F455845

General Info

Members Datasets Scaffolds Average Seq Length
502 269 502 134

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_12540884|Ga0157378_125408841
Length 137
Sequence MARVTGIGGVFFKSRKDHQALAAWYEKNLGIKLEPWGGAILRWPDDHGEDKAEDKGVTVWCTAAANTDWFSPSESSFMINYRVDDMAGLLAKLRGADVKIVKGPESHENGKFAWILDPEGNKVELWEPMNWDEKNKG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
243 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
244 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
248 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
249 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 2.79
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10062662 3300003320 Bacteria 2250
2 Ga0055531_10027319 3300003794 Bacteria 2006
3 Ga0058863_11441775 3300004799 Bacteria 500
4 Ga0065714_10148579 3300005288 Bacteria 1119
5 Ga0065704_10035083 3300005289 Bacteria 952
6 Ga0065704_10355072 3300005289 Unclassified 805
7 Ga0065712_10068047 3300005290 Bacteria 16179
8 Ga0065712_10239804 3300005290 Bacteria 982
9 Ga0065715_10099278 3300005293 Bacteria 3433
10 Ga0065715_10217048 3300005293 Bacteria 1288
11 Ga0065707_10088575 3300005295 Bacteria 4619
12 Ga0070658_10004673 3300005327 Bacteria 11133
13 Ga0070658_10061896 3300005327 Unclassified 3049
14 Ga0070658_10134783 3300005327 Bacteria 2059
15 Ga0070676_11067136 3300005328 Bacteria 609
16 Ga0070690_100005509 3300005330 Bacteria 7118
17 Ga0070690_100007704 3300005330 Bacteria 6174
18 Ga0070690_100461592 3300005330 Bacteria 943
19 Ga0070670_100025220 3300005331 Bacteria 5117
20 Ga0070670_101106628 3300005331 Bacteria 722
21 Ga0070677_10469521 3300005333 Bacteria 676
22 Ga0068869_100014103 3300005334 Bacteria 5333
23 Ga0068869_100080243 3300005334 Bacteria 2434
24 Ga0068869_100744253 3300005334 Bacteria 839
25 Ga0070666_10000767 3300005335 Bacteria 19409
26 Ga0070666_10002699 3300005335 Bacteria 10708
27 Ga0070666_10601297 3300005335 Bacteria 803
28 Ga0068868_100002891 3300005338 Bacteria 11918
29 Ga0068868_100578712 3300005338 Bacteria 992
30 Ga0070660_100000214 3300005339 Bacteria 38727
31 Ga0070689_100003324 3300005340 Bacteria 10680
32 Ga0070689_100016977 3300005340 Bacteria 5339
33 Ga0070689_100638925 3300005340 Bacteria 925
34 Ga0070691_10018421 3300005341 Bacteria 3219
35 Ga0070687_100000241 3300005343 Bacteria 18833
36 Ga0070661_100291351 3300005344 Bacteria 1268
37 Ga0070661_100954738 3300005344 Bacteria 710
38 Ga0070692_10290024 3300005345 Bacteria 995
39 Ga0070692_11162073 3300005345 Bacteria 548
40 Ga0070669_100013220 3300005353 Bacteria 5868
41 Ga0070669_100085492 3300005353 Bacteria 2355
42 Ga0070669_100354866 3300005353 Bacteria 1191
43 Ga0070675_100003764 3300005354 Bacteria 11517
44 Ga0070675_100388693 3300005354 Bacteria 1243
45 Ga0070671_100001794 3300005355 Bacteria 16314
46 Ga0070671_100001940 3300005355 Bacteria 15865
47 Ga0070671_101499379 3300005355 Bacteria 597
48 Ga0070673_100043700 3300005364 Bacteria 3464
49 Ga0070673_100512093 3300005364 Bacteria 1086
50 Ga0070673_100572870 3300005364 Bacteria 1027
51 Ga0070673_100801891 3300005364 Bacteria 869
52 Ga0070673_101273217 3300005364 Bacteria 690
53 Ga0070688_100000389 3300005365 Bacteria 22221
54 Ga0070688_100002574 3300005365 Bacteria 9188
55 Ga0070659_100001202 3300005366 Bacteria 18849
56 Ga0070659_100282771 3300005366 Bacteria 1380
57 Ga0070667_100216359 3300005367 Bacteria 1704
58 Ga0070667_101422651 3300005367 Bacteria 650
59 Ga0070667_101493685 3300005367 Bacteria 634
60 Ga0070705_100014731 3300005440 Bacteria 4031
61 Ga0070700_100000056 3300005441 Bacteria 83455
62 Ga0070700_100384520 3300005441 Bacteria 1051
63 Ga0070678_100050133 3300005456 Bacteria 3018
64 Ga0070662_100001196 3300005457 Bacteria 15947
65 Ga0070662_100007301 3300005457 Bacteria 7159
66 Ga0070662_100669477 3300005457 Bacteria 876
67 Ga0070662_101301249 3300005457 Unclassified 626
68 Ga0070681_10237887 3300005458 Bacteria 1735
69 Ga0068867_100007657 3300005459 Bacteria 7642
70 Ga0068867_100011658 3300005459 Bacteria 6207
71 Ga0070685_10354947 3300005466 Bacteria 1003
72 Ga0070707_100009815 3300005468 Bacteria 8905
73 Ga0070699_100408909 3300005518 Bacteria 1227
74 Ga0070679_101537795 3300005530 Bacteria 612
75 Ga0070684_100045803 3300005535 Bacteria 3788
76 Ga0070684_100063589 3300005535 Bacteria 3235
77 Ga0070697_100006709 3300005536 Bacteria 8933
78 Ga0068853_100603510 3300005539 Bacteria 1042
79 Ga0070672_100051268 3300005543 Bacteria 3217
80 Ga0070672_100707880 3300005543 Unclassified 882
