 3300025918 Bacteria 6988
269 Ga0207657_10018197 3300025919 Bacteria 6722
270 Ga0207657_10116936 3300025919 Bacteria 2196
271 Ga0207657_10275495 3300025919 Bacteria 1337
272 Ga0207649_10003773 3300025920 Bacteria 8263
273 Ga0207652_10143727 3300025921 Bacteria 2134
274 Ga0207681_10000473 3300025923 Bacteria 28146
275 Ga0207681_10009896 3300025923 Bacteria 5834
276 Ga0207681_10021375 3300025923 Bacteria 4112
277 Ga0207681_10114828 3300025923 Bacteria 1965
278 Ga0207694_10001091 3300025924 Bacteria 23538
279 Ga0207650_10005579 3300025925 Bacteria 8591
280 Ga0207650_10010106 3300025925 Bacteria 6467
281 Ga0207650_10017541 3300025925 Bacteria 5015
282 Ga0207650_10020666 3300025925 Bacteria 4646
283 Ga0207650_10135234 3300025925 Bacteria 1933
284 Ga0207650_10234133 3300025925 Bacteria 1482
285 Ga0207650_10413506 3300025925 Bacteria 1118
286 Ga0207659_10002984 3300025926 Bacteria 10084
287 Ga0207659_10005423 3300025926 Bacteria 7728
288 Ga0207659_10016084 3300025926 Bacteria 4863
289 Ga0207659_10040475 3300025926 Bacteria 3259
290 Ga0207659_10073427 3300025926 Bacteria 2504
291 Ga0207659_10083661 3300025926 Bacteria 2366
292 Ga0207659_10088037 3300025926 Bacteria 2312
293 Ga0207687_10081434 3300025927 Bacteria 2339
294 Ga0207687_10119967 3300025927 Bacteria 1965
295 Ga0207644_10002025 3300025931 Bacteria 13102
296 Ga0207644_10011603 3300025931 Bacteria 5833
297 Ga0207644_10027083 3300025931 Bacteria 3957
298 Ga0207690_10005896 3300025932 Bacteria 7253
299 Ga0207706_10008424 3300025933 Bacteria 9516
300 Ga0207706_10009492 3300025933 Bacteria 8935
301 Ga0207706_10056682 3300025933 Bacteria 3454
302 Ga0207706_10070319 3300025933 Bacteria 3079
303 Ga0207706_10368879 3300025933 Bacteria 1247
304 Ga0207709_10017443 3300025935 Bacteria 4007
305 Ga0207670_10244256 3300025936 Bacteria 1384
306 Ga0207669_10004750 3300025937 Bacteria 6015
307 Ga0207669_10007170 3300025937 Bacteria 5134
308 Ga0207669_10154472 3300025937 Bacteria 1612
309 Ga0207704_10006202 3300025938 Bacteria 5557
310 Ga0207704_10228788 3300025938 Bacteria 1381
311 Ga0207691_10000186 3300025940 Bacteria 58949
312 Ga0207691_10010046 3300025940 Bacteria 9083
313 Ga0207691_10011461 3300025940 Bacteria 8507
314 Ga0207691_10013124 3300025940 Bacteria 7931
315 Ga0207691_10016270 3300025940 Bacteria 7062
316 Ga0207691_10023935 3300025940 Bacteria 5747
317 Ga0207691_10026819 3300025940 Bacteria 5406
318 Ga0207691_10034598 3300025940 Bacteria 4696
319 Ga0207691_10053680 3300025940 Bacteria 3679
320 Ga0207691_10254808 3300025940 Bacteria 1514
321 Ga0207691_10447478 3300025940 Bacteria 1099
322 Ga0207711_10017485 3300025941 Bacteria 5957
323 Ga0207711_10022995 3300025941 Bacteria 5217
324 Ga0207711_10198895 3300025941 Bacteria 1828
325 Ga0207711_10219149 3300025941 Bacteria 1740
326 Ga0207689_10000550 3300025942 Bacteria 35746
327 Ga0207689_10012799 3300025942 Bacteria 7165
328 Ga0207679_10003726 3300025945 Bacteria 9451
329 Ga0207679_10146798 3300025945 Bacteria 1914
330 Ga0207667_10000438 3300025949 Bacteria 55784
331 Ga0207667_10027709 3300025949 Bacteria 6163
