metagRoot

F455826

General Info

Members	Datasets	Scaffolds	Average Seq Length
502	263	487	268

Family's Representative Sequence

Representative Sequence	3300006051\|Ga0075364_10064113\|Ga0075364_100641132
Length	273
Sequence	MALDDPGPAWLFCPADRPERFQKAAAAADVVILDLEDGVSAPHRPAARQALIDTTLDPGRTVVRLNPAGSPDHALDLQALGQTRYTTVMLAKTESAQQVSALAPLDVIVLVETPLGALTVADCARADNAYAVMWGAEDLFAVTGGTANRGSDGTYRDVAQHVRSSSLLAAKAYGRLALDSVYIDIKDIDGLREECDDAVAVGFDAKVAIHPSQVPVIRGAYTPTGEQVRWARQVLAEVAAQRGVFQFEGIMVDAPVLRRAERIVALAPHPDEA

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2643221692	Nocardia sp. Root136	Isolate	Unclassified
3	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
4	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
5	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
6	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
7	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
8	2784132109	Dermacoccus sp. DS28 SAI-028	Isolate	Unclassified
9	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
10	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
11	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
12	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
13	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
14	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
15	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
16	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
17	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
18	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
19	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
20	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
21	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
22	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
23	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
24	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
25	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
26	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
27	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
28	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
29	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
30	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
31	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
32	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
33	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
34	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
35	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
36	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
37	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
41	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
42	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
43	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
44	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
45	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
46	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
47	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
48	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
51	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
52	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
53	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
54	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
55	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
56	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
57	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
58	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
59	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
60	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
61	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
62	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
63	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
64	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
65	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
66	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
67	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
68	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
69	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
70	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
71	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
72	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
73	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
74	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
75	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
76	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
77	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
78	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
79	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
80	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
81	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
82	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
83	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
84	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
85	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
86	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
87	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
88	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
90	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
92	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
93	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
94	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
95	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
96	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
97	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
98	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
99	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
100	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
101	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
102	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
103	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
104	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
112	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
113	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
162	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
163	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
164	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
165	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
166	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
167	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
170	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
171	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
172	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
173	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
174	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
175	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
176	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
177	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
178	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
179	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
180	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
181	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
182	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
183	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
184	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
185	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
186	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
187	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
188	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
189	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
190	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
191	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
192	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
193	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
194	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
195	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
196	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
197	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
198	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
199	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
200	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
201	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
202	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
203	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
204	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
205	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
206	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
207	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
208	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
209	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
210	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
211	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
212	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
213	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
214	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
215	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
216	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
217	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
218	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
219	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
220	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
221	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
222	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
223	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
224	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
225	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
226	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
227	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
228	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
229	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
230	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
231	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
232	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
233	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
234	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
235	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
244	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
247	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
248	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
249	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
250	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
251	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
252	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
253	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
254	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
255	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
256	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
257	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
258	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
259	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
260	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
261	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
262	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
263	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.01
Metatranscriptomes	0
Isolates	2.99

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.34
Nodule	0.2
Rhizoplane	11.95
Rhizosphere	63.15
Stem	0
Stem Tuber	0
Unclassified	9.36