81 Ga0070686_100019907 3300005544 Bacteria 3965
82 Ga0070695_100090724 3300005545 Unclassified 2040
83 Ga0070695_100120119 3300005545 Bacteria 1797
84 Ga0070696_100294029 3300005546 Bacteria 1242
85 Ga0070693_100000641 3300005547 Bacteria 15412
86 Ga0070665_100001521 3300005548 Bacteria 26874
87 Ga0070665_100038653 3300005548 Bacteria 4797
88 Ga0070665_101114833 3300005548 Bacteria 800
89 Ga0070664_100005842 3300005564 Bacteria 9926
90 Ga0070664_100011822 3300005564 Bacteria 7086
91 Ga0070664_101330394 3300005564 Bacteria 679
92 Ga0068857_100001753 3300005577 Bacteria 17438
93 Ga0068857_100436290 3300005577 Unclassified 1223
94 Ga0068857_100672004 3300005577 Bacteria 983
95 Ga0068854_100011914 3300005578 Bacteria 5681
96 Ga0070702_100111708 3300005615 Bacteria 1695
97 Ga0070702_100646871 3300005615 Bacteria 799
98 Ga0070702_100754426 3300005615 Bacteria 748
99 Ga0068852_100112794 3300005616 Bacteria 2474
100 Ga0068852_100227558 3300005616 Bacteria 1776
101 Ga0068859_100019498 3300005617 Bacteria 6813
102 Ga0068859_100245698 3300005617 Bacteria 1879
103 Ga0068859_101049271 3300005617 Unclassified 896
104 Ga0068859_101968757 3300005617 Bacteria 645
105 Ga0068864_100004004 3300005618 Bacteria 12133
106 Ga0068864_100107192 3300005618 Bacteria 2485
107 Ga0068864_100657637 3300005618 Bacteria 1021
108 Ga0068864_101223437 3300005618 Bacteria 750
109 Ga0068866_10006018 3300005718 Bacteria 5048
110 Ga0068866_10090536 3300005718 Bacteria 1665
111 Ga0068861_100000562 3300005719 Bacteria 22006
112 Ga0068861_100000577 3300005719 Bacteria 21668
113 Ga0068861_100032990 3300005719 Bacteria 3817
114 Ga0068861_100095663 3300005719 Bacteria 2353
115 Ga0068861_101011232 3300005719 Bacteria 794
116 Ga0068851_10001093 3300005834 Bacteria 11764
117 Ga0068851_10613007 3300005834 Unclassified 663
118 Ga0068870_10011516 3300005840 Bacteria 4103
119 Ga0068870_10363494 3300005840 Bacteria 932
120 Ga0068870_10413006 3300005840 Bacteria 881
121 Ga0068863_100003717 3300005841 Bacteria 15093
122 Ga0068863_100007517 3300005841 Bacteria 10656
123 Ga0068863_100053869 3300005841 Bacteria 3813
124 Ga0068863_100233295 3300005841 Bacteria 1775
125 Ga0068863_100621813 3300005841 Bacteria 1070
126 Ga0068863_100749024 3300005841 Bacteria 973
127 Ga0068863_100783729 3300005841 Unclassified 950
128 Ga0068858_100006090 3300005842 Bacteria 11767
129 Ga0068858_100072795 3300005842 Bacteria 3189
130 Ga0068860_100174934 3300005843 Bacteria 2075
131 Ga0068860_100307078 3300005843 Bacteria 1555
132 Ga0068860_100554758 3300005843 Bacteria 1151
133 Ga0068860_101092584 3300005843 Unclassified 817
134 Ga0068862_100029895 3300005844 Bacteria 4590
135 Ga0068862_100046498 3300005844 Bacteria 3703
136 Ga0068862_100073311 3300005844 Bacteria 2959
137 Ga0068862_100359943 3300005844 Bacteria 1352
138 Ga0068862_100547847 3300005844 Bacteria 1104
139 Ga0068862_101207915 3300005844 Bacteria 755
140 Ga0081539_10035507 3300005985 Bacteria 2995
141 Ga0075368_10037190 3300006042 Bacteria 1903
142 Ga0075368_10184516 3300006042 Bacteria 880
143 Ga0075364_10002052 3300006051 Bacteria 11243
144 Ga0075362_10020965 3300006177 Bacteria 2736
145 Ga0075367_10024806 3300006178 Bacteria 3383
146 Ga0075367_10312786 3300006178 Unclassified 989
147 Ga0075366_10000302 3300006195 Bacteria 22298
148 Ga0075366_10979768 3300006195 Bacteria 527
149 Ga0097621_100010243 3300006237 Bacteria 6848
150 Ga0097621_100229527 3300006237 Bacteria 1620
151 Ga0075370_10397198 3300006353 Unclassified 827
152 Ga0075428_100018514 3300006844 Bacteria 7700
153 Ga0075428_100959448 3300006844 Bacteria 906
154 Ga0075430_100010623 3300006846 Bacteria 7800
155 Ga0075430_100217121 3300006846 Bacteria 1587
156 Ga0075430_100316383 3300006846 Bacteria 1290
157 Ga0075430_100494073 3300006846 Unclassified 1010
158 Ga0075431_100225523 3300006847 Bacteria 1911
159 Ga0075433_10502713 3300006852 Bacteria 1067
160 Ga0075433_10568376 3300006852 Unclassified 996
161 Ga0075433_10611119 3300006852 Bacteria 957
162 Ga0075429_100036497 3300006880 Bacteria 4275
163 Ga0075429_100587891 3300006880 Bacteria 975
164 Ga0068865_100261583 3300006881 Bacteria 1370
165 Ga0068865_100938012 3300006881 Bacteria 755
166 Ga0097620_100019499 3300006931 Bacteria 6813
167 Ga0097620_100245694 3300006931 Bacteria 1879
168 Ga0097620_101049334 3300006931 Unclassified 896
169 Ga0097620_101969479 3300006931 Bacteria 645
170 Ga0075435_100496256 3300007076 Bacteria 1055
171 Ga0105240_10040933 3300009093 Bacteria 5920
172 Ga0105240_10965091 3300009093 Bacteria 913