332 Ga0207667_10071265 3300025949 Bacteria 3614
333 Ga0207651_10000508 3300025960 Bacteria 16359
334 Ga0207651_10007427 3300025960 Bacteria 5840
335 Ga0207651_10011223 3300025960 Bacteria 5005
336 Ga0207651_10069417 3300025960 Bacteria 2488
337 Ga0207651_10071443 3300025960 Bacteria 2460
338 Ga0207651_10174245 3300025960 Bacteria 1700
339 Ga0207651_10206411 3300025960 Bacteria 1578
340 Ga0207712_10008643 3300025961 Bacteria 6438
341 Ga0207668_10004414 3300025972 Bacteria 8261
342 Ga0207668_10122803 3300025972 Bacteria 1969
343 Ga0207640_10019823 3300025981 Bacteria 3981
344 Ga0207640_10051698 3300025981 Bacteria 2672
345 Ga0207640_10061126 3300025981 Bacteria 2494
346 Ga0207640_10162440 3300025981 Bacteria 1654
347 Ga0207640_10350208 3300025981 Bacteria 1186
348 Ga0207658_10002217 3300025986 Bacteria 14426
349 Ga0207658_10062250 3300025986 Bacteria 2792
350 Ga0207658_10174616 3300025986 Bacteria 1773
351 Ga0207658_10257441 3300025986 Bacteria 1486
352 Ga0207658_10263242 3300025986 Bacteria 1470
353 Ga0207677_10000871 3300026023 Bacteria 17171
354 Ga0207677_10057159 3300026023 Bacteria 2677
355 Ga0207677_10146583 3300026023 Bacteria 1815
356 Ga0207677_10233314 3300026023 Bacteria 1484
357 Ga0207703_10000277 3300026035 Bacteria 56761
358 Ga0207703_10012355 3300026035 Bacteria 6656
359 Ga0207703_10028691 3300026035 Bacteria 4390
360 Ga0207703_10051599 3300026035 Bacteria 3334
361 Ga0207639_10007798 3300026041 Bacteria 7312
362 Ga0207639_10159520 3300026041 Bacteria 1899
363 Ga0207678_10014287 3300026067 Bacteria 6981
364 Ga0207678_10046638 3300026067 Bacteria 3747
365 Ga0207678_10109904 3300026067 Bacteria 2351
366 Ga0207678_10156847 3300026067 Bacteria 1943
367 Ga0207708_10063298 3300026075 Bacteria 2826
368 Ga0207708_10107991 3300026075 Bacteria 2158
369 Ga0207702_10004454 3300026078 Bacteria 12446
370 Ga0207641_10002779 3300026088 Bacteria 15944
371 Ga0207641_10047303 3300026088 Bacteria 3627
372 Ga0207641_10058278 3300026088 Bacteria 3286
373 Ga0207641_10065747 3300026088 Bacteria 3102
374 Ga0207641_10140430 3300026088 Bacteria 2179
375 Ga0207641_10408165 3300026088 Bacteria 1305
376 Ga0207648_10002813 3300026089 Bacteria 18446
377 Ga0207648_10009743 3300026089 Bacteria 9186
378 Ga0207648_10018173 3300026089 Bacteria 6369
379 Ga0207648_10037720 3300026089 Bacteria 4256
380 Ga0207648_10073125 3300026089 Bacteria 2988
381 Ga0207648_10082017 3300026089 Bacteria 2812
382 Ga0207676_10006632 3300026095 Bacteria 8183
383 Ga0207676_10007048 3300026095 Bacteria 7968
384 Ga0207676_10018564 3300026095 Bacteria 5058
385 Ga0207676_10084138 3300026095 Bacteria 2592
386 Ga0207676_10109296 3300026095 Bacteria 2310
387 Ga0207676_10247691 3300026095 Bacteria 1602
388 Ga0207674_10023446 3300026116 Bacteria 6611
389 Ga0207674_10121300 3300026116 Bacteria 2581
390 Ga0207675_100000576 3300026118 Bacteria 35873
391 Ga0207675_100002372 3300026118 Bacteria 18650
392 Ga0207675_100055728 3300026118 Bacteria 3689
393 Ga0207683_10002558 3300026121 Bacteria 15875
394 Ga0207683_10008937 3300026121 Bacteria 8535