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24743J22301_10002076	3300001991	Bacteria	2951
2	JGI24735J21928_10056054	3300002067	Bacteria	1135
3	JGI24745J21846_1009867	3300002073	Bacteria	1084
4	JGI24748J21848_1008354	3300002074	Bacteria	1216
5	JGI24749J21850_1005836	3300002076	Bacteria	1717
6	JGI24744J21845_10000931	3300002077	Bacteria	5559
7	JGI24744J21845_10007786	3300002077	Bacteria	2213
8	JGI24034J26672_10007887	3300002239	Bacteria	1550
9	JGI24742J22300_10001585	3300002244	Bacteria	3617
10	JGI24742J22300_10005368	3300002244	Bacteria	2107
11	Ga0055540_1000061	3300003792	Bacteria	129782
12	Ga0055540_1001120	3300003792	Bacteria	16757
13	Ga0055540_1002997	3300003792	Bacteria	8457
14	Ga0055540_1003552	3300003792	Bacteria	7466
15	Ga0070658_10468085	3300005327	Bacteria	1087
16	Ga0070690_100026177	3300005330	Bacteria	3596
17	Ga0068869_100096586	3300005334	Bacteria	2230
18	Ga0070666_10016040	3300005335	Bacteria	4788
19	Ga0070666_10192831	3300005335	Bacteria	1432
20	Ga0070682_100197567	3300005337	Bacteria	1417
21	Ga0068868_100051379	3300005338	Bacteria	3242
22	Ga0070691_10031567	3300005341	Bacteria	2485
23	Ga0070661_100208824	3300005344	Bacteria	1494
24	Ga0070692_10003961	3300005345	Bacteria	6110
25	Ga0070668_100004679	3300005347	Bacteria	10143
26	Ga0070668_100008873	3300005347	Bacteria	7465
27	Ga0070668_100062060	3300005347	Bacteria	2895
28	Ga0070668_100313687	3300005347	Bacteria	1318
29	Ga0070669_100001457	3300005353	Bacteria	17131
30	Ga0070669_100018037	3300005353	Bacteria	5041
31	Ga0070669_100133732	3300005353	Bacteria	1906
32	Ga0070671_100097762	3300005355	Bacteria	2462
33	Ga0070671_100289284	3300005355	Bacteria	1394
34	Ga0070674_100000410	3300005356	Bacteria	21593
35	Ga0070659_100015530	3300005366	Bacteria	5702
36	Ga0070659_100161643	3300005366	Bacteria	1831
37	Ga0070667_100000077	3300005367	Bacteria	120245
38	Ga0070667_100000758	3300005367	Bacteria	30687
39	Ga0070667_100039464	3300005367	Bacteria	3957
40	Ga0070709_10092607	3300005434	Bacteria	1997
41	Ga0070713_100044346	3300005436	Bacteria	3640
42	Ga0070710_10002304	3300005437	Bacteria	9036
43	Ga0070710_10068582	3300005437	Bacteria	2038
44	Ga0070701_10002032	3300005438	Bacteria	7677
45	Ga0070711_100001425	3300005439	Bacteria	13128
46	Ga0070705_100007253	3300005440	Bacteria	5452
47	Ga0070700_100003645	3300005441	Bacteria	7963
48	Ga0070700_100020833	3300005441	Bacteria	3805
49	Ga0070700_100367915	3300005441	Bacteria	1071
50	Ga0070694_100539452	3300005444	Bacteria	933
51	Ga0070663_100022411	3300005455	Bacteria	4223
52	Ga0070663_100064950	3300005455	Bacteria	2639
53	Ga0070663_100081068	3300005455	Bacteria	2385
54	Ga0070663_100103801	3300005455	Bacteria	2125
55	Ga0070678_100001358	3300005456	Bacteria	12995
56	Ga0070678_100114878	3300005456	Bacteria	2112
57	Ga0070678_100291776	3300005456	Bacteria	1383
58	Ga0070662_100231739	3300005457	Bacteria	1477
59	Ga0068867_100000801	3300005459	Bacteria	21218
60	Ga0070685_10070040	3300005466	Bacteria	2076
61	Ga0070697_100377961	3300005536	Bacteria	1227
62	Ga0068853_100000965	3300005539	Bacteria	20226
63	Ga0068853_100061738	3300005539	Bacteria	3242
64	Ga0070695_100073083	3300005545	Bacteria	2250
65	Ga0070696_100008493	3300005546	Bacteria	6875
66	Ga0070693_100252728	3300005547	Bacteria	1169
67	Ga0070665_100004838	3300005548	Bacteria	13992
68	Ga0070665_100024235	3300005548	Bacteria	6110
69	Ga0070665_100031673	3300005548	Bacteria	5321
70	Ga0070665_100057095	3300005548	Bacteria	3914
71	Ga0070704_100001445	3300005549	Bacteria	12709
72	Ga0070664_100198827	3300005564	Bacteria	1788
73	Ga0068854_100000621	3300005578	Bacteria	20969
74	Ga0068854_100018242	3300005578	Bacteria	4708
75	Ga0068854_100056656	3300005578	Bacteria	2825
76	Ga0068856_100038726	3300005614	Bacteria	4680
77	Ga0068856_100751705	3300005614	Bacteria	995
78	Ga0068852_100213100	3300005616	Bacteria	1833
79	Ga0068859_100001748	3300005617	Bacteria	22138
80	Ga0068859_100028201	3300005617	Bacteria	5628
81	Ga0068859_100613766	3300005617	Bacteria	1180
82	Ga0068864_100220481	3300005618	Bacteria	1750
83	Ga0068864_100318634	3300005618	Bacteria	1460
84	Ga0068864_100327696	3300005618	Bacteria	1440
85	Ga0068866_10002051	3300005718	Bacteria	8382
86	Ga0068861_100000524	3300005719	Bacteria	22431
87	Ga0068870_10137336	3300005840	Bacteria	1427
88	Ga0068863_100002287	3300005841	Bacteria	19045
89	Ga0068863_100002886	3300005841	Bacteria	17017
90	Ga0068863_100014868	3300005841	Bacteria	7478
91	Ga0068858_100007910	3300005842	Bacteria	10243
92	Ga0068858_100007993	3300005842	Bacteria	10196
93	Ga0068858_100266520	3300005842	Bacteria	1629
94	Ga0068860_100000010	3300005843	Bacteria	359114
95	Ga0068860_100017188	3300005843	Bacteria	7051
96	Ga0068860_100071031	3300005843	Bacteria	3309
97	Ga0068862_100000052	3300005844	Bacteria	144622
98	Ga0068862_100017477	3300005844	Bacteria	5974
99	Ga0068862_100056172	3300005844	Bacteria	3373
100	Ga0068862_100450935	3300005844	Bacteria	1213
101	Ga0081455_10064372	3300005937	Bacteria	3070
102	Ga0081538_10043742	3300005981	Bacteria	2806
103	Ga0081538_10061375	3300005981	Bacteria	2152
104	Ga0075365_10006730	3300006038	Bacteria	6357
105	Ga0075365_10060919	3300006038	Bacteria	2519
106	Ga0075365_10293800	3300006038	Bacteria	1143
107	Ga0075365_10333218	3300006038	Bacteria	1069
108	Ga0075363_100000564	3300006048	Bacteria	12114
109	Ga0075363_100001950	3300006048	Bacteria	8184
110	Ga0075363_100018344	3300006048	Bacteria	3485
111	Ga0075363_100026177	3300006048	Bacteria	2982
112	Ga0075363_100031815	3300006048	Bacteria	2737
113	Ga0075363_100048007	3300006048	Bacteria	2269
114	Ga0075364_10002903	3300006051	Bacteria	9666
115	Ga0075364_10005037	3300006051	Bacteria	7661
116	Ga0075364_10005475	3300006051	Bacteria	7383
117	Ga0075364_10024521	3300006051	Bacteria	3831
118	Ga0075364_10031371	3300006051	Bacteria	3414
119	Ga0075364_10064113	3300006051	Bacteria	2412
120	Ga0075364_10234284	3300006051	Bacteria	1247
121	Ga0075364_10281390	3300006051	Bacteria	1132
122	Ga0070716_100008122	3300006173	Bacteria	5198
123	Ga0070716_100157507	3300006173	Bacteria	1468
124	Ga0070712_100000372	3300006175	Bacteria	25375
125	Ga0075362_10085050	3300006177	Bacteria	1462
126	Ga0075367_10005946	3300006178	Bacteria	6123
127	Ga0075367_10284382	3300006178	Bacteria	1040
128	Ga0075369_10003148	3300006186	Bacteria	5981
129	Ga0075369_10014606	3300006186	Bacteria	3141
130	Ga0075369_10038173	3300006186	Bacteria	2048
131	Ga0075369_10038686	3300006186	Bacteria	2036
132	Ga0075369_10069670	3300006186	Bacteria	1547
133	Ga0075370_10005464	3300006353	Bacteria	6320
134	Ga0075370_10037685	3300006353	Bacteria	2719
135	Ga0075370_10278963	3300006353	Bacteria	992
136	Ga0068871_100646368	3300006358	Bacteria	965
137	Ga0075430_100038999	3300006846	Bacteria	4023
138	Ga0075429_100373070	3300006880	Bacteria	1249
139	Ga0068865_100028122	3300006881	Bacteria	3721
140	Ga0097620_100001748	3300006931	Bacteria	22138
141	Ga0097620_100028201	3300006931	Bacteria	5628
142	Ga0097620_100613734	3300006931	Bacteria	1180
143	Ga0099795_10023071	3300007788	Bacteria	2061
144	Ga0111539_10336197	3300009094	Bacteria	1758
145	Ga0105245_10012330	3300009098	Bacteria	7437
146	Ga0105245_10668643	3300009098	Bacteria	1070
147	Ga0105247_10000220	3300009101	Bacteria	54751
148	Ga0105247_10001060	3300009101	Bacteria	20592
149	Ga0105247_10037085	3300009101	Bacteria	2974
150	Ga0114129_10058641	3300009147	Bacteria	5384
151	Ga0114129_10433235	3300009147	Bacteria	1727
152	Ga0105243_10001194	3300009148	Bacteria	23402
153	Ga0105243_10385116	3300009148	Bacteria	1298
154	Ga0105242_10008314	3300009176	Bacteria	7972
155	Ga0105242_10202626	3300009176	Bacteria	1763
156	Ga0105248_10000745	3300009177	Bacteria	36573
157	Ga0105248_10043526	3300009177	Bacteria	5034
158	Ga0105248_10515931	3300009177	Bacteria	1348
159	Ga0105238_10172183	3300009551	Bacteria	2141
160	Ga0105249_10001369	3300009553	Bacteria	21319
161	Ga0105249_10001483	3300009553	Bacteria	20551
162	Ga0105249_10047057	3300009553	Bacteria	3929
163	Ga0099796_10096114	3300010159	Bacteria	1108
164	Ga0105239_10011719	3300010375	Bacteria	9785
165	Ga0105239_10543484	3300010375	Bacteria	1323
166	Ga0157374_10038424	3300013296	Bacteria	4400
167	Ga0157378_10012518	3300013297	Bacteria	7424
168	Ga0157378_10307824	3300013297	Bacteria	1536
169	Ga0163162_10019755	3300013306	Bacteria	6614
170	Ga0163162_10110480	3300013306	Bacteria	2846
171	Ga0163162_10842988	3300013306	Bacteria	1032
172	Ga0157372_10014417	3300013307	Bacteria	8454
173	Ga0157375_10001067	3300013308	Bacteria	23707
174	Ga0163163_10022728	3300014325	Bacteria	5942
175	Ga0163163_10390731	3300014325	Bacteria	1449
176	Ga0163163_10736642	3300014325	Bacteria	1049
177	Ga0157380_10002117	3300014326	Bacteria	13314
178	Ga0157379_10253959	3300014968	Bacteria	1596
179	Ga0157379_10378177	3300014968	Bacteria	1299
180	Ga0157376_10239933	3300014969	Bacteria	1688
181	Ga0157376_10778244	3300014969	Bacteria	968
182	Ga0163161_10002340	3300017792	Bacteria	13586
183	Ga0213874_10005669	3300021377	Bacteria	2921
184	Ga0213876_10022842	3300021384	Bacteria	3305
185	Ga0213876_10040123	3300021384	Bacteria	2473
186	Ga0209051_1000048	3300025303	Bacteria	292755
187	Ga0209051_1000540	3300025303	Bacteria	46615