173 Ga0111539_10000099 3300009094 Bacteria 91525
174 Ga0111539_10116058 3300009094 Bacteria 3139
175 Ga0111539_10117917 3300009094 Bacteria 3111
176 Ga0105245_10000641 3300009098 Bacteria 31814
177 Ga0105245_12073518 3300009098 Bacteria 622
178 Ga0105247_10018198 3300009101 Bacteria 4214
179 Ga0114129_10488508 3300009147 Bacteria 1610
180 Ga0105243_10077148 3300009148 Bacteria 2709
181 Ga0105243_10413777 3300009148 Bacteria 1255
182 Ga0105243_10899161 3300009148 Bacteria 880
183 Ga0105241_10006878 3300009174 Bacteria 8369
184 Ga0105241_10250572 3300009174 Bacteria 1501
185 Ga0105241_10341937 3300009174 Bacteria 1297
186 Ga0105241_10834505 3300009174 Bacteria 851
187 Ga0105242_10080633 3300009176 Unclassified 2720
188 Ga0105242_10106875 3300009176 Bacteria 2379
189 Ga0105242_10425444 3300009176 Bacteria 1245
190 Ga0105248_10005072 3300009177 Bacteria 14536
191 Ga0105237_10626263 3300009545 Bacteria 1083
192 Ga0105238_10060496 3300009551 Bacteria 3792
193 Ga0105249_10001405 3300009553 Bacteria 21079
194 Ga0105249_10015546 3300009553 Bacteria 6737
195 Ga0105249_10049294 3300009553 Bacteria 3840
196 Ga0105249_10067053 3300009553 Bacteria 3305
197 Ga0105249_10102115 3300009553 Bacteria 2698
198 Ga0105249_13332304 3300009553 Bacteria 517
199 Ga0105239_10613032 3300010375 Bacteria 1242
200 Ga0105239_12748558 3300010375 Bacteria 574
201 Ga0105239_13427710 3300010375 Bacteria 516
202 Ga0105246_10069060 3300011119 Bacteria 2480
203 Ga0157371_10557383 3300013102 Bacteria 850
204 Ga0157369_10002451 3300013105 Bacteria 22260
205 Ga0157369_10490476 3300013105 Bacteria 1271
206 Ga0157369_10630962 3300013105 Bacteria 1105
207 Ga0157374_10233982 3300013296 Bacteria 1805
208 Ga0157374_10456119 3300013296 Bacteria 1280
209 Ga0157378_10002122 3300013297 Bacteria 17643
210 Ga0157378_10302074 3300013297 Bacteria 1549
211 Ga0157378_12540884 3300013297 Bacteria 564
212 Ga0163162_10205427 3300013306 Bacteria 2099
213 Ga0157372_10012458 3300013307 Bacteria 9064
214 Ga0157372_10681806 3300013307 Bacteria 1196
215 Ga0163163_10009152 3300014325 Bacteria 8826
216 Ga0157380_10028565 3300014326 Bacteria 4254
217 Ga0157380_10048913 3300014326 Bacteria 3332
218 Ga0157380_11168861 3300014326 Bacteria 812
219 Ga0157377_10003883 3300014745 Bacteria 6810
220 Ga0157379_10007314 3300014968 Bacteria 9555
221 Ga0157379_10127139 3300014968 Bacteria 2293
222 Ga0157379_10836552 3300014968 Bacteria 870
223 Ga0157376_10210208 3300014969 Bacteria 1796
224 Ga0163161_11202889 3300017792 Bacteria 655
225 Ga0213876_10000024 3300021384 Bacteria 237488
226 Ga0209257_1000437 3300025304 Bacteria 80060
227 Ga0207697_10001765 3300025315 Bacteria 11610
228 Ga0207656_10045092 3300025321 Bacteria 1885
229 Ga0207642_10036617 3300025899 Bacteria 2107
230 Ga0207710_10781921 3300025900 Bacteria 502
231 Ga0207688_10000450 3300025901 Bacteria 19483
232 Ga0207688_10014280 3300025901 Bacteria 4321
233 Ga0207680_10005230 3300025903 Bacteria 6191
234 Ga0207680_10578044 3300025903 Bacteria 803
235 Ga0207647_10000019 3300025904 Bacteria 123924
236 Ga0207647_10597039 3300025904 Bacteria 609
237 Ga0207645_10001166 3300025907 Bacteria 21674
238 Ga0207645_10192595 3300025907 Bacteria 1340
239 Ga0207645_10720596 3300025907 Bacteria 678
240 Ga0207643_10000113 3300025908 Bacteria 55446
241 Ga0207643_10088663 3300025908 Bacteria 1801
242 Ga0207643_10667954 3300025908 Unclassified 671
243 Ga0207705_10006527 3300025909 Bacteria 8639
244 Ga0207705_10027757 3300025909 Bacteria 4037
245 Ga0207705_10078343 3300025909 Bacteria 2405
246 Ga0207705_11196320 3300025909 Bacteria 583
247 Ga0207654_10625146 3300025911 Bacteria 770
248 Ga0207654_10794695 3300025911 Bacteria 683
249 Ga0207695_10030334 3300025913 Bacteria 5954
250 Ga0207695_10067526 3300025913 Bacteria 3668
251 Ga0207671_10497768 3300025914 Bacteria 972
252 Ga0207657_10000059 3300025919 Bacteria 103782
253 Ga0207649_10031191 3300025920 Bacteria 3166
254 Ga0207649_10663316 3300025920 Bacteria 807
255 Ga0207652_10030302 3300025921 Bacteria 4529
256 Ga0207681_10031477 3300025923 Bacteria 3465
257 Ga0207694_10001535 3300025924 Bacteria 19628
258 Ga0207650_10000514 3300025925 Bacteria 32086
259 Ga0207650_10034298 3300025925 Bacteria 3680
260 Ga0207650_10319660 3300025925 Unclassified 1271
261 Ga0207659_10212343 3300025926 Bacteria 1552
262 Ga0207644_10005866 3300025931 Bacteria 8005
263 Ga0207644_10377148 3300025931 Bacteria 1156
264 Ga0207644_10599656 3300025931 Bacteria 914
265 Ga0207690_10214456 3300025932 Bacteria 1469