395 Ga0207683_10020305 3300026121 Bacteria 5681
396 Ga0207683_10022185 3300026121 Bacteria 5449
397 Ga0207683_10032351 3300026121 Bacteria 4543
398 Ga0207683_10043731 3300026121 Bacteria 3915
399 Ga0207683_10054152 3300026121 Bacteria 3517
400 Ga0207683_10152139 3300026121 Bacteria 2088
401 Ga0207683_10279819 3300026121 Bacteria 1525
402 Ga0207698_10007391 3300026142 Bacteria 6882
403 Ga0207698_10086569 3300026142 Bacteria 2548
404 Ga0207698_10087984 3300026142 Bacteria 2532
405 Ga0207698_10121910 3300026142 Bacteria 2209
406 Ga0207698_10275994 3300026142 Bacteria 1552
407 Ga0207698_10333258 3300026142 Bacteria 1426
408 Ga0209970_1000358 3300027614 Bacteria 7658
409 Ga0209813_10004728 3300027866 Bacteria 3264
410 Ga0268265_10010050 3300028380 Bacteria 6389
411 Ga0268265_10041588 3300028380 Bacteria 3403
412 Ga0268264_10002728 3300028381 Bacteria 15415
413 Ga0268264_10005650 3300028381 Bacteria 10599
414 Ga0265314_10003924 3300031711 Bacteria 14131
415 Ga0265342_10082926 3300031712 Bacteria 1849
416 Ga0307405_10037698 3300031731 Bacteria 2907
417 Ga0307413_10006366 3300031824 Bacteria 5382
418 Ga0307413_10146509 3300031824 Bacteria 1640
419 Ga0307406_10006978 3300031901 Bacteria 6254
420 Ga0307406_10012222 3300031901 Bacteria 4893
421 Ga0307412_10011706 3300031911 Bacteria 5088
422 Ga0307412_10029800 3300031911 Bacteria 3428
423 Ga0307409_100000680 3300031995 Bacteria 15083
424 Ga0307409_100206627 3300031995 Bacteria 1761
425 Ga0307416_100001182 3300032002 Bacteria 14007
426 Ga0307416_100034721 3300032002 Bacteria 3842
427 Ga0307411_10007142 3300032005 Bacteria 5658
428 Ga0307415_100015183 3300032126 Bacteria 4552
429 Ga0307510_10030567 3300033180 Bacteria 6104
430 Ga0373929_0005882 3300035085 Bacteria 2215
431 Ga0373944_0010859 3300035089 Bacteria 2489
432 Ga0373943_0176996 3300035170 Bacteria 1170
433 Ga0373946_0054374 3300035171 Bacteria 1685
434 Ga0373931_0009502 3300035691 Bacteria 4650
435 Ga0373937_0050114 3300036401 Bacteria 3824
436 Ga0395900_0023206 3300037418 Bacteria 6351
437 Ga0395898_0015152 3300037466 Bacteria 7913
438 Ga0395905_0000025 3300037471 Bacteria 317571
439 Ga0395905_0687735 3300037471 Bacteria 925
440 Ga0395901_0023751 3300038443 Bacteria 6286
441 Ga0395901_0438997 3300038443 Bacteria 1336
442 Ga0436365_1466894 3300039437 Bacteria 13672
443 Ga0466969_0012132 3300044656 Bacteria 4554
444 Ga0466966_0011924 3300044684 Bacteria 5761
445 Ga0466961_0016813 3300044693 Bacteria 4703
446 Ga0466968_0131538 3300044735 Bacteria 1139
447 Ga0495629_0053161 3300046459 Bacteria 2834
448 Ga0495620_0031131 3300046515 Bacteria 2448
449 Ga0495628_0137313 3300046516 Bacteria 1868
450 Ga0495632_0031298 3300046519 Bacteria 2752
451 Ga0495647_0014196 3300046681 Bacteria 2772
452 Ga0495647_0110458 3300046681 Bacteria 1147
453 Ga0495658_0033191 3300046683 Bacteria 2825
454 Ga0495684_0099250 3300047471 Bacteria 2202
455 Ga0496100_0036990 3300048903 Bacteria 3083
456 Ga0496101_0106940 3300048904 Bacteria 2101
457 Ga0496102_0000771 3300048905 Bacteria 31181