188	Ga0209051_1001240	3300025303	Bacteria	22881
189	Ga0209051_1004299	3300025303	Bacteria	8853
190	Ga0209051_1049144	3300025303	Bacteria	1423
191	Ga0207692_10189400	3300025898	Bacteria	1203
192	Ga0207642_10002082	3300025899	Bacteria	6184
193	Ga0207710_10000204	3300025900	Bacteria	54757
194	Ga0207710_10004352	3300025900	Bacteria	6193
195	Ga0207710_10031449	3300025900	Bacteria	2321
196	Ga0207688_10003073	3300025901	Bacteria	9104
197	Ga0207688_10006359	3300025901	Bacteria	6433
198	Ga0207680_10009043	3300025903	Bacteria	4922
199	Ga0207680_10244449	3300025903	Bacteria	1238
200	Ga0207647_10061975	3300025904	Bacteria	2280
201	Ga0207647_10171361	3300025904	Bacteria	1263
202	Ga0207699_10009544	3300025906	Bacteria	4837
203	Ga0207693_10001758	3300025915	Bacteria	19018
204	Ga0207663_10000605	3300025916	Bacteria	15897
205	Ga0207662_10125827	3300025918	Bacteria	1612
206	Ga0207681_10005675	3300025923	Bacteria	7662
207	Ga0207681_10009283	3300025923	Bacteria	6007
208	Ga0207694_10194037	3300025924	Bacteria	1651
209	Ga0207687_10002341	3300025927	Bacteria	12898
210	Ga0207700_10453093	3300025928	Bacteria	1131
211	Ga0207664_10037870	3300025929	Bacteria	3735
212	Ga0207644_10156180	3300025931	Bacteria	1769
213	Ga0207690_10016541	3300025932	Bacteria	4490
214	Ga0207690_10068189	3300025932	Bacteria	2443
215	Ga0207706_10030350	3300025933	Bacteria	4823
216	Ga0207706_10148865	3300025933	Bacteria	2059
217	Ga0207686_10002014	3300025934	Bacteria	11210
218	Ga0207686_10175763	3300025934	Bacteria	1514
219	Ga0207709_10048322	3300025935	Bacteria	2592
220	Ga0207670_10217917	3300025936	Bacteria	1459
221	Ga0207669_10002905	3300025937	Bacteria	7355
222	Ga0207669_10494026	3300025937	Bacteria	978
223	Ga0207704_10000386	3300025938	Bacteria	20307
224	Ga0207704_10401055	3300025938	Bacteria	1082
225	Ga0207691_10062919	3300025940	Bacteria	3366
226	Ga0207691_10148525	3300025940	Bacteria	2062
227	Ga0207711_10000600	3300025941	Bacteria	36342
228	Ga0207711_10024745	3300025941	Bacteria	5036
229	Ga0207711_10362267	3300025941	Bacteria	1343
230	Ga0207689_10102672	3300025942	Bacteria	2349
231	Ga0207679_10369370	3300025945	Bacteria	1255
232	Ga0207712_10000905	3300025961	Bacteria	21476
233	Ga0207712_10005285	3300025961	Bacteria	8156
234	Ga0207668_10000656	3300025972	Bacteria	21222
235	Ga0207668_10001919	3300025972	Bacteria	12172
236	Ga0207668_10687452	3300025972	Bacteria	898
237	Ga0207640_10016662	3300025981	Bacteria	4281
238	Ga0207640_10019500	3300025981	Bacteria	4008
239	Ga0207658_10000963	3300025986	Bacteria	23730
240	Ga0207658_10004324	3300025986	Bacteria	9888
241	Ga0207658_10028830	3300025986	Bacteria	3913
242	Ga0207658_10144825	3300025986	Bacteria	1928
243	Ga0207677_10004080	3300026023	Bacteria	7807
244	Ga0207703_10016921	3300026035	Bacteria	5688
245	Ga0207703_10124232	3300026035	Bacteria	2219
246	Ga0207703_10598012	3300026035	Bacteria	1043
247	Ga0207639_10020359	3300026041	Bacteria	4748
248	Ga0207639_10255624	3300026041	Bacteria	1530
249	Ga0207678_10038210	3300026067	Bacteria	4172
250	Ga0207678_10050836	3300026067	Bacteria	3580
251	Ga0207678_10076180	3300026067	Bacteria	2873
252	Ga0207708_10031603	3300026075	Bacteria	4019
253	Ga0207708_10190496	3300026075	Bacteria	1632
254	Ga0207702_10209844	3300026078	Bacteria	1810
255	Ga0207641_10001390	3300026088	Bacteria	23826
256	Ga0207641_10021260	3300026088	Bacteria	5335
257	Ga0207641_10077449	3300026088	Bacteria	2877
258	Ga0207648_10000965	3300026089	Bacteria	32491
259	Ga0207648_10122818	3300026089	Bacteria	2283
260	Ga0207676_10225222	3300026095	Bacteria	1673
261	Ga0207676_10293603	3300026095	Bacteria	1481
262	Ga0207675_100001845	3300026118	Bacteria	21265
263	Ga0207675_100292884	3300026118	Bacteria	1584
264	Ga0207683_10001132	3300026121	Bacteria	24270
265	Ga0207683_10030342	3300026121	Bacteria	4684
266	Ga0207683_10139868	3300026121	Bacteria	2181
267	Ga0207698_10010825	3300026142	Bacteria	5886
268	Ga0209813_10091471	3300027866	Bacteria	1022
269	Ga0268266_10001009	3300028379	Bacteria	35417
270	Ga0268266_10004984	3300028379	Bacteria	12556
271	Ga0268266_10246224	3300028379	Bacteria	1652
272	Ga0268266_10308791	3300028379	Bacteria	1477
273	Ga0268265_10000063	3300028380	Bacteria	144643
274	Ga0268265_10011077	3300028380	Bacteria	6093
275	Ga0268264_10000007	3300028381	Bacteria	815790
276	Ga0268264_10002004	3300028381	Bacteria	18286
277	Ga0265327_10000125	3300031251	Bacteria	167832
278	Ga0265327_10003621	3300031251	Bacteria	14538
279	Ga0265327_10017697	3300031251	Bacteria	4455
280	Ga0307413_10021357	3300031824	Bacteria	3464
281	Ga0307413_10121899	3300031824	Bacteria	1768
282	Ga0307413_10142274	3300031824	Bacteria	1659
283	Ga0307410_10055255	3300031852	Bacteria	2695
284	Ga0307406_10185481	3300031901	Bacteria	1518
285	Ga0307409_100131860	3300031995	Bacteria	2137
286	Ga0307416_100190322	3300032002	Bacteria	1934
287	Ga0307416_100191451	3300032002	Bacteria	1930
288	Ga0373960_0043344	3300035121	Bacteria	1310
289	Ga0373931_0016240	3300035691	Bacteria	3662
290	Ga0373947_0032891	3300035725	Bacteria	3059
291	Ga0436364_0974792	3300037853	Bacteria	5505
292	Ga0436365_0666108	3300039437	Bacteria	3827
293	Ga0436365_1089628	3300039437	Bacteria	3799
294	Ga0436363_0565692	3300039450	Bacteria	4158
295	Ga0439466_0048423	3300041411	Bacteria	1398
296	Ga0439466_0088292	3300041411	Bacteria	973
297	Ga0439465_0003761	3300041413	Bacteria	4950
298	Ga0439465_0008600	3300041413	Bacteria	3221
299	Ga0439465_0023632	3300041413	Bacteria	1934
300	Ga0451793_1070389	3300041452	Bacteria	1242
301	Ga0451793_1337666	3300041452	Bacteria	4546
302	Ga0451841_0768560	3300041498	Bacteria	1066
303	Ga0451853_0465000	3300041512	Bacteria	930
304	Ga0439431_0003659	3300041997	Bacteria	3395
305	Ga0439434_0013767	3300042435	Bacteria	2402
306	Ga0439434_0032892	3300042435	Bacteria	1579
307	Ga0439435_0008321	3300042436	Bacteria	2403
308	Ga0466969_0103875	3300044656	Bacteria	1335
309	Ga0466972_0061964	3300044658	Bacteria	1793
310	Ga0466972_0087280	3300044658	Bacteria	1482
311	Ga0466965_0012370	3300044683	Bacteria	4012
312	Ga0466965_0068204	3300044683	Bacteria	1786
313	Ga0466966_0001665	3300044684	Bacteria	14331
314	Ga0466966_0004683	3300044684	Bacteria	9000
315	Ga0466963_0130404	3300044694	Bacteria	1736
316	Ga0466964_0029236	3300044706	Bacteria	2175
317	Ga0466971_0043729	3300044719	Bacteria	2012
318	Ga0466968_0003710	3300044735	Bacteria	5666
319	Ga0466968_0012781	3300044735	Bacteria	3293
320	Ga0466970_0004314	3300044765	Bacteria	6995
321	Ga0466957_0051750	3300044842	Bacteria	2500
322	Ga0466960_0000092	3300044901	Bacteria	29454
323	Ga0466960_0153191	3300044901	Bacteria	1233
324	Ga0466959_0036658	3300045049	Bacteria	3623
325	Ga0466959_0060275	3300045049	Bacteria	2761
326	Ga0466958_0007349	3300045836	Bacteria	6052
327	Ga0466967_0087674	3300045976	Bacteria	2822
328	Ga0466967_0100557	3300045976	Bacteria	2642
329	Ga0466967_0314538	3300045976	Bacteria	1509
330	Ga0466967_0615210	3300045976	Bacteria	1073
331	Ga0495603_0051373	3300046455	Bacteria	2450
332	Ga0495629_0006518	3300046459	Bacteria	8649
333	Ga0495638_0054467	3300046460	Bacteria	2486
334	Ga0495638_0209287	3300046460	Bacteria	1096
335	Ga0495648_0018897	3300046524	Bacteria	4862
336	Ga0495654_0018905	3300046530	Bacteria	3605
337	Ga0495668_0044829	3300046616	Bacteria	2458
338	Ga0495611_0123155	3300046648	Bacteria	1209
339	Ga0495625_0050604	3300046660	Bacteria	2981
340	Ga0495658_0061066	3300046683	Bacteria	2163
341	Ga0495613_0100954	3300046689	Bacteria	2084
342	Ga0495581_0092185	3300047315	Bacteria	1759
343	Ga0495672_0010866	3300047320	Bacteria	6458
344	Ga0495672_0058916	3300047320	Bacteria	2224
345	Ga0495673_0006080	3300047469	Bacteria	7168
346	Ga0495686_0001060	3300047472	Bacteria	32862
347	Ga0495593_0014061	3300047673	Bacteria	4556
348	Ga0496100_0000036	3300048903	Bacteria	97367
349	Ga0496100_0000295	3300048903	Bacteria	24832
350	Ga0496100_0003673	3300048903	Bacteria	8032
351	Ga0496100_0004905	3300048903	Bacteria	7147
352	Ga0496100_0149047	3300048903	Bacteria	1666
353	Ga0496101_0000069	3300048904	Bacteria	120917
354	Ga0496101_0000177	3300048904	Bacteria	51019
355	Ga0496101_0002774	3300048904	Bacteria	10746
356	Ga0496101_0022061	3300048904	Bacteria	4380
357	Ga0496102_0000001	3300048905	Bacteria	873433
358	Ga0496102_0000112	3300048905	Bacteria	116902
359	Ga0496102_0009296	3300048905	Bacteria	8438
360	Ga0496102_0013564	3300048905	Bacteria	7063
361	Ga0496102_0130254	3300048905	Bacteria	2354
362	Ga0496102_0135257	3300048905	Bacteria	2309
363	Ga0496103_0000003	3300048906	Bacteria	603967
364	Ga0496103_0000298	3300048906	Bacteria	45518
365	Ga0496103_0000778	3300048906	Bacteria	23469
366	Ga0496103_0001180	3300048906	Bacteria	17934
367	Ga0496103_0078425	3300048906	Bacteria	2074
368	Ga0496103_0140523	3300048906	Bacteria	1544
369	Ga0496104_0016861	3300048907	Bacteria	6641
370	Ga0496104_0115827	3300048907	Bacteria	2572
371	Ga0496104_0669434	3300048907	Bacteria	946
372	Ga0496105_0015724	3300048908	Bacteria	6038
373	Ga0496105_0272217	3300048908	Bacteria	1367
374	Ga0496105_0426768	3300048908	Bacteria	1049
375	Ga0496106_0001476	3300048909	Bacteria	17681
376	Ga0496106_0004114	3300048909	Bacteria	10837
377	Ga0496106_0012284	3300048909	Bacteria	6319