266 Ga0207706_10001171 3300025933 Bacteria 26598
267 Ga0207706_10003006 3300025933 Bacteria 16254
268 Ga0207706_10027587 3300025933 Bacteria 5076
269 Ga0207686_10088922 3300025934 Bacteria 2034
270 Ga0207709_10005185 3300025935 Bacteria 7422
271 Ga0207670_10137445 3300025936 Bacteria 1798
272 Ga0207670_10188726 3300025936 Bacteria 1558
273 Ga0207669_10094347 3300025937 Bacteria 1958
274 Ga0207704_10000136 3300025938 Bacteria 39545
275 Ga0207704_10105773 3300025938 Bacteria 1888
276 Ga0207704_10489492 3300025938 Bacteria 989
277 Ga0207665_10785704 3300025939 Bacteria 752
278 Ga0207691_10243695 3300025940 Bacteria 1553
279 Ga0207691_10590868 3300025940 Bacteria 940
280 Ga0207711_10002981 3300025941 Bacteria 14789
281 Ga0207711_10149157 3300025941 Bacteria 2109
282 Ga0207711_11103579 3300025941 Bacteria 734
283 Ga0207689_10000009 3300025942 Bacteria 127375
284 Ga0207689_10081879 3300025942 Bacteria 2654
285 Ga0207661_11169489 3300025944 Bacteria 708
286 Ga0207679_10001112 3300025945 Bacteria 17128
287 Ga0207679_10001337 3300025945 Bacteria 15592
288 Ga0207679_10044140 3300025945 Bacteria 3215
289 Ga0207651_10160275 3300025960 Bacteria 1763
290 Ga0207651_11026635 3300025960 Bacteria 737
291 Ga0207651_11378682 3300025960 Unclassified 634
292 Ga0207651_11622355 3300025960 Bacteria 583
293 Ga0207712_10000601 3300025961 Bacteria 28655
294 Ga0207712_10000977 3300025961 Bacteria 20523
295 Ga0207712_10596962 3300025961 Bacteria 955
296 Ga0207668_10370134 3300025972 Bacteria 1203
297 Ga0207640_10006300 3300025981 Bacteria 6506
298 Ga0207640_10196049 3300025981 Bacteria 1526
299 Ga0207658_10462108 3300025986 Bacteria 1125
300 Ga0207658_11278002 3300025986 Bacteria 671
301 Ga0207677_10092834 3300026023 Bacteria 2199
302 Ga0207703_10000632 3300026035 Bacteria 35396
303 Ga0207703_10056820 3300026035 Bacteria 3189
304 Ga0207703_10146389 3300026035 Bacteria 2055
305 Ga0207703_10348106 3300026035 Bacteria 1363
306 Ga0207703_10982188 3300026035 Bacteria 810
307 Ga0207639_10000117 3300026041 Bacteria 61185
308 Ga0207678_10013247 3300026067 Bacteria 7236
309 Ga0207708_10000089 3300026075 Bacteria 72013
310 Ga0207708_10469712 3300026075 Bacteria 1050
311 Ga0207708_10641688 3300026075 Bacteria 903
312 Ga0207702_10068161 3300026078 Bacteria 3056
313 Ga0207641_10001506 3300026088 Bacteria 22808
314 Ga0207641_10082030 3300026088 Bacteria 2801
315 Ga0207641_10206474 3300026088 Bacteria 1814
316 Ga0207641_10605499 3300026088 Bacteria 1073
317 Ga0207648_10007978 3300026089 Bacteria 10327
318 Ga0207648_10059561 3300026089 Bacteria 3330
319 Ga0207676_10006786 3300026095 Bacteria 8104
320 Ga0207676_10429802 3300026095 Bacteria 1240
321 Ga0207674_10000858 3300026116 Bacteria 39727
322 Ga0207674_10112976 3300026116 Bacteria 2689
323 Ga0207675_100000005 3300026118 Bacteria 199965
324 Ga0207675_100003665 3300026118 Bacteria 14982
325 Ga0207675_100015382 3300026118 Bacteria 7136
326 Ga0207675_100168584 3300026118 Bacteria 2092
327 Ga0207683_10001342 3300026121 Bacteria 22223
328 Ga0207683_10697643 3300026121 Bacteria 941
329 Ga0207698_10055343 3300026142 Bacteria 3057
330 Ga0209813_10009972 3300027866 Unclassified 2445
331 Ga0209813_10082454 3300027866 Bacteria 1066
332 Ga0207428_10000201 3300027907 Bacteria 83434
333 Ga0207428_10016879 3300027907 Bacteria 6274
334 Ga0268266_10000007 3300028379 Bacteria 1372921
335 Ga0268266_10522972 3300028379 Bacteria 1134
336 Ga0268265_10030100 3300028380 Bacteria 3905
337 Ga0268265_10101793 3300028380 Bacteria 2321
338 Ga0268265_10222728 3300028380 Bacteria 1652
339 Ga0268265_10344458 3300028380 Bacteria 1358
340 Ga0268265_11312082 3300028380 Unclassified 724
341 Ga0268264_10001536 3300028381 Bacteria 21495
342 Ga0268264_10189775 3300028381 Bacteria 1872
343 Ga0268264_11420083 3300028381 Bacteria 705
344 Ga0265760_10036224 3300031090 Bacteria 1463
345 Ga0307513_10147147 3300031456 Bacteria 2271
346 Ga0307513_10919903 3300031456 Bacteria 582
347 Ga0307408_101463953 3300031548 Bacteria 645
348 Ga0307516_10029632 3300031730 Bacteria 5532
349 Ga0307405_10019518 3300031731 Bacteria 3767
350 Ga0307405_10058067 3300031731 Bacteria 2433
351 Ga0307405_10059360 3300031731 Unclassified 2410
352 Ga0316577_10020123 3300031733 Bacteria 3699
353 Ga0307413_10000482 3300031824 Bacteria 13035
354 Ga0307413_10073191 3300031824 Bacteria 2165
355 Ga0307413_10170852 3300031824 Bacteria 1538
356 Ga0307413_10919382 3300031824 Unclassified 744
357 Ga0307410_10001582 3300031852 Bacteria 10425