458 Ga0496104_0214501 3300048907 Bacteria 1837
459 Ga0496104_0289733 3300048907 Bacteria 1549
460 Ga0496106_0011948 3300048909 Bacteria 6411
461 Ga0496107_0009894 3300048910 Bacteria 6616
462 Ga0496108_0029383 3300048911 Bacteria 4551
463 Ga0496108_0063493 3300048911 Bacteria 3110
464 Ga0496108_0154217 3300048911 Bacteria 1983
465 Ga0496108_0220969 3300048911 Bacteria 1646
466 Ga0496109_0064653 3300048912 Bacteria 3348
467 Ga0496109_0090403 3300048912 Bacteria 2832
468 Ga0496109_0171419 3300048912 Bacteria 2036
469 Ga0496110_0002997 3300048913 Bacteria 12811
470 Ga0496110_0151107 3300048913 Bacteria 2103
471 Ga0496110_0469358 3300048913 Bacteria 1147
472 Ga0496114_0076139 3300048917 Bacteria 2827
473 Ga0496114_0141127 3300048917 Bacteria 2086
474 Ga0496115_0024126 3300048918 Bacteria 4725
475 Ga0501075_0145256 3300049591 Bacteria 1808
476 Ga0501076_0076070 3300049592 Bacteria 2692
477 Ga0501045_0051844 3300049824 Bacteria 2995
478 nmdc:mga03n38_125556_c1 3300050490 Bacteria 1266
479 nmdc:mga00v17_8336_c1 3300050491 Bacteria 5576
480 nmdc:mga0k408_28056_c1 3300050493 Bacteria 3199
481 nmdc:mga06z11_2269_c1 3300050494 Bacteria 7318
482 nmdc:mga04h51_4290_c1 3300050495 Bacteria 3534
483 nmdc:mga07m45_43454_c1 3300050496 Bacteria 2519
484 nmdc:mga08y16_645600_c1 3300050511 Bacteria 1063
485 nmdc:mga0n895_295943_c1 3300050512 Bacteria 1641
486 Ga0495595_0143394 3300053084 Bacteria 1173
487 Ga0500644_0002584 3300053088 Bacteria 4523
488 Ga0500651_0043827 3300053093 Bacteria 2817
489 Ga0500559_0000022 3300053136 Bacteria 128071
490 Ga0500559_0016414 3300053136 Bacteria 3126
491 Ga0500622_0000498 3300053156 Bacteria 36624
492 2819615166 2818991449 Bacteria 5518009
493 2856293607 2856287931 Bacteria 7223934
494 2904441560 2904439833 Bacteria 5931679
495 2904531511 2904530477 Bacteria 5876334
496 2904586852 2904584206 Bacteria 6028872
497 2904593115 2904589729 Bacteria 6113573
498 2904603039 2904601388 Bacteria 5884906
499 2919050864 2919046199 Bacteria 5567169
500 2919083940 2919079590 Bacteria 5946433
501 2923510904 2923510766 Bacteria 5926163
502 2990713838 2990710928 Bacteria 5002431
503 Ga0068868_100139213
504 rootL2_10010606
505 Ga0055538_1000155
506 Ga0055539_1000205
507 Ga0055533_1000207
508 Ga0055525_1000284
509 Ga0055526_1019969
510 Ga0055524_1007305
511 Ga0055536_1006351
512 Ga0055541_1000133
513 Ga0070658_10053813
514 Ga0070658_10088303
515 Ga0070658_10198594
516 Ga0070676_10004086
517 Ga0070676_10010250
518 Ga0070683_100012316
519 Ga0070690_100018066
520 Ga0070670_100001996
521 Ga0070670_100025318
522 Ga0070670_100036389
523 Ga0070670_100046708
524 Ga0070670_100072838
525 Ga0070670_100092373
526 Ga0070677_10007604
527 Ga0070677_10012390
528 Ga0070677_10025038
529 Ga0068869_100002609
530 Ga0068869_100022167
531 Ga0070666_10003932
532 Ga0070666_10066303
533 Ga0070680_100006496
534 Ga0068868_100006084
535 Ga0068868_100012140
536 Ga0068868_100243628
537 Ga0070689_100022614
538 Ga0070689_100164536
539 Ga0070687_100013399
540 Ga0070661_100004582
541 Ga0070661_100106301
542 Ga0070661_100118925
543 Ga0070661_100330002