378	Ga0496106_0040023	3300048909	Bacteria	3510
379	Ga0496107_0000874	3300048910	Bacteria	17738
380	Ga0496107_0002774	3300048910	Bacteria	11543
381	Ga0496107_0010428	3300048910	Bacteria	6455
382	Ga0496107_0084755	3300048910	Bacteria	2312
383	Ga0496108_0000788	3300048911	Bacteria	24747
384	Ga0496108_0005342	3300048911	Bacteria	10383
385	Ga0496108_0104577	3300048911	Bacteria	2416
386	Ga0496109_0000138	3300048912	Bacteria	72894
387	Ga0496109_0005186	3300048912	Bacteria	10879
388	Ga0496109_0020459	3300048912	Bacteria	5845
389	Ga0496109_0040782	3300048912	Bacteria	4205
390	Ga0496109_0564504	3300048912	Bacteria	1073
391	Ga0496110_0000293	3300048913	Bacteria	32698
392	Ga0496110_0026714	3300048913	Bacteria	4944
393	Ga0496110_0109681	3300048913	Bacteria	2479
394	Ga0496110_0286454	3300048913	Bacteria	1500
395	Ga0496111_0021424	3300048914	Bacteria	4513
396	Ga0496111_0191099	3300048914	Bacteria	1522
397	Ga0496112_0001680	3300048915	Bacteria	17227
398	Ga0496112_0014523	3300048915	Bacteria	7314
399	Ga0496112_0071254	3300048915	Bacteria	3435
400	Ga0496114_0000454	3300048917	Bacteria	30133
401	Ga0496114_0001224	3300048917	Bacteria	19407
402	Ga0496114_0002249	3300048917	Bacteria	14706
403	Ga0496115_0011094	3300048918	Bacteria	6752
404	Ga0496115_0018464	3300048918	Bacteria	5354
405	Ga0496115_0127449	3300048918	Bacteria	2097
406	Ga0496116_0000013	3300048919	Bacteria	603993
407	Ga0496116_0002782	3300048919	Bacteria	17971
408	Ga0496116_0021482	3300048919	Bacteria	4866
409	Ga0496117_0000013	3300048920	Bacteria	603995
410	Ga0496117_0000197	3300048920	Bacteria	118822
411	Ga0496117_0012493	3300048920	Bacteria	7476
412	Ga0496118_0000011	3300048921	Bacteria	603995
413	Ga0496118_0005867	3300048921	Bacteria	13762
414	Ga0496118_0008836	3300048921	Bacteria	10310
415	Ga0496118_0173275	3300048921	Bacteria	1315
416	Ga0496119_0001695	3300048922	Bacteria	25743
417	Ga0496119_0003803	3300048922	Bacteria	15437
418	Ga0496121_0000027	3300048924	Bacteria	444747
419	Ga0496121_0005250	3300048924	Bacteria	16747
420	Ga0496122_0000343	3300048925	Bacteria	100701
421	Ga0496123_0004939	3300048926	Bacteria	13677
422	Ga0496124_0000016	3300048927	Bacteria	444747
423	Ga0496124_0069074	3300048927	Bacteria	2934
424	Ga0496125_0000008	3300048928	Bacteria	704677
425	Ga0496125_0009412	3300048928	Bacteria	10044
426	Ga0496125_0079252	3300048928	Bacteria	2521
427	Ga0496126_0000025	3300048929	Bacteria	444747
428	Ga0496126_0003494	3300048929	Bacteria	19830
429	Ga0496126_0095127	3300048929	Bacteria	2613
430	Ga0496126_0212663	3300048929	Bacteria	1627
431	Ga0501032_0007048	3300049569	Bacteria	8246
432	Ga0501034_0010163	3300049571	Bacteria	9817
433	Ga0501034_0088801	3300049571	Bacteria	3089
434	Ga0501036_0003975	3300049572	Bacteria	11879
435	Ga0501037_0002275	3300049573	Bacteria	13871
436	Ga0501038_0004018	3300049574	Bacteria	13668
437	Ga0501039_0029365	3300049575	Bacteria	4234
438	Ga0501043_0011867	3300049579	Bacteria	6823
439	Ga0501043_0190245	3300049579	Bacteria	1596
440	Ga0501047_0186469	3300049581	Bacteria	1940
441	Ga0501070_0000383	3300049586	Bacteria	40471
442	Ga0501071_0469166	3300049587	Bacteria	964
443	Ga0501073_0011558	3300049589	Bacteria	6456
444	Ga0501044_0008163	3300049823	Bacteria	11487
445	Ga0501044_0056232	3300049823	Bacteria	4039
446	nmdc:mga03683_142761_c1	3300050489	Bacteria	1077
447	nmdc:mga03683_33759_c1	3300050489	Bacteria	1448
448	nmdc:mga03n38_11005_c1	3300050490	Bacteria	3354
449	nmdc:mga03n38_129764_c1	3300050490	Bacteria	1248
450	nmdc:mga03n38_27394_c1	3300050490	Bacteria	2364
451	nmdc:mga03n38_28769_c1	3300050490	Bacteria	2320
452	nmdc:mga03n38_29271_c1	3300050490	Bacteria	2303
453	nmdc:mga03n38_44749_c1	3300050490	Bacteria	1946
454	nmdc:mga00v17_18387_c1	3300050491	Bacteria	3969
455	nmdc:mga00v17_185454_c1	3300050491	Bacteria	1343
456	nmdc:mga00v17_214066_c1	3300050491	Bacteria	1247
457	nmdc:mga00v17_4403_c1	3300050491	Bacteria	7324
458	nmdc:mga00v17_55487_c1	3300050491	Bacteria	2420
459	nmdc:mga0yw44_104389_c1	3300050492	Bacteria	1809
460	nmdc:mga0yw44_28890_c1	3300050492	Bacteria	3195
461	nmdc:mga0yw44_382198_c1	3300050492	Bacteria	951
462	nmdc:mga0yw44_78383_c1	3300050492	Bacteria	2066
463	nmdc:mga0yw44_93422_c1	3300050492	Bacteria	1905
464	nmdc:mga06z11_850_c1	3300050494	Bacteria	11183
465	nmdc:mga07m45_13508_c1	3300050496	Bacteria	4335
466	nmdc:mga07m45_161834_c1	3300050496	Bacteria	1299
467	nmdc:mga07m45_328_c1	3300050496	Bacteria	19287
468	nmdc:mga05p37_39833_c1	3300050507	Bacteria	5770
469	nmdc:mga05p37_672662_c1	3300050507	Bacteria	1155
470	nmdc:mga0qj67_111971_c1	3300050509	Bacteria	2204
471	nmdc:mga0sz30_127858_c1	3300050516	Bacteria	1119
472	nmdc:mga0sz30_1317_c1	3300050516	Bacteria	8825
473	nmdc:mga0sz30_33423_c1	3300050516	Bacteria	2138
474	nmdc:mga0sz30_52265_c1	3300050516	Bacteria	1734
475	nmdc:mga0sz30_63842_c1	3300050516	Bacteria	1577
476	nmdc:mga0sz30_6554_c1	3300050516	Bacteria	3557
477	nmdc:mga0sz30_66370_c1	3300050516	Bacteria	1548
478	Ga0495655_0016760	3300053083	Bacteria	1584
479	Ga0500643_004404	3300053087	Bacteria	6386
480	Ga0500646_0117434	3300053090	Bacteria	852
481	Ga0500556_0005971	3300053104	Bacteria	3449
482	Ga0500652_003446	3300053131	Bacteria	4797
483	Ga0500652_176095	3300053131	Bacteria	878
484	Ga0500604_0087545	3300053151	Bacteria	1014
485	Ga0500627_0062558	3300053158	Bacteria	1639
486	Ga0500645_000007	3300053730	Bacteria	233700
487	Ga0500645_014941	3300053730	Bacteria	2467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041413	Ga0439465_0023632	Ga0439465_0023632_300_962	220
2	3300031251	Ga0265327_10000125	Ga0265327_10000125126	238
3	3300045976	Ga0466967_0615210	Ga0466967_0615210_74_880	243
4	3300048908	Ga0496105_0272217	Ga0496105_0272217_12_743	243
5	3300005335	Ga0070666_10016040	Ga0070666_100160402	246
6	3300005367	Ga0070667_100000758	Ga0070667_1000007583	246
7	3300025903	Ga0207680_10009043	Ga0207680_100090432	246
8	3300025986	Ga0207658_10004324	Ga0207658_100043243	246
9	3300048903	Ga0496100_0000036	Ga0496100_0000036_87630_88436	246
10	3300048904	Ga0496101_0000069	Ga0496101_0000069_59022_59828	246
11	3300048905	Ga0496102_0135257	Ga0496102_0135257_185_991	246
12	3300048906	Ga0496103_0000298	Ga0496103_0000298_23352_24158	246
13	3300048909	Ga0496106_0012284	Ga0496106_0012284_4962_5768	246
14	3300048910	Ga0496107_0000874	Ga0496107_0000874_9049_9855	246
15	3300048911	Ga0496108_0005342	Ga0496108_0005342_5855_6661	246
16	3300048912	Ga0496109_0000138	Ga0496109_0000138_8859_9665	246
17	3300048913	Ga0496110_0000293	Ga0496110_0000293_26949_27755	246
18	3300048914	Ga0496111_0021424	Ga0496111_0021424_3010_3816	246
19	3300048917	Ga0496114_0000454	Ga0496114_0000454_16786_17592	246
20	3300048918	Ga0496115_0127449	Ga0496115_0127449_62_868	246
21	3300048919	Ga0496116_0002782	Ga0496116_0002782_185_991	246
22	3300048920	Ga0496117_0012493	Ga0496117_0012493_3233_4039	246
23	3300048921	Ga0496118_0005867	Ga0496118_0005867_11028_11834	246
24	3300048922	Ga0496119_0003803	Ga0496119_0003803_2522_3328	246
25	3300048924	Ga0496121_0000027	Ga0496121_0000027_205590_206396	246
26	3300048925	Ga0496122_0000343	Ga0496122_0000343_22014_22820	246
27	3300048926	Ga0496123_0004939	Ga0496123_0004939_12856_13662	246
28	3300048927	Ga0496124_0000016	Ga0496124_0000016_205590_206396	246
29	3300048928	Ga0496125_0000008	Ga0496125_0000008_205590_206396	246
30	3300048929	Ga0496126_0000025	Ga0496126_0000025_205590_206396	246
31	3300003792	Ga0055540_1000061	Ga0055540_100006162	247
32	3300025303	Ga0209051_1000048	Ga0209051_1000048114	247
33	3300006186	Ga0075369_10003148	Ga0075369_100031484	256
34	3300048927	Ga0496124_0069074	Ga0496124_0069074_38_808	256
35	3300050516	nmdc:mga0sz30_1317_c1	nmdc:mga0sz30_1317_c1_6652_7470	256
36	3300025937	Ga0207669_10494026	Ga0207669_104940261	258
37	3300050516	nmdc:mga0sz30_127858_c1	nmdc:mga0sz30_127858_c1_193_972	258
38	3300046660	Ga0495625_0050604	Ga0495625_0050604_415_1200	261
39	3300042436	Ga0439435_0008321	Ga0439435_0008321_1198_1986	262
40	3300044901	Ga0466960_0153191	Ga0466960_0153191_428_1216	262
41	3300053151	Ga0500604_0087545	Ga0500604_0087545_30_818	262
42	3300031251	Ga0265327_10017697	Ga0265327_100176973	263
43	3300053131	Ga0500652_003446	Ga0500652_003446_2448_3248	264
44	iso_pu_bacteria	2738541264	2738666221	264
45	iso_pu_bacteria	2738541356	2739145355	264
46	iso_pu_bacteria	2902837492	2902838291	264
47	iso_pu_bacteria	2643221687	2644489315	265
48	iso_pu_bacteria	2643221715	2644638240	266
49	iso_pu_bacteria	2902810491	2902812118	266
50	iso_pu_bacteria	2939582691	2939588733	266
51	3300003792	Ga0055540_1001120	Ga0055540_10011207	267
52	3300006038	Ga0075365_10333218	Ga0075365_103332182	267
53	3300006051	Ga0075364_10005475	Ga0075364_100054753	267
54	3300025303	Ga0209051_1001240	Ga0209051_100124012	267
55	3300035121	Ga0373960_0043344	Ga0373960_0043344_286_1113	267
56	3300050492	nmdc:mga0yw44_104389_c1	nmdc:mga0yw44_104389_c1_267_1073	267
57	3300050492	nmdc:mga0yw44_78383_c1	nmdc:mga0yw44_78383_c1_1230_2033	267
58	iso_pu_bacteria	2643221692	2644514021	267
59	iso_pu_bacteria	2929212328	2929216680	267
60	3300002074	JGI24748J21848_1008354	JGI24748J21848_10083541	268