358 Ga0307410_10019234 3300031852 Bacteria 4149
359 Ga0307410_10073529 3300031852 Bacteria 2377
360 Ga0307410_10608632 3300031852 Bacteria 912
361 Ga0307406_10012030 3300031901 Bacteria 4923
362 Ga0307406_10263352 3300031901 Bacteria 1306
363 Ga0307406_10803779 3300031901 Bacteria 794
364 Ga0307406_10999681 3300031901 Bacteria 717
365 Ga0307407_10001104 3300031903 Bacteria 9423
366 Ga0307407_10149132 3300031903 Bacteria 1517
367 Ga0307412_10295751 3300031911 Unclassified 1277
368 Ga0307409_100001611 3300031995 Bacteria 11291
369 Ga0307409_100017862 3300031995 Bacteria 4744
370 Ga0307409_100459574 3300031995 Bacteria 1230
371 Ga0307416_100194876 3300032002 Unclassified 1915
372 Ga0307416_100239706 3300032002 Bacteria 1756
373 Ga0307416_100549192 3300032002 Unclassified 1228
374 Ga0307416_101615747 3300032002 Bacteria 753
375 Ga0307414_10020614 3300032004 Bacteria 4113
376 Ga0307414_10045985 3300032004 Bacteria 2993
377 Ga0307414_10084730 3300032004 Bacteria 2332
378 Ga0307414_10088793 3300032004 Bacteria 2289
379 Ga0307411_10003392 3300032005 Bacteria 7380
380 Ga0307411_10874392 3300032005 Bacteria 797
381 Ga0307415_100007314 3300032126 Bacteria 6030
382 Ga0307415_100035794 3300032126 Bacteria 3246
383 Ga0307415_100139544 3300032126 Bacteria 1849
384 Ga0307415_100266116 3300032126 Unclassified 1402
385 Ga0307415_100509266 3300032126 Bacteria 1054
386 Ga0373955_0412676 3300035172 Bacteria 821
387 Ga0395900_0041747 3300037418 Bacteria 4728
388 Ga0395905_0015900 3300037471 Bacteria 7149
389 Ga0395901_1458318 3300038443 Bacteria 641
390 Ga0436365_0861406 3300039437 Bacteria 61112
391 Ga0436365_0947596 3300039437 Bacteria 3628
392 Ga0436365_1839233 3300039437 Bacteria 2872
393 Ga0436365_1926687 3300039437 Bacteria 2586
394 Ga0436360_1040944 3300039438 Unclassified 554
395 Ga0436363_1307533 3300039450 Bacteria 637
396 Ga0451804_1119475 3300041463 Bacteria 618
397 Ga0451843_0715407 3300041509 Bacteria 728
398 Ga0439441_104615 3300042001 Bacteria 638
399 Ga0451577_0022276 3300042876 Bacteria 5785
400 Ga0451577_0279088 3300042876 Bacteria 1513
401 Ga0451577_0335525 3300042876 Bacteria 1371
402 Ga0466972_0001665 3300044658 Bacteria 10868
403 Ga0466965_0186806 3300044683 Bacteria 1095
404 Ga0453684_0035312 3300044712 Bacteria 6913
405 Ga0453684_0764850 3300044712 Bacteria 1044
406 Ga0466970_0005725 3300044765 Bacteria 6175
407 Ga0466960_0002003 3300044901 Bacteria 7561
408 Ga0451576_1011184 3300045051 Bacteria 871
409 Ga0495607_0019656 3300046501 Bacteria 4286
410 Ga0495628_0007266 3300046516 Bacteria 9595
411 Ga0495630_0061512 3300046517 Bacteria 2819
412 Ga0495663_0000453 3300046525 Bacteria 15016
413 Ga0495586_0008975 3300046535 Bacteria 5321
414 Ga0495598_0000091 3300046537 Bacteria 14636
415 Ga0495621_0000163 3300046539 Bacteria 14912
416 Ga0495634_0088614 3300046642 Bacteria 2012
417 Ga0495599_0070158 3300046678 Bacteria 2187
418 Ga0495670_0390107 3300046691 Bacteria 752
419 Ga0495636_0004660 3300047318 Bacteria 5378
420 Ga0495674_0005575 3300047319 Bacteria 12067
421 Ga0495672_0006846 3300047320 Bacteria 8704
422 Ga0495684_0021130 3300047471 Bacteria 5015
423 Ga0495684_0267135 3300047471 Bacteria 1239
424 Ga0495615_0162996 3300048090 Bacteria 670
425 Ga0496101_0120527 3300048904 Unclassified 1983
426 Ga0496103_0266791 3300048906 Bacteria 1101
427 Ga0496104_0570473 3300048907 Bacteria 1042
428 Ga0496107_0532032 3300048910 Bacteria 871
429 Ga0496108_0185944 3300048911 Bacteria 1800
430 Ga0496109_0015254 3300048912 Bacteria 6690
431 Ga0496109_0122696 3300048912 Bacteria 2421
432 Ga0496109_0238027 3300048912 Bacteria 1713
433 Ga0496110_0067624 3300048913 Bacteria 3162
434 Ga0496110_0182458 3300048913 Bacteria 1906
435 Ga0496112_0486006 3300048915 Bacteria 1171
436 Ga0496113_0259178 3300048916 Bacteria 1389
437 Ga0496113_0283461 3300048916 Bacteria 1325
438 Ga0501292_043533 3300049515 Bacteria 781
439 Ga0501292_059774 3300049515 Bacteria 690
440 Ga0501036_0044709 3300049572 Bacteria 3752
441 Ga0501040_0103368 3300049576 Bacteria 1989
442 Ga0501041_0042731 3300049577 Bacteria 2755
443 Ga0501042_0245760 3300049578 Bacteria 1291
444 Ga0501048_0025190 3300049582 Bacteria 4336
445 Ga0501067_0000953 3300049583 Bacteria 15496
446 Ga0501072_0293392 3300049588 Bacteria 1293
447 Ga0501072_1499401 3300049588 Bacteria 521
448 Ga0501073_0015295 3300049589 Bacteria 5564
449 Ga0501075_0440401 3300049591 Unclassified 994
450 Ga0501076_0005699 3300049592 Bacteria 8982
451 Ga0501077_0826578 3300049593 Bacteria 596