544 Ga0070668_100001912
545 Ga0070668_100074824
546 Ga0070668_100194344
547 Ga0070668_100268022
548 Ga0070669_100004154
549 Ga0070669_100005334
550 Ga0070669_100015849
551 Ga0070669_100049060
552 Ga0070675_100005905
553 Ga0070675_100008064
554 Ga0070675_100019464
555 Ga0070675_100021501
556 Ga0070675_100080988
557 Ga0070671_100009117
558 Ga0070671_100011396
559 Ga0070671_100034873
560 Ga0070671_100079188
561 Ga0070671_100187725
562 Ga0070671_100205355
563 Ga0070674_100000422
564 Ga0070674_100004419
565 Ga0070674_100009593
566 Ga0070673_100006380
567 Ga0070673_100014753
568 Ga0070673_100037703
569 Ga0070673_100117341
570 Ga0070673_100143955
571 Ga0070673_100245418
572 Ga0070659_100028246
573 Ga0070659_100071997
574 Ga0070667_100001966
575 Ga0070667_100013141
576 Ga0070667_100065294
577 Ga0070667_100516799
578 Ga0070701_10095368
579 Ga0070663_100024822
580 Ga0070663_100244078
581 Ga0070678_100000623
582 Ga0070678_100004960
583 Ga0070678_100008442
584 Ga0070678_100016066
585 Ga0070678_100114580
586 Ga0070678_100153827
587 Ga0070678_100222800
588 Ga0070662_100002386
589 Ga0070662_100006293
590 Ga0070662_100072632
591 Ga0070662_100120507
592 Ga0068867_100001767
593 Ga0068867_100005710
594 Ga0068867_100063221
595 Ga0068867_100179216
596 Ga0070679_100005291
597 Ga0070684_100018857
598 Ga0070684_100120860
599 Ga0068853_100019645
600 Ga0068853_100094673
601 Ga0070672_100002705
602 Ga0070672_100003225
603 Ga0070672_100006272
604 Ga0070672_100009849
605 Ga0070672_100011867
606 Ga0070672_100169157
607 Ga0070672_100173134
608 Ga0070672_100327272
609 Ga0070686_100255560
610 Ga0068855_100045864
611 Ga0068855_100094018
612 Ga0070664_100043522
613 Ga0070664_100220298
614 Ga0068857_100007335
615 Ga0068854_100010163
616 Ga0068854_100010945
617 Ga0068854_100046508
618 Ga0068854_100218539
619 Ga0068856_100021624
620 Ga0070702_100366960
621 Ga0068852_100011610
622 Ga0068852_100012671
623 Ga0068852_100032471
624 Ga0068852_100073244
625 Ga0068852_100115543
626 Ga0068852_100188692
627 Ga0068852_100270939
628 Ga0068859_100056963
629 Ga0068859_100227142
630 Ga0068864_100000817
631 Ga0068864_100001915
632 Ga0068864_100008913
633 Ga0068864_100013259
634 Ga0068864_100022083
635 Ga0068864_100066794
636 Ga0068864_100308726
637 Ga0068866_10027216
638 Ga0068866_10040147
639 Ga0068861_100003183
640 Ga0068861_100008700
641 Ga0068851_10017222
642 Ga0068870_10039892
643 Ga0068870_10055376
644 Ga0068863_100011347
645 Ga0068863_100012732
646 Ga0068863_100013120
647 Ga0068863_100058832
648 Ga0068858_100004486
649 Ga0068858_100004529
650 Ga0068858_100007226
651 Ga0068858_100038738
652 Ga0068858_100395114
653 Ga0068860_100002683
654 Ga0068860_100003994
655 Ga0068860_100217901
656 Ga0068862_100015060
657 Ga0068862_100219468
658 Ga0081538_10049508
659 Ga0075365_10003405
660 Ga0075368_10007521
661 Ga0075364_10009796
662 Ga0075366_10029651
663 Ga0097621_100003755
664 Ga0097621_100004171
665 Ga0097621_100004884
666 Ga0075370_10100444
667 Ga0068871_100001394
668 Ga0068871_100017063
669 Ga0068871_100017652
670 Ga0068871_100021820