61	3300002076	JGI24749J21850_1005836	JGI24749J21850_10058361	268
62	3300002077	JGI24744J21845_10000931	JGI24744J21845_100009315	268
63	3300002239	JGI24034J26672_10007887	JGI24034J26672_100078871	268
64	3300002244	JGI24742J22300_10001585	JGI24742J22300_100015854	268
65	3300003792	Ga0055540_1002997	Ga0055540_10029975	268
66	3300003792	Ga0055540_1003552	Ga0055540_10035524	268
67	3300005330	Ga0070690_100026177	Ga0070690_1000261773	268
68	3300005335	Ga0070666_10192831	Ga0070666_101928311	268
69	3300005338	Ga0068868_100051379	Ga0068868_1000513794	268
70	3300005341	Ga0070691_10031567	Ga0070691_100315673	268
71	3300005345	Ga0070692_10003961	Ga0070692_100039614	268
72	3300005347	Ga0070668_100008873	Ga0070668_1000088734	268
73	3300005347	Ga0070668_100062060	Ga0070668_1000620602	268
74	3300005353	Ga0070669_100018037	Ga0070669_1000180374	268
75	3300005355	Ga0070671_100097762	Ga0070671_1000977622	268
76	3300005355	Ga0070671_100289284	Ga0070671_1002892842	268
77	3300005356	Ga0070674_100000410	Ga0070674_1000004105	268
78	3300005366	Ga0070659_100015530	Ga0070659_1000155304	268
79	3300005367	Ga0070667_100039464	Ga0070667_1000394643	268
80	3300005434	Ga0070709_10092607	Ga0070709_100926072	268
81	3300005437	Ga0070710_10002304	Ga0070710_100023044	268
82	3300005438	Ga0070701_10002032	Ga0070701_100020327	268
83	3300005439	Ga0070711_100001425	Ga0070711_10000142510	268
84	3300005440	Ga0070705_100007253	Ga0070705_1000072536	268
85	3300005441	Ga0070700_100003645	Ga0070700_1000036454	268
86	3300005455	Ga0070663_100022411	Ga0070663_1000224114	268
87	3300005456	Ga0070678_100001358	Ga0070678_1000013589	268
88	3300005459	Ga0068867_100000801	Ga0068867_10000080118	268
89	3300005466	Ga0070685_10070040	Ga0070685_100700403	268
90	3300005536	Ga0070697_100377961	Ga0070697_1003779612	268
91	3300005539	Ga0068853_100000965	Ga0068853_1000009654	268
92	3300005545	Ga0070695_100073083	Ga0070695_1000730832	268
93	3300005546	Ga0070696_100008493	Ga0070696_1000084934	268
94	3300005548	Ga0070665_100004838	Ga0070665_10000483811	268
95	3300005548	Ga0070665_100031673	Ga0070665_1000316734	268
96	3300005549	Ga0070704_100001445	Ga0070704_1000014459	268
97	3300005578	Ga0068854_100000621	Ga0068854_1000006215	268
98	3300005616	Ga0068852_100213100	Ga0068852_1002131002	268
99	3300005617	Ga0068859_100028201	Ga0068859_1000282013	268
100	3300005618	Ga0068864_100327696	Ga0068864_1003276961	268
101	3300005718	Ga0068866_10002051	Ga0068866_100020515	268
102	3300005719	Ga0068861_100000524	Ga0068861_1000005244	268
103	3300005841	Ga0068863_100002886	Ga0068863_1000028868	268
104	3300005841	Ga0068863_100014868	Ga0068863_1000148683	268
105	3300005842	Ga0068858_100007910	Ga0068858_1000079104	268
106	3300005843	Ga0068860_100017188	Ga0068860_1000171884	268
107	3300005844	Ga0068862_100017477	Ga0068862_1000174774	268
108	3300005981	Ga0081538_10061375	Ga0081538_100613752	268
109	3300006038	Ga0075365_10293800	Ga0075365_102938001	268
110	3300006048	Ga0075363_100026177	Ga0075363_1000261772	268
111	3300006051	Ga0075364_10024521	Ga0075364_100245213	268
112	3300006173	Ga0070716_100008122	Ga0070716_1000081223	268
113	3300006175	Ga0070712_100000372	Ga0070712_1000003725	268
114	3300006186	Ga0075369_10038686	Ga0075369_100386862	268
115	3300006186	Ga0075369_10069670	Ga0075369_100696702	268
116	3300006353	Ga0075370_10037685	Ga0075370_100376852	268
117	3300006358	Ga0068871_100646368	Ga0068871_1006463681	268
118	3300006881	Ga0068865_100028122	Ga0068865_1000281222	268
119	3300006931	Ga0097620_100028201	Ga0097620_1000282013	268
120	3300009098	Ga0105245_10012330	Ga0105245_100123304	268
121	3300009098	Ga0105245_10668643	Ga0105245_106686432	268
122	3300009101	Ga0105247_10001060	Ga0105247_1000106018	268
123	3300009147	Ga0114129_10433235	Ga0114129_104332352	268
124	3300009148	Ga0105243_10001194	Ga0105243_1000119421	268
125	3300009148	Ga0105243_10385116	Ga0105243_103851162	268
126	3300009176	Ga0105242_10008314	Ga0105242_100083144	268
127	3300009177	Ga0105248_10515931	Ga0105248_105159311	268
128	3300009553	Ga0105249_10001483	Ga0105249_1000148317	268
129	3300009553	Ga0105249_10047057	Ga0105249_100470574	268
130	3300010375	Ga0105239_10011719	Ga0105239_100117196	268
131	3300010375	Ga0105239_10543484	Ga0105239_105434842	268
132	3300013297	Ga0157378_10012518	Ga0157378_100125184	268
133	3300013306	Ga0163162_10019755	Ga0163162_100197554	268
134	3300013307	Ga0157372_10014417	Ga0157372_100144174	268
135	3300013308	Ga0157375_10001067	Ga0157375_100010675	268
136	3300014325	Ga0163163_10022728	Ga0163163_100227282	268
137	3300014326	Ga0157380_10002117	Ga0157380_1000211710	268
138	3300014968	Ga0157379_10253959	Ga0157379_102539591	268
139	3300014969	Ga0157376_10239933	Ga0157376_102399332	268
140	3300017792	Ga0163161_10002340	Ga0163161_100023404	268
141	3300021384	Ga0213876_10040123	Ga0213876_100401233	268
142	3300025303	Ga0209051_1000540	Ga0209051_100054027	268
143	3300025303	Ga0209051_1004299	Ga0209051_10042996	268
144	3300025899	Ga0207642_10002082	Ga0207642_100020824	268
145	3300025900	Ga0207710_10004352	Ga0207710_100043525	268
146	3300025901	Ga0207688_10003073	Ga0207688_100030735	268
147	3300025904	Ga0207647_10061975	Ga0207647_100619752	268
148	3300025906	Ga0207699_10009544	Ga0207699_100095442	268
149	3300025915	Ga0207693_10001758	Ga0207693_100017585	268
150	3300025916	Ga0207663_10000605	Ga0207663_1000060512	268
151	3300025923	Ga0207681_10009283	Ga0207681_100092834	268
152	3300025927	Ga0207687_10002341	Ga0207687_100023414	268
153	3300025931	Ga0207644_10156180	Ga0207644_101561801	268
154	3300025932	Ga0207690_10016541	Ga0207690_100165414	268
155	3300025933	Ga0207706_10030350	Ga0207706_100303505	268
156	3300025934	Ga0207686_10002014	Ga0207686_100020146	268
157	3300025935	Ga0207709_10048322	Ga0207709_100483223	268
158	3300025937	Ga0207669_10002905	Ga0207669_100029054	268
159	3300025938	Ga0207704_10000386	Ga0207704_1000038617	268
160	3300025940	Ga0207691_10148525	Ga0207691_101485253	268
161	3300025941	Ga0207711_10362267	Ga0207711_103622672	268
162	3300025961	Ga0207712_10005285	Ga0207712_100052857	268
163	3300025972	Ga0207668_10001919	Ga0207668_100019195	268
164	3300025981	Ga0207640_10016662	Ga0207640_100166622	268
165	3300025986	Ga0207658_10028830	Ga0207658_100288303	268
166	3300026023	Ga0207677_10004080	Ga0207677_100040804	268
167	3300026035	Ga0207703_10016921	Ga0207703_100169214	268
168	3300026041	Ga0207639_10020359	Ga0207639_100203594	268
169	3300026067	Ga0207678_10038210	Ga0207678_100382104	268
170	3300026088	Ga0207641_10021260	Ga0207641_100212605	268
171	3300026088	Ga0207641_10077449	Ga0207641_100774492	268
172	3300026089	Ga0207648_10000965	Ga0207648_1000096518	268
173	3300026095	Ga0207676_10225222	Ga0207676_102252223	268
174	3300026118	Ga0207675_100001845	Ga0207675_10000184517	268
175	3300026118	Ga0207675_100292884	Ga0207675_1002928842	268
176	3300026121	Ga0207683_10001132	Ga0207683_1000113222	268
177	3300026142	Ga0207698_10010825	Ga0207698_100108253	268
178	3300028379	Ga0268266_10001009	Ga0268266_1000100922	268
179	3300028379	Ga0268266_10246224	Ga0268266_102462242	268
180	3300028380	Ga0268265_10011077	Ga0268265_100110775	268
181	3300028381	Ga0268264_10002004	Ga0268264_100020044	268
182	3300031251	Ga0265327_10003621	Ga0265327_1000362110	268
183	3300031901	Ga0307406_10185481	Ga0307406_101854812	268
184	3300035691	Ga0373931_0016240	Ga0373931_0016240_2402_3208	268
185	3300039437	Ga0436365_1089628	Ga0436365_1089628_2056_2865	268
186	3300041411	Ga0439466_0088292	Ga0439466_0088292_124_930	268
187	3300041413	Ga0439465_0003761	Ga0439465_0003761_908_1714	268
188	3300041413	Ga0439465_0008600	Ga0439465_0008600_589_1395	268
189	3300041452	Ga0451793_1337666	Ga0451793_1337666_1659_2468	268
190	3300041498	Ga0451841_0768560	Ga0451841_0768560_74_883	268
191	3300041997	Ga0439431_0003659	Ga0439431_0003659_388_1200	268
192	3300042435	Ga0439434_0013767	Ga0439434_0013767_238_1050	268
193	3300042435	Ga0439434_0032892	Ga0439434_0032892_296_1102	268
194	3300044683	Ga0466965_0012370	Ga0466965_0012370_1959_2777	268
195	3300044901	Ga0466960_0000092	Ga0466960_0000092_9883_10701	268
196	3300048904	Ga0496101_0022061	Ga0496101_0022061_2783_3589	268
197	3300048905	Ga0496102_0013564	Ga0496102_0013564_3854_4660	268
198	3300048905	Ga0496102_0130254	Ga0496102_0130254_743_1552	268
199	3300048906	Ga0496103_0001180	Ga0496103_0001180_3643_4449	268
200	3300048906	Ga0496103_0140523	Ga0496103_0140523_312_1118	268
201	3300048907	Ga0496104_0115827	Ga0496104_0115827_1431_2237	268
202	3300048907	Ga0496104_0669434	Ga0496104_0669434_67_873	268
203	3300048909	Ga0496106_0004114	Ga0496106_0004114_6291_7097	268
204	3300048910	Ga0496107_0002774	Ga0496107_0002774_3610_4416	268
205	3300048912	Ga0496109_0040782	Ga0496109_0040782_1082_1888	268
206	3300048913	Ga0496110_0026714	Ga0496110_0026714_3500_4309	268
207	3300048915	Ga0496112_0071254	Ga0496112_0071254_2277_3083	268
208	3300048917	Ga0496114_0001224	Ga0496114_0001224_14892_15698	268
209	3300048918	Ga0496115_0018464	Ga0496115_0018464_859_1665	268
210	3300049569	Ga0501032_0007048	Ga0501032_0007048_2325_3134	268
211	3300049571	Ga0501034_0010163	Ga0501034_0010163_3678_4487	268
212	3300049572	Ga0501036_0003975	Ga0501036_0003975_5079_5888	268