452 Ga0501209_124033 3300049656 Bacteria 768
453 Ga0501224_013541 3300049664 Bacteria 1205
454 Ga0501224_085191 3300049664 Bacteria 507
455 Ga0501233_050989 3300049668 Bacteria 1002
456 Ga0501235_073882 3300049669 Bacteria 809
457 Ga0501235_132271 3300049669 Bacteria 632
458 Ga0501235_162646 3300049669 Bacteria 585
459 Ga0501243_135385 3300049675 Unclassified 517
460 Ga0501248_005350 3300049678 Bacteria 1007
461 Ga0501249_003610 3300049679 Bacteria 3114
462 Ga0501257_007050 3300049686 Bacteria 2505
463 Ga0501259_054134 3300049688 Bacteria 822
464 Ga0501219_008541 3300049703 Bacteria 750
465 Ga0501221_009345 3300049704 Bacteria 1720
466 Ga0501079_0629964 3300049741 Bacteria 844
467 Ga0501083_1073306 3300049744 Unclassified 524
468 Ga0501270_000837 3300049767 Bacteria 2781
469 Ga0501272_002131 3300049769 Bacteria 1947
470 Ga0501273_001165 3300049770 Bacteria 2424
471 nmdc:mga03683_2448_c1 3300050489 Bacteria 5765
472 nmdc:mga03n38_30403_c1 3300050490 Bacteria 2270
473 nmdc:mga0yw44_339809_c1 3300050492 Bacteria 1010
474 nmdc:mga0k408_1673_c1 3300050493 Bacteria 11970
475 nmdc:mga06z11_2949_c1 3300050494 Bacteria 6552
476 nmdc:mga04h51_96103_c1 3300050495 Bacteria 1073
477 nmdc:mga04h51_9615_c1 3300050495 Unclassified 2629
478 nmdc:mga07m45_373662_c1 3300050496 Unclassified 828
479 nmdc:mga05p37_693918_c1 3300050507 Bacteria 1132
480 nmdc:mga09592_409997_c1 3300050508 Bacteria 1171
481 nmdc:mga09592_948080_c1 3300050508 Unclassified 721
482 nmdc:mga0qj67_26271_c1 3300050509 Bacteria 4507
483 nmdc:mga0qj67_673843_c1 3300050509 Bacteria 824
484 nmdc:mga0qj67_80814_c1 3300050509 Bacteria 2605
485 nmdc:mga06r32_51065_c1 3300050510 Bacteria 3957
486 nmdc:mga08y16_122_c1 3300050511 Bacteria 67305
487 nmdc:mga08y16_5289_c1 3300050511 Bacteria 13497
488 nmdc:mga08y16_781514_c1 3300050511 Bacteria 949
489 nmdc:mga0n895_2041112_c1 3300050512 Unclassified 531
490 nmdc:mga0rr50_736205_c1 3300050513 Bacteria 841
491 nmdc:mga0a205_360479_c1 3300050515 Bacteria 1320
492 nmdc:mga0a205_455565_c1 3300050515 Bacteria 1139
493 nmdc:mga0a205_607789_c1 3300050515 Unclassified 946
494 nmdc:mga0a205_659341_c1 3300050515 Bacteria 897
495 nmdc:mga0a205_801438_c1 3300050515 Bacteria 790
496 Ga0495601_0046681 3300053077 Bacteria 2726
497 Ga0500658_0093189 3300053134 Bacteria 1306
498 Ga0500622_0005971 3300053156 Bacteria 7166
499 Ga0500622_0093379 3300053156 Bacteria 1490
500 Ga0500637_0002574 3300053178 Bacteria 8104
501 Ga0501084_0279871 3300054114 Bacteria 1409
502 Ga0501084_0400088 3300054114 Bacteria 1161

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10488508 Ga0114129_104885081 125
2 3300050507 nmdc:mga05p37_693918_c1 nmdc:mga05p37_693918_c1_269_646 125
3 3300005719 Ga0068861_100000562 Ga0068861_10000056218 129
4 3300005842 Ga0068858_100072795 Ga0068858_1000727954 129
5 3300009553 Ga0105249_13332304 Ga0105249_133323041 129
6 3300026035 Ga0207703_10146389 Ga0207703_101463893 129
7 3300026118 Ga0207675_100003665 Ga0207675_10000366513 129
8 3300005844 Ga0068862_100073311 Ga0068862_1000733112 130
9 3300009551 Ga0105238_10060496 Ga0105238_100604962 130
10 3300009553 Ga0105249_10015546 Ga0105249_100155467 130
11 3300003794 Ga0055531_10027319 Ga0055531_100273193 133
12 3300005333 Ga0070677_10469521 Ga0070677_104695211 133
13 3300005364 Ga0070673_101273217 Ga0070673_1012732172 133
14 3300005539 Ga0068853_100603510 Ga0068853_1006035102 133
15 3300005617 Ga0068859_101049271 Ga0068859_1010492712 133
16 3300005834 Ga0068851_10613007 Ga0068851_106130071 133
17 3300005840 Ga0068870_10363494 Ga0068870_103634942 133
18 3300006852 Ga0075433_10502713 Ga0075433_105027132 133
19 3300006931 Ga0097620_101049334 Ga0097620_1010493342 133
20 3300013102 Ga0157371_10557383 Ga0157371_105573832 133
21 3300013105 Ga0157369_10630962 Ga0157369_106309622 133
22 3300013297 Ga0157378_12540884 Ga0157378_125408841 133
23 3300013307 Ga0157372_10681806 Ga0157372_106818062 133
24 3300014326 Ga0157380_10048913 Ga0157380_100489132 133
25 3300025304 Ga0209257_1000437 Ga0209257_100043758 133
26 3300025907 Ga0207645_10192595 Ga0207645_101925952 133
27 3300025908 Ga0207643_10088663 Ga0207643_100886633 133
28 3300025944 Ga0207661_11169489 Ga0207661_111694891 133
29 3300025960 Ga0207651_11378682 Ga0207651_113786822 133
30 3300025981 Ga0207640_10196049 Ga0207640_101960492 133
31 3300031731 Ga0307405_10019518 Ga0307405_100195189 133
32 3300031824 Ga0307413_10170852 Ga0307413_101708523 133
33 3300031824 Ga0307413_10919382 Ga0307413_109193821 133