671 Ga0068871_100123456
672 Ga0075434_100042804
673 Ga0068865_100008939
674 Ga0068865_100017013
675 Ga0068865_100027541
676 Ga0097620_100056960
677 Ga0097620_100227123
678 Ga0105240_10454650
679 Ga0105240_10652711
680 Ga0105245_10083198
681 Ga0105243_10264180
682 Ga0105241_10213294
683 Ga0105248_10010348
684 Ga0105248_10010604
685 Ga0105248_10012543
686 Ga0105248_10043854
687 Ga0105248_10085669
688 Ga0105248_10138163
689 Ga0105248_10417484
690 Ga0105248_10475689
691 Ga0105237_10035832
692 Ga0105237_10329799
693 Ga0105238_10001273
694 Ga0105238_10013227
695 Ga0105249_10053090
696 Ga0105239_10131252
697 Ga0105239_10186196
698 Ga0157373_10033739
699 Ga0157371_10066214
700 Ga0157369_10431707
701 Ga0157374_10007118
702 Ga0157374_10267039
703 Ga0163162_10001310
704 Ga0163162_10049801
705 Ga0163162_10187432
706 Ga0163162_10199922
707 Ga0163162_10404199
708 Ga0163162_10478460
709 Ga0157372_10006557
710 Ga0157372_10010659
711 Ga0157372_10710048
712 Ga0157375_10004510
713 Ga0157375_10005098
714 Ga0157375_10023842
715 Ga0157375_10034836
716 Ga0157375_10087018
717 Ga0163163_10002325
718 Ga0163163_10103317
719 Ga0163163_10133606
720 Ga0163163_10566906
721 Ga0157380_10002416
722 Ga0157380_10180794
723 Ga0157377_10004115
724 Ga0157379_10007020
725 Ga0157379_10025641
726 Ga0157379_10028945
727 Ga0157376_10005186
728 Ga0157376_10021803
729 Ga0157376_10022375
730 Ga0157376_10285474
731 Ga0157376_10516023
732 Ga0182006_1001264
733 Ga0163161_10005205
734 Ga0163161_10011133
735 Ga0163161_10032156
736 Ga0163161_10140462
737 Ga0213876_10016973
738 Ga0213876_10114968
739 Ga0209784_100002
740 Ga0209566_100003
741 Ga0209674_100004
742 Ga0209563_100006
743 Ga0209677_100003
744 Ga0209675_1002614
745 Ga0209676_1000547
746 Ga0209025_1004773
747 Ga0209256_1004400
748 Ga0207656_10001853
749 Ga0207656_10091993
750 Ga0207682_10000414
751 Ga0207682_10005419
752 Ga0207682_10013852
753 Ga0207682_10033652
754 Ga0207642_10015183
755 Ga0207688_10070045
756 Ga0207688_10076066
757 Ga0207680_10014250
758 Ga0207680_10023176
759 Ga0207680_10144987
760 Ga0207645_10007675
761 Ga0207645_10014837
762 Ga0207645_10028965
763 Ga0207645_10074205
764 Ga0207705_10008377
765 Ga0207705_10372426
766 Ga0207707_10272856
767 Ga0207695_10002435
768 Ga0207695_10428935
769 Ga0207671_10008088
770 Ga0207662_10005054
771 Ga0207657_10018197
772 Ga0207657_10116936
773 Ga0207657_10275495
774 Ga0207649_10003773
775 Ga0207652_10143727
776 Ga0207681_10000473
777 Ga0207681_10009896
778 Ga0207681_10021375
779 Ga0207681_10114828
780 Ga0207694_10001091
781 Ga0207650_10005579
782 Ga0207650_10010106
783 Ga0207650_10017541
784 Ga0207650_10020666
785 Ga0207650_10135234
786 Ga0207650_10234133
787 Ga0207650_10413506
788 Ga0207659_10002984
789 Ga0207659_10005423
790 Ga0207659_10016084
791 Ga0207659_10040475
792 Ga0207659_10073427
793 Ga0207659_10083661
794 Ga0207659_10088037
795 Ga0207687_10081434
796 Ga0207687_10119967
797 Ga0207644_10002025
798 Ga0207644_10011603
799 Ga0207644_10027083
800 Ga0207690_10005896
801 Ga0207706_10008424
802 Ga0207706_10009492