213	3300049573	Ga0501037_0002275	Ga0501037_0002275_5894_6703	268
214	3300049574	Ga0501038_0004018	Ga0501038_0004018_1787_2596	268
215	3300049575	Ga0501039_0029365	Ga0501039_0029365_973_1782	268
216	3300049579	Ga0501043_0011867	Ga0501043_0011867_22_831	268
217	3300049579	Ga0501043_0190245	Ga0501043_0190245_415_1221	268
218	3300049586	Ga0501070_0000383	Ga0501070_0000383_33320_34129	268
219	3300049587	Ga0501071_0469166	Ga0501071_0469166_132_941	268
220	3300049589	Ga0501073_0011558	Ga0501073_0011558_1448_2257	268
221	3300049823	Ga0501044_0008163	Ga0501044_0008163_5747_6556	268
222	3300050490	nmdc:mga03n38_11005_c1	nmdc:mga03n38_11005_c1_374_1180	268
223	3300050490	nmdc:mga03n38_129764_c1	nmdc:mga03n38_129764_c1_147_953	268
224	3300050491	nmdc:mga00v17_185454_c1	nmdc:mga00v17_185454_c1_367_1173	268
225	3300050491	nmdc:mga00v17_55487_c1	nmdc:mga00v17_55487_c1_537_1349	268
226	3300050492	nmdc:mga0yw44_93422_c1	nmdc:mga0yw44_93422_c1_483_1289	268
227	3300050507	nmdc:mga05p37_672662_c1	nmdc:mga05p37_672662_c1_251_1057	268
228	3300050516	nmdc:mga0sz30_33423_c1	nmdc:mga0sz30_33423_c1_612_1418	268
229	3300050516	nmdc:mga0sz30_6554_c1	nmdc:mga0sz30_6554_c1_2238_3044	268
230	iso_pu_bacteria	2738541274	2738705843	268
231	iso_pu_bacteria	2738543028	2739330332	268
232	iso_pu_bacteria	2784132109	2784471348	268
233	iso_pu_bacteria	2842134933	2842140044	268
234	iso_pu_bacteria	2902792274	2902796604	268
235	iso_pu_bacteria	2902799365	2902800204	268
236	3300005455	Ga0070663_100081068	Ga0070663_1000810683	269
237	3300005539	Ga0068853_100061738	Ga0068853_1000617382	269
238	3300005842	Ga0068858_100266520	Ga0068858_1002665202	269
239	3300006038	Ga0075365_10060919	Ga0075365_100609192	269
240	3300025903	Ga0207680_10244449	Ga0207680_102444492	269
241	3300026041	Ga0207639_10255624	Ga0207639_102556243	269
242	3300026067	Ga0207678_10050836	Ga0207678_100508362	269
243	3300045976	Ga0466967_0314538	Ga0466967_0314538_359_1168	269
244	3300047472	Ga0495686_0001060	Ga0495686_0001060_26517_27326	269
245	3300048903	Ga0496100_0149047	Ga0496100_0149047_768_1580	269
246	3300048908	Ga0496105_0426768	Ga0496105_0426768_174_986	269
247	3300048909	Ga0496106_0040023	Ga0496106_0040023_501_1313	269
248	3300048913	Ga0496110_0109681	Ga0496110_0109681_1193_2005	269
249	3300005353	Ga0070669_100001457	Ga0070669_1000014573	270
250	3300005367	Ga0070667_100000077	Ga0070667_10000007724	270
251	3300005548	Ga0070665_100057095	Ga0070665_1000570953	270
252	3300005617	Ga0068859_100001748	Ga0068859_10000174810	270
253	3300005841	Ga0068863_100002287	Ga0068863_1000022878	270
254	3300005842	Ga0068858_100007993	Ga0068858_1000079931	270
255	3300005843	Ga0068860_100000010	Ga0068860_100000010324	270
256	3300005844	Ga0068862_100000052	Ga0068862_1000000521	270
257	3300005844	Ga0068862_100056172	Ga0068862_1000561723	270
258	3300006177	Ga0075362_10085050	Ga0075362_100850502	270
259	3300006353	Ga0075370_10278963	Ga0075370_102789632	270
260	3300006931	Ga0097620_100001748	Ga0097620_10000174810	270
261	3300009101	Ga0105247_10000220	Ga0105247_1000022028	270
262	3300009177	Ga0105248_10000745	Ga0105248_1000074524	270
263	3300009553	Ga0105249_10001369	Ga0105249_100013691	270
264	3300013306	Ga0163162_10842988	Ga0163162_108429881	270
265	3300014325	Ga0163163_10390731	Ga0163163_103907312	270
266	3300021377	Ga0213874_10005669	Ga0213874_100056693	270
267	3300025900	Ga0207710_10000204	Ga0207710_1000020423	270
268	3300025923	Ga0207681_10005675	Ga0207681_100056753	270
269	3300025941	Ga0207711_10000600	Ga0207711_1000060012	270
270	3300025961	Ga0207712_10000905	Ga0207712_100009051	270
271	3300025986	Ga0207658_10000963	Ga0207658_100009633	270
272	3300026035	Ga0207703_10124232	Ga0207703_101242321	270
273	3300026088	Ga0207641_10001390	Ga0207641_100013905	270
274	3300028379	Ga0268266_10004984	Ga0268266_100049844	270
275	3300028380	Ga0268265_10000063	Ga0268265_100000631	270
276	3300028381	Ga0268264_10000007	Ga0268264_10000007137	270
277	3300031824	Ga0307413_10142274	Ga0307413_101422742	270
278	3300039450	Ga0436363_0565692	Ga0436363_0565692_1860_2675	270
279	3300046524	Ga0495648_0018897	Ga0495648_0018897_956_1768	270
280	3300046530	Ga0495654_0018905	Ga0495654_0018905_792_1604	270
281	3300046616	Ga0495668_0044829	Ga0495668_0044829_240_1052	270
282	3300046648	Ga0495611_0123155	Ga0495611_0123155_131_943	270
283	3300047320	Ga0495672_0010866	Ga0495672_0010866_3626_4438	270
284	3300047469	Ga0495673_0006080	Ga0495673_0006080_4529_5341	270
285	3300048903	Ga0496100_0003673	Ga0496100_0003673_44_856	270
286	3300048904	Ga0496101_0002774	Ga0496101_0002774_5808_6620	270
287	3300048905	Ga0496102_0000112	Ga0496102_0000112_102042_102854	270
288	3300048905	Ga0496102_0009296	Ga0496102_0009296_6267_7079	270
289	3300048906	Ga0496103_0000778	Ga0496103_0000778_1649_2461	270
290	3300048910	Ga0496107_0084755	Ga0496107_0084755_747_1559	270
291	3300048919	Ga0496116_0021482	Ga0496116_0021482_2790_3602	270
292	3300048920	Ga0496117_0000197	Ga0496117_0000197_63188_64000	270
293	3300048921	Ga0496118_0008836	Ga0496118_0008836_1323_2135	270
294	3300048921	Ga0496118_0173275	Ga0496118_0173275_464_1276	270
295	3300048922	Ga0496119_0001695	Ga0496119_0001695_14942_15754	270
296	3300048924	Ga0496121_0005250	Ga0496121_0005250_1323_2135	270
297	3300048928	Ga0496125_0009412	Ga0496125_0009412_9071_9883	270
298	3300048929	Ga0496126_0003494	Ga0496126_0003494_14271_15083	270
299	3300049571	Ga0501034_0088801	Ga0501034_0088801_1330_2142	270
300	3300050489	nmdc:mga03683_33759_c1	nmdc:mga03683_33759_c1_270_1082	270
301	3300053090	Ga0500646_0117434	Ga0500646_0117434_18_830	270
302	3300005347	Ga0070668_100004679	Ga0070668_1000046793	271
303	3300005937	Ga0081455_10064372	Ga0081455_100643721	271
304	3300006038	Ga0075365_10006730	Ga0075365_100067302	271
305	3300006048	Ga0075363_100000564	Ga0075363_1000005643	271
306	3300006048	Ga0075363_100001950	Ga0075363_1000019505	271
307	3300006048	Ga0075363_100031815	Ga0075363_1000318153	271
308	3300006048	Ga0075363_100048007	Ga0075363_1000480072	271
309	3300006051	Ga0075364_10002903	Ga0075364_100029033	271
310	3300006051	Ga0075364_10005037	Ga0075364_100050378	271
311	3300006051	Ga0075364_10281390	Ga0075364_102813902	271
312	3300006178	Ga0075367_10005946	Ga0075367_100059465	271
313	3300006178	Ga0075367_10284382	Ga0075367_102843821	271
314	3300006186	Ga0075369_10014606	Ga0075369_100146063	271
315	3300006353	Ga0075370_10005464	Ga0075370_100054643	271
316	3300025972	Ga0207668_10000656	Ga0207668_1000065610	271
317	3300027866	Ga0209813_10091471	Ga0209813_100914712	271
318	3300031824	Ga0307413_10021357	Ga0307413_100213574	271
319	3300031824	Ga0307413_10121899	Ga0307413_101218992	271
320	3300031852	Ga0307410_10055255	Ga0307410_100552552	271
321	3300031995	Ga0307409_100131860	Ga0307409_1001318603	271
322	3300032002	Ga0307416_100190322	Ga0307416_1001903222	271
323	3300032002	Ga0307416_100191451	Ga0307416_1001914513	271
324	3300045976	Ga0466967_0087674	Ga0466967_0087674_1765_2580	271
325	3300050489	nmdc:mga03683_142761_c1	nmdc:mga03683_142761_c1_230_1048	271
326	3300050490	nmdc:mga03n38_28769_c1	nmdc:mga03n38_28769_c1_1007_1825	271
327	3300050490	nmdc:mga03n38_29271_c1	nmdc:mga03n38_29271_c1_674_1492	271
328	3300050490	nmdc:mga03n38_44749_c1	nmdc:mga03n38_44749_c1_42_860	271
329	3300050491	nmdc:mga00v17_4403_c1	nmdc:mga00v17_4403_c1_1025_1843	271
330	3300050492	nmdc:mga0yw44_382198_c1	nmdc:mga0yw44_382198_c1_71_889	271
331	3300050494	nmdc:mga06z11_850_c1	nmdc:mga06z11_850_c1_6620_7438	271
332	3300050496	nmdc:mga07m45_13508_c1	nmdc:mga07m45_13508_c1_3007_3825	271
333	3300050496	nmdc:mga07m45_161834_c1	nmdc:mga07m45_161834_c1_69_887	271
334	3300050496	nmdc:mga07m45_328_c1	nmdc:mga07m45_328_c1_14427_15245	271
335	3300050516	nmdc:mga0sz30_52265_c1	nmdc:mga0sz30_52265_c1_126_944	271
336	3300001991	JGI24743J22301_10002076	JGI24743J22301_100020762	272
337	3300002067	JGI24735J21928_10056054	JGI24735J21928_100560541	272
338	3300002073	JGI24745J21846_1009867	JGI24745J21846_10098672	272
339	3300002077	JGI24744J21845_10007786	JGI24744J21845_100077863	272
340	3300002244	JGI24742J22300_10005368	JGI24742J22300_100053683	272
341	3300005327	Ga0070658_10468085	Ga0070658_104680851	272
342	3300005334	Ga0068869_100096586	Ga0068869_1000965863	272
343	3300005337	Ga0070682_100197567	Ga0070682_1001975672	272
344	3300005344	Ga0070661_100208824	Ga0070661_1002088242	272
345	3300005347	Ga0070668_100313687	Ga0070668_1003136872	272
346	3300005353	Ga0070669_100133732	Ga0070669_1001337321	272
347	3300005366	Ga0070659_100161643	Ga0070659_1001616431	272
348	3300005436	Ga0070713_100044346	Ga0070713_1000443463	272
349	3300005437	Ga0070710_10068582	Ga0070710_100685822	272
350	3300005441	Ga0070700_100020833	Ga0070700_1000208334	272
351	3300005441	Ga0070700_100367915	Ga0070700_1003679152	272
352	3300005444	Ga0070694_100539452	Ga0070694_1005394521	272
353	3300005455	Ga0070663_100064950	Ga0070663_1000649502	272
354	3300005455	Ga0070663_100103801	Ga0070663_1001038012	272
355	3300005456	Ga0070678_100114878	Ga0070678_1001148782	272
356	3300005456	Ga0070678_100291776	Ga0070678_1002917761	272
357	3300005457	Ga0070662_100231739	Ga0070662_1002317391	272