34 3300031852 Ga0307410_10019234 Ga0307410_100192349 133
35 3300031901 Ga0307406_10012030 Ga0307406_100120307 133
36 3300031901 Ga0307406_10803779 Ga0307406_108037792 133
37 3300031903 Ga0307407_10149132 Ga0307407_101491324 133
38 3300031995 Ga0307409_100459574 Ga0307409_1004595742 133
39 3300032002 Ga0307416_100239706 Ga0307416_1002397064 133
40 3300032004 Ga0307414_10084730 Ga0307414_100847305 133
41 3300032005 Ga0307411_10003392 Ga0307411_100033925 133
42 3300032005 Ga0307411_10874392 Ga0307411_108743921 133
43 3300032126 Ga0307415_100007314 Ga0307415_10000731410 133
44 3300037418 Ga0395900_0041747 Ga0395900_0041747_2186_2587 133
45 3300037471 Ga0395905_0015900 Ga0395905_0015900_2380_2781 133
46 3300038443 Ga0395901_1458318 Ga0395901_1458318_57_458 133
47 3300039437 Ga0436365_1926687 Ga0436365_1926687_1736_2137 133
48 3300039438 Ga0436360_1040944 Ga0436360_1040944_110_511 133
49 3300042001 Ga0439441_104615 Ga0439441_104615_117_518 133
50 3300049515 Ga0501292_043533 Ga0501292_043533_54_455 133
51 3300049583 Ga0501067_0000953 Ga0501067_0000953_6229_6630 133
52 3300049589 Ga0501073_0015295 Ga0501073_0015295_3101_3502 133
53 3300049664 Ga0501224_013541 Ga0501224_013541_612_1013 133
54 3300049669 Ga0501235_073882 Ga0501235_073882_343_744 133
55 3300049669 Ga0501235_132271 Ga0501235_132271_29_430 133
56 3300049678 Ga0501248_005350 Ga0501248_005350_542_943 133
57 3300049679 Ga0501249_003610 Ga0501249_003610_1202_1603 133
58 3300049686 Ga0501257_007050 Ga0501257_007050_2013_2414 133
59 3300049688 Ga0501259_054134 Ga0501259_054134_268_669 133
60 3300049703 Ga0501219_008541 Ga0501219_008541_324_725 133
61 3300049704 Ga0501221_009345 Ga0501221_009345_1202_1603 133
62 3300049767 Ga0501270_000837 Ga0501270_000837_2136_2537 133
63 3300049769 Ga0501272_002131 Ga0501272_002131_1235_1636 133
64 3300049770 Ga0501273_001165 Ga0501273_001165_150_551 133
65 3300050508 nmdc:mga09592_948080_c1 nmdc:mga09592_948080_c1_181_585 133
66 3300050515 nmdc:mga0a205_455565_c1 nmdc:mga0a205_455565_c1_511_918 133
67 3300003320 rootH2_10062662 rootH2_100626622 134
68 3300004799 Ga0058863_11441775 Ga0058863_114417751 134
69 3300005288 Ga0065714_10148579 Ga0065714_101485793 134
70 3300005289 Ga0065704_10035083 Ga0065704_100350831 134
71 3300005289 Ga0065704_10355072 Ga0065704_103550721 134
72 3300005290 Ga0065712_10068047 Ga0065712_100680475 134
73 3300005290 Ga0065712_10239804 Ga0065712_102398041 134
74 3300005293 Ga0065715_10099278 Ga0065715_100992783 134
75 3300005293 Ga0065715_10217048 Ga0065715_102170482 134
76 3300005295 Ga0065707_10088575 Ga0065707_100885752 134
77 3300005327 Ga0070658_10004673 Ga0070658_1000467314 134
78 3300005327 Ga0070658_10061896 Ga0070658_100618962 134
79 3300005327 Ga0070658_10134783 Ga0070658_101347832 134
80 3300005328 Ga0070676_11067136 Ga0070676_110671361 134
81 3300005330 Ga0070690_100005509 Ga0070690_1000055094 134
82 3300005330 Ga0070690_100007704 Ga0070690_1000077046 134
83 3300005330 Ga0070690_100461592 Ga0070690_1004615922 134
84 3300005331 Ga0070670_100025220 Ga0070670_1000252204 134
85 3300005331 Ga0070670_101106628 Ga0070670_1011066282 134
86 3300005334 Ga0068869_100014103 Ga0068869_1000141033 134
87 3300005334 Ga0068869_100080243 Ga0068869_1000802431 134
88 3300005334 Ga0068869_100744253 Ga0068869_1007442532 134
89 3300005335 Ga0070666_10000767 Ga0070666_100007672 134
90 3300005335 Ga0070666_10002699 Ga0070666_1000269910 134
91 3300005335 Ga0070666_10601297 Ga0070666_106012972 134
92 3300005338 Ga0068868_100002891 Ga0068868_1000028916 134
93 3300005338 Ga0068868_100578712 Ga0068868_1005787121 134
94 3300005339 Ga0070660_100000214 Ga0070660_1000002142 134
95 3300005340 Ga0070689_100003324 Ga0070689_1000033246 134
96 3300005340 Ga0070689_100016977 Ga0070689_1000169778 134
97 3300005340 Ga0070689_100638925 Ga0070689_1006389252 134
98 3300005341 Ga0070691_10018421 Ga0070691_100184212 134
99 3300005343 Ga0070687_100000241 Ga0070687_1000002419 134
100 3300005344 Ga0070661_100291351 Ga0070661_1002913513 134
101 3300005344 Ga0070661_100954738 Ga0070661_1009547381 134
102 3300005345 Ga0070692_10290024 Ga0070692_102900243 134
103 3300005345 Ga0070692_11162073 Ga0070692_111620731 134
104 3300005353 Ga0070669_100013220 Ga0070669_1000132206 134
105 3300005353 Ga0070669_100085492 Ga0070669_1000854922 134
106 3300005353 Ga0070669_100354866 Ga0070669_1003548661 134
107 3300005354 Ga0070675_100003764 Ga0070675_10000376410 134
108 3300005354 Ga0070675_100388693 Ga0070675_1003886932 134
109 3300005355 Ga0070671_100001794 Ga0070671_10000179411 134