803 Ga0207706_10056682
804 Ga0207706_10070319
805 Ga0207706_10368879
806 Ga0207709_10017443
807 Ga0207670_10244256
808 Ga0207669_10004750
809 Ga0207669_10007170
810 Ga0207669_10154472
811 Ga0207704_10006202
812 Ga0207704_10228788
813 Ga0207691_10000186
814 Ga0207691_10010046
815 Ga0207691_10011461
816 Ga0207691_10013124
817 Ga0207691_10016270
818 Ga0207691_10023935
819 Ga0207691_10026819
820 Ga0207691_10034598
821 Ga0207691_10053680
822 Ga0207691_10254808
823 Ga0207691_10447478
824 Ga0207711_10017485
825 Ga0207711_10022995
826 Ga0207711_10198895
827 Ga0207711_10219149
828 Ga0207689_10000550
829 Ga0207689_10012799
830 Ga0207679_10003726
831 Ga0207679_10146798
832 Ga0207667_10000438
833 Ga0207667_10027709
834 Ga0207667_10071265
835 Ga0207651_10000508
836 Ga0207651_10007427
837 Ga0207651_10011223
838 Ga0207651_10069417
839 Ga0207651_10071443
840 Ga0207651_10174245
841 Ga0207651_10206411
842 Ga0207712_10008643
843 Ga0207668_10004414
844 Ga0207668_10122803
845 Ga0207640_10019823
846 Ga0207640_10051698
847 Ga0207640_10061126
848 Ga0207640_10162440
849 Ga0207640_10350208
850 Ga0207658_10002217
851 Ga0207658_10062250
852 Ga0207658_10174616
853 Ga0207658_10257441
854 Ga0207658_10263242
855 Ga0207677_10000871
856 Ga0207677_10057159
857 Ga0207677_10146583
858 Ga0207677_10233314
859 Ga0207703_10000277
860 Ga0207703_10012355
861 Ga0207703_10028691
862 Ga0207703_10051599
863 Ga0207639_10007798
864 Ga0207639_10159520
865 Ga0207678_10014287
866 Ga0207678_10046638
867 Ga0207678_10109904
868 Ga0207678_10156847
869 Ga0207708_10063298
870 Ga0207708_10107991
871 Ga0207702_10004454
872 Ga0207641_10002779
873 Ga0207641_10047303
874 Ga0207641_10058278
875 Ga0207641_10065747
876 Ga0207641_10140430
877 Ga0207641_10408165
878 Ga0207648_10002813
879 Ga0207648_10009743
880 Ga0207648_10018173
881 Ga0207648_10037720
882 Ga0207648_10073125
883 Ga0207648_10082017
884 Ga0207676_10006632
885 Ga0207676_10007048
886 Ga0207676_10018564
887 Ga0207676_10084138
888 Ga0207676_10109296
889 Ga0207676_10247691
890 Ga0207674_10023446
891 Ga0207674_10121300
892 Ga0207675_100000576
893 Ga0207675_100002372
894 Ga0207675_100055728
895 Ga0207683_10002558
896 Ga0207683_10008937
897 Ga0207683_10020305
898 Ga0207683_10022185
899 Ga0207683_10032351
900 Ga0207683_10043731
901 Ga0207683_10054152
902 Ga0207683_10152139
903 Ga0207683_10279819
904 Ga0207698_10007391
905 Ga0207698_10086569
906 Ga0207698_10087984
907 Ga0207698_10121910
908 Ga0207698_10275994
909 Ga0207698_10333258
910 Ga0209970_1000358
911 Ga0209813_10004728
912 Ga0268265_10010050
913 Ga0268265_10041588
914 Ga0268264_10002728
915 Ga0268264_10005650
916 Ga0265314_10003924
917 Ga0265342_10082926
918 Ga0307405_10037698
919 Ga0307413_10006366
920 Ga0307413_10146509
921 Ga0307406_10006978
922 Ga0307406_10012222
923 Ga0307412_10011706
924 Ga0307412_10029800
925 Ga0307409_100000680
926 Ga0307409_100206627
927 Ga0307416_100001182
928 Ga0307416_100034721
929 Ga0307411_10007142
930 Ga0307415_100015183
931 Ga0307510_10030567
932 Ga0373929_0005882
933 Ga0373944_0010859
934 Ga0373943_0176996