358	3300005547	Ga0070693_100252728	Ga0070693_1002527281	272
359	3300005548	Ga0070665_100024235	Ga0070665_1000242355	272
360	3300005564	Ga0070664_100198827	Ga0070664_1001988272	272
361	3300005578	Ga0068854_100018242	Ga0068854_1000182425	272
362	3300005578	Ga0068854_100056656	Ga0068854_1000566563	272
363	3300005614	Ga0068856_100038726	Ga0068856_1000387263	272
364	3300005614	Ga0068856_100751705	Ga0068856_1007517052	272
365	3300005617	Ga0068859_100613766	Ga0068859_1006137662	272
366	3300005618	Ga0068864_100220481	Ga0068864_1002204812	272
367	3300005618	Ga0068864_100318634	Ga0068864_1003186342	272
368	3300005840	Ga0068870_10137336	Ga0068870_101373361	272
369	3300005843	Ga0068860_100071031	Ga0068860_1000710312	272
370	3300005844	Ga0068862_100450935	Ga0068862_1004509352	272
371	3300005981	Ga0081538_10043742	Ga0081538_100437422	272
372	3300006048	Ga0075363_100018344	Ga0075363_1000183444	272
373	3300006051	Ga0075364_10031371	Ga0075364_100313715	272
374	3300006051	Ga0075364_10064113	Ga0075364_100641132	272
375	3300006051	Ga0075364_10234284	Ga0075364_102342842	272
376	3300006173	Ga0070716_100157507	Ga0070716_1001575072	272
377	3300006186	Ga0075369_10038173	Ga0075369_100381733	272
378	3300006846	Ga0075430_100038999	Ga0075430_1000389995	272
379	3300006880	Ga0075429_100373070	Ga0075429_1003730702	272
380	3300006931	Ga0097620_100613734	Ga0097620_1006137341	272
381	3300007788	Ga0099795_10023071	Ga0099795_100230712	272
382	3300009094	Ga0111539_10336197	Ga0111539_103361972	272
383	3300009101	Ga0105247_10037085	Ga0105247_100370852	272
384	3300009147	Ga0114129_10058641	Ga0114129_100586414	272
385	3300009176	Ga0105242_10202626	Ga0105242_102026262	272
386	3300009177	Ga0105248_10043526	Ga0105248_100435263	272
387	3300009551	Ga0105238_10172183	Ga0105238_101721832	272
388	3300010159	Ga0099796_10096114	Ga0099796_100961141	272
389	3300013296	Ga0157374_10038424	Ga0157374_100384242	272
390	3300013297	Ga0157378_10307824	Ga0157378_103078243	272
391	3300013306	Ga0163162_10110480	Ga0163162_101104802	272
392	3300014325	Ga0163163_10736642	Ga0163163_107366422	272
393	3300014968	Ga0157379_10378177	Ga0157379_103781772	272
394	3300014969	Ga0157376_10778244	Ga0157376_107782441	272
395	3300021384	Ga0213876_10022842	Ga0213876_100228423	272
396	3300025303	Ga0209051_1049144	Ga0209051_10491442	272
397	3300025898	Ga0207692_10189400	Ga0207692_101894001	272
398	3300025900	Ga0207710_10031449	Ga0207710_100314491	272
399	3300025901	Ga0207688_10006359	Ga0207688_100063595	272
400	3300025904	Ga0207647_10171361	Ga0207647_101713612	272
401	3300025918	Ga0207662_10125827	Ga0207662_101258272	272
402	3300025924	Ga0207694_10194037	Ga0207694_101940371	272
403	3300025928	Ga0207700_10453093	Ga0207700_104530931	272
404	3300025929	Ga0207664_10037870	Ga0207664_100378702	272
405	3300025932	Ga0207690_10068189	Ga0207690_100681893	272
406	3300025933	Ga0207706_10148865	Ga0207706_101488652	272
407	3300025934	Ga0207686_10175763	Ga0207686_101757632	272
408	3300025936	Ga0207670_10217917	Ga0207670_102179171	272
409	3300025938	Ga0207704_10401055	Ga0207704_104010551	272
410	3300025940	Ga0207691_10062919	Ga0207691_100629194	272
411	3300025941	Ga0207711_10024745	Ga0207711_100247454	272
412	3300025942	Ga0207689_10102672	Ga0207689_101026724	272
413	3300025945	Ga0207679_10369370	Ga0207679_103693701	272
414	3300025972	Ga0207668_10687452	Ga0207668_106874521	272
415	3300025981	Ga0207640_10019500	Ga0207640_100195004	272
416	3300025986	Ga0207658_10144825	Ga0207658_101448251	272
417	3300026035	Ga0207703_10598012	Ga0207703_105980122	272
418	3300026067	Ga0207678_10076180	Ga0207678_100761802	272
419	3300026075	Ga0207708_10031603	Ga0207708_100316032	272
420	3300026075	Ga0207708_10190496	Ga0207708_101904962	272
421	3300026078	Ga0207702_10209844	Ga0207702_102098442	272
422	3300026089	Ga0207648_10122818	Ga0207648_101228183	272
423	3300026095	Ga0207676_10293603	Ga0207676_102936031	272
424	3300026121	Ga0207683_10030342	Ga0207683_100303424	272
425	3300026121	Ga0207683_10139868	Ga0207683_101398682	272
426	3300028379	Ga0268266_10308791	Ga0268266_103087911	272
427	3300035725	Ga0373947_0032891	Ga0373947_0032891_1828_2646	272
428	3300037853	Ga0436364_0974792	Ga0436364_0974792_1387_2208	272
429	3300039437	Ga0436365_0666108	Ga0436365_0666108_1938_2759	272
430	3300041411	Ga0439466_0048423	Ga0439466_0048423_154_972	272
431	3300041452	Ga0451793_1070389	Ga0451793_1070389_365_1183	272
432	3300041512	Ga0451853_0465000	Ga0451853_0465000_50_868	272
433	3300044656	Ga0466969_0103875	Ga0466969_0103875_61_879	272
434	3300044658	Ga0466972_0061964	Ga0466972_0061964_859_1677	272
435	3300044658	Ga0466972_0087280	Ga0466972_0087280_293_1111	272
436	3300044683	Ga0466965_0068204	Ga0466965_0068204_860_1678	272
437	3300044684	Ga0466966_0001665	Ga0466966_0001665_2894_3712	272
438	3300044684	Ga0466966_0004683	Ga0466966_0004683_997_1815	272
439	3300044694	Ga0466963_0130404	Ga0466963_0130404_761_1579	272
440	3300044706	Ga0466964_0029236	Ga0466964_0029236_976_1794	272
441	3300044719	Ga0466971_0043729	Ga0466971_0043729_1080_1898	272
442	3300044735	Ga0466968_0003710	Ga0466968_0003710_624_1442	272
443	3300044735	Ga0466968_0012781	Ga0466968_0012781_1649_2467	272
444	3300044765	Ga0466970_0004314	Ga0466970_0004314_2966_3784	272
445	3300044842	Ga0466957_0051750	Ga0466957_0051750_663_1481	272
446	3300045049	Ga0466959_0036658	Ga0466959_0036658_2158_2976	272
447	3300045049	Ga0466959_0060275	Ga0466959_0060275_760_1578	272
448	3300045836	Ga0466958_0007349	Ga0466958_0007349_1709_2527	272
449	3300045976	Ga0466967_0100557	Ga0466967_0100557_338_1156	272
450	3300046455	Ga0495603_0051373	Ga0495603_0051373_1236_2054	272
451	3300046459	Ga0495629_0006518	Ga0495629_0006518_7452_8270	272
452	3300046460	Ga0495638_0054467	Ga0495638_0054467_1253_2071	272
453	3300046460	Ga0495638_0209287	Ga0495638_0209287_145_963	272
454	3300046683	Ga0495658_0061066	Ga0495658_0061066_979_1797	272
455	3300046689	Ga0495613_0100954	Ga0495613_0100954_794_1612	272
456	3300047315	Ga0495581_0092185	Ga0495581_0092185_454_1272	272
457	3300047320	Ga0495672_0058916	Ga0495672_0058916_1157_1975	272
458	3300047673	Ga0495593_0014061	Ga0495593_0014061_434_1252	272
459	3300048903	Ga0496100_0000295	Ga0496100_0000295_6829_7647	272
460	3300048903	Ga0496100_0004905	Ga0496100_0004905_122_940	272
461	3300048904	Ga0496101_0000177	Ga0496101_0000177_39319_40137	272
462	3300048905	Ga0496102_0000001	Ga0496102_0000001_729495_730313	272
463	3300048906	Ga0496103_0000003	Ga0496103_0000003_460557_461375	272
464	3300048906	Ga0496103_0078425	Ga0496103_0078425_209_1027	272
465	3300048907	Ga0496104_0016861	Ga0496104_0016861_2210_3028	272
466	3300048908	Ga0496105_0015724	Ga0496105_0015724_1815_2633	272
467	3300048909	Ga0496106_0001476	Ga0496106_0001476_4787_5605	272
468	3300048910	Ga0496107_0010428	Ga0496107_0010428_2638_3456	272
469	3300048911	Ga0496108_0000788	Ga0496108_0000788_6549_7367	272
470	3300048911	Ga0496108_0104577	Ga0496108_0104577_682_1500	272
471	3300048912	Ga0496109_0005186	Ga0496109_0005186_6083_6901	272
472	3300048912	Ga0496109_0020459	Ga0496109_0020459_1067_1885	272
473	3300048912	Ga0496109_0564504	Ga0496109_0564504_152_970	272
474	3300048913	Ga0496110_0286454	Ga0496110_0286454_630_1448	272
475	3300048914	Ga0496111_0191099	Ga0496111_0191099_187_1005	272
476	3300048915	Ga0496112_0001680	Ga0496112_0001680_11515_12333	272
477	3300048915	Ga0496112_0014523	Ga0496112_0014523_4362_5180	272
478	3300048917	Ga0496114_0002249	Ga0496114_0002249_13852_14670	272
479	3300048918	Ga0496115_0011094	Ga0496115_0011094_1036_1854	272
480	3300048919	Ga0496116_0000013	Ga0496116_0000013_142619_143437	272
481	3300048920	Ga0496117_0000013	Ga0496117_0000013_460557_461375	272
482	3300048921	Ga0496118_0000011	Ga0496118_0000011_142621_143439	272
483	3300048928	Ga0496125_0079252	Ga0496125_0079252_687_1505	272
484	3300048929	Ga0496126_0095127	Ga0496126_0095127_811_1629	272
485	3300048929	Ga0496126_0212663	Ga0496126_0212663_121_939	272
486	3300049581	Ga0501047_0186469	Ga0501047_0186469_591_1409	272
487	3300049823	Ga0501044_0056232	Ga0501044_0056232_2750_3568	272
488	3300050490	nmdc:mga03n38_27394_c1	nmdc:mga03n38_27394_c1_1084_1902	272
489	3300050491	nmdc:mga00v17_18387_c1	nmdc:mga00v17_18387_c1_382_1200	272
490	3300050491	nmdc:mga00v17_214066_c1	nmdc:mga00v17_214066_c1_255_1073	272
491	3300050492	nmdc:mga0yw44_28890_c1	nmdc:mga0yw44_28890_c1_1649_2467	272
492	3300050507	nmdc:mga05p37_39833_c1	nmdc:mga05p37_39833_c1_4424_5242	272
493	3300050509	nmdc:mga0qj67_111971_c1	nmdc:mga0qj67_111971_c1_589_1407	272
494	3300050516	nmdc:mga0sz30_63842_c1	nmdc:mga0sz30_63842_c1_152_970	272
495	3300050516	nmdc:mga0sz30_66370_c1	nmdc:mga0sz30_66370_c1_188_1006	272
496	3300053083	Ga0495655_0016760	Ga0495655_0016760_12_830	272
497	3300053087	Ga0500643_004404	Ga0500643_004404_3168_3986	272
498	3300053104	Ga0500556_0005971	Ga0500556_0005971_1925_2743	272
499	3300053131	Ga0500652_176095	Ga0500652_176095_12_830	272
500	3300053158	Ga0500627_0062558	Ga0500627_0062558_70_888	272
501	3300053730	Ga0500645_000007	Ga0500645_000007_138601_139419	272
502	3300053730	Ga0500645_014941	Ga0500645_014941_1501_2319	272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