935 Ga0373946_0054374
936 Ga0373931_0009502
937 Ga0373937_0050114
938 Ga0395900_0023206
939 Ga0395898_0015152
940 Ga0395905_0000025
941 Ga0395905_0687735
942 Ga0395901_0023751
943 Ga0395901_0438997
944 Ga0436365_1466894
945 Ga0466969_0012132
946 Ga0466966_0011924
947 Ga0466961_0016813
948 Ga0466968_0131538
949 Ga0495629_0053161
950 Ga0495620_0031131
951 Ga0495628_0137313
952 Ga0495632_0031298
953 Ga0495647_0014196
954 Ga0495647_0110458
955 Ga0495658_0033191
956 Ga0495684_0099250
957 Ga0496100_0036990
958 Ga0496101_0106940
959 Ga0496102_0000771
960 Ga0496104_0214501
961 Ga0496104_0289733
962 Ga0496106_0011948
963 Ga0496107_0009894
964 Ga0496108_0029383
965 Ga0496108_0063493
966 Ga0496108_0154217
967 Ga0496108_0220969
968 Ga0496109_0064653
969 Ga0496109_0090403
970 Ga0496109_0171419
971 Ga0496110_0002997
972 Ga0496110_0151107
973 Ga0496110_0469358
974 Ga0496114_0076139
975 Ga0496114_0141127
976 Ga0496115_0024126
977 Ga0501075_0145256
978 Ga0501076_0076070
979 Ga0501045_0051844
980 nmdc:mga03n38_125556_c1
981 nmdc:mga00v17_8336_c1
982 nmdc:mga0k408_28056_c1
983 nmdc:mga06z11_2269_c1
984 nmdc:mga04h51_4290_c1
985 nmdc:mga07m45_43454_c1
986 nmdc:mga08y16_645600_c1
987 nmdc:mga0n895_295943_c1
988 Ga0495595_0143394
989 Ga0500644_0002584
990 Ga0500651_0043827
991 Ga0500559_0000022
992 Ga0500559_0016414
993 Ga0500622_0000498
994 2819615166
995 2856293607
996 2904441560
997 2904531511
998 2904586852
999 2904593115
1000 2904603039
1001 2919050864
1002 2919083940
1003 2923510904
1004 2990713838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

29

322

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v78-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase 0.9334 3 304
2dcn-assembly1.cif.gz_D crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form) 0.9323 4 304
4du5-assembly2.cif.gz_C crystal structure of pfkb protein from polaromonas sp. js666 0.9268 3 301
4du5-assembly1.cif.gz_A crystal structure of pfkb protein from polaromonas sp. js666 0.9249 3 301
3lki-assembly2.cif.gz_B crystal structure of fructokinase with bound atp from xylella fastidiosa 0.924 1 307
ID Description Score Start End Superfamily
af_C6TGN8_61_381_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.947 5 303 3.40.1190.20
af_Q2FWM2_2_319_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9346 4 301 3.40.1190.20
2varB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9315 3 304 3.40.1190.20
3pl2D01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.927 4 301 3.40.1190.20
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9211 3 301 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7H4PXP7-F1-model_v4 Sugar kinase 0.9904 3 304 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A108GDH4-F1-model_v4 2-dehydro-3-deoxygluconokinase 0.99 3 304 GO:0016301
AF-A0A7Z9TS47-F1-model_v4 Sugar kinase 0.9815 1 304 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A4Q3XVL1-F1-model_v4 deleted 0.9765 208 298
AF-A0A7Z9TS47-F1-model_v4 Sugar kinase 0.9721 1 304 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840

Map