9

211

0.91 PF15617

C-C_Bond_Lyase

C-C_Bond_Lyase of the TIM-Barrel fold

130

269

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1z6k-assembly1.cif.gz_A	citrate lyase beta subunit complexed with oxaloacetate and magnesium from m. tuberculosis	0.9949	7	223
1u5v-assembly1.cif.gz_A	structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis	0.9948	7	223
1u5h-assembly1.cif.gz_A	structure of citrate lyase beta subunit from mycobacterium tuberculosis	0.994	7	223
1z6k-assembly1.cif.gz_A	citrate lyase beta subunit complexed with oxaloacetate and magnesium from m. tuberculosis	0.9639	7	223
1u5v-assembly1.cif.gz_A	structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis	0.9638	7	223

ID	Description	Score	Start	End	Superfamily
1z6kA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains	0.9935	7	223	3.20.20.60
1z6kA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains	0.9665	7	223	3.20.20.60
1sgjA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains	0.9059	8	221	3.20.20.60
3qllC00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains	0.9046	6	226	3.20.20.60
4l9yB00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains	0.8974	4	223	3.20.20.60

ID	Description	Score	Start	End	GO Terms
AF-A0A5C7MDG5-F1-model_v4	CoA ester lyase	0.9922	1	201	GO:0000287 GO:0006107 GO:0016829
AF-A0A1A3TH43-F1-model_v4	Citrate lyase subunit beta	0.9904	3	214	GO:0000287 GO:0006107 GO:0016829
AF-A0A2S9GHZ2-F1-model_v4	CoA ester lyase	0.9897	63	147	GO:0016829
AF-X8ANV1-F1-model_v4	deleted	0.9872	39	124
AF-A0A523JBC6-F1-model_v4	HpcH/HpaI aldolase/citrate lyase domain-containing protein	0.9826	106	198	GO:0000287 GO:0003824 GO:0006107

Feature Viewer

pLDDT	pTM	Quality
92.84	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F455826

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

9

211

0.91

PF15617

C-C_Bond_Lyase

C-C_Bond_Lyase of the TIM-Barrel fold

130

269

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map