110 3300005355 Ga0070671_100001940 Ga0070671_10000194011 134
111 3300005355 Ga0070671_101499379 Ga0070671_1014993791 134
112 3300005364 Ga0070673_100043700 Ga0070673_1000437003 134
113 3300005364 Ga0070673_100512093 Ga0070673_1005120932 134
114 3300005364 Ga0070673_100572870 Ga0070673_1005728702 134
115 3300005364 Ga0070673_100801891 Ga0070673_1008018912 134
116 3300005365 Ga0070688_100000389 Ga0070688_1000003892 134
117 3300005365 Ga0070688_100002574 Ga0070688_1000025742 134
118 3300005366 Ga0070659_100001202 Ga0070659_10000120212 134
119 3300005366 Ga0070659_100282771 Ga0070659_1002827712 134
120 3300005367 Ga0070667_100216359 Ga0070667_1002163594 134
121 3300005367 Ga0070667_101422651 Ga0070667_1014226512 134
122 3300005367 Ga0070667_101493685 Ga0070667_1014936851 134
123 3300005440 Ga0070705_100014731 Ga0070705_1000147313 134
124 3300005441 Ga0070700_100000056 Ga0070700_10000005617 134
125 3300005441 Ga0070700_100384520 Ga0070700_1003845202 134
126 3300005456 Ga0070678_100050133 Ga0070678_1000501332 134
127 3300005457 Ga0070662_100001196 Ga0070662_1000011962 134
128 3300005457 Ga0070662_100007301 Ga0070662_1000073018 134
129 3300005457 Ga0070662_100669477 Ga0070662_1006694771 134
130 3300005457 Ga0070662_101301249 Ga0070662_1013012491 134
131 3300005458 Ga0070681_10237887 Ga0070681_102378872 134
132 3300005459 Ga0068867_100007657 Ga0068867_1000076573 134
133 3300005459 Ga0068867_100011658 Ga0068867_1000116586 134
134 3300005466 Ga0070685_10354947 Ga0070685_103549471 134
135 3300005468 Ga0070707_100009815 Ga0070707_1000098157 134
136 3300005518 Ga0070699_100408909 Ga0070699_1004089092 134
137 3300005530 Ga0070679_101537795 Ga0070679_1015377951 134
138 3300005535 Ga0070684_100045803 Ga0070684_1000458034 134
139 3300005535 Ga0070684_100063589 Ga0070684_1000635892 134
140 3300005536 Ga0070697_100006709 Ga0070697_1000067099 134
141 3300005543 Ga0070672_100051268 Ga0070672_1000512683 134
142 3300005543 Ga0070672_100707880 Ga0070672_1007078802 134
143 3300005544 Ga0070686_100019907 Ga0070686_1000199072 134
144 3300005545 Ga0070695_100090724 Ga0070695_1000907244 134
145 3300005545 Ga0070695_100120119 Ga0070695_1001201193 134
146 3300005546 Ga0070696_100294029 Ga0070696_1002940293 134
147 3300005547 Ga0070693_100000641 Ga0070693_1000006416 134
148 3300005548 Ga0070665_100001521 Ga0070665_10000152113 134
149 3300005548 Ga0070665_100038653 Ga0070665_1000386535 134
150 3300005548 Ga0070665_101114833 Ga0070665_1011148332 134
151 3300005564 Ga0070664_100005842 Ga0070664_1000058423 134
152 3300005564 Ga0070664_100011822 Ga0070664_1000118226 134
153 3300005564 Ga0070664_101330394 Ga0070664_1013303942 134
154 3300005577 Ga0068857_100001753 Ga0068857_1000017532 134
155 3300005577 Ga0068857_100436290 Ga0068857_1004362902 134
156 3300005577 Ga0068857_100672004 Ga0068857_1006720042 134
157 3300005578 Ga0068854_100011914 Ga0068854_1000119144 134
158 3300005615 Ga0070702_100111708 Ga0070702_1001117082 134
159 3300005615 Ga0070702_100646871 Ga0070702_1006468712 134
160 3300005615 Ga0070702_100754426 Ga0070702_1007544262 134
161 3300005616 Ga0068852_100112794 Ga0068852_1001127941 134
162 3300005616 Ga0068852_100227558 Ga0068852_1002275582 134
163 3300005617 Ga0068859_100019498 Ga0068859_1000194987 134
164 3300005617 Ga0068859_100245698 Ga0068859_1002456981 134
165 3300005617 Ga0068859_101968757 Ga0068859_1019687571 134
166 3300005618 Ga0068864_100004004 Ga0068864_10000400415 134
167 3300005618 Ga0068864_100107192 Ga0068864_1001071923 134
168 3300005618 Ga0068864_100657637 Ga0068864_1006576372 134
169 3300005618 Ga0068864_101223437 Ga0068864_1012234372 134
170 3300005718 Ga0068866_10006018 Ga0068866_100060182 134
171 3300005718 Ga0068866_10090536 Ga0068866_100905362 134
172 3300005719 Ga0068861_100000577 Ga0068861_1000005772 134
173 3300005719 Ga0068861_100032990 Ga0068861_1000329903 134
174 3300005719 Ga0068861_100095663 Ga0068861_1000956632 134
175 3300005719 Ga0068861_101011232 Ga0068861_1010112322 134
176 3300005834 Ga0068851_10001093 Ga0068851_100010931 134
177 3300005840 Ga0068870_10011516 Ga0068870_100115167 134
178 3300005840 Ga0068870_10413006 Ga0068870_104130062 134
179 3300005841 Ga0068863_100003717 Ga0068863_10000371717 134
180 3300005841 Ga0068863_100007517 Ga0068863_1000075176 134
181 3300005841 Ga0068863_100053869 Ga0068863_1000538693 134
182 3300005841 Ga0068863_100233295 Ga0068863_1002332952 134
183 3300005841 Ga0068863_100621813 Ga0068863_1006218131 134
184 3300005841 Ga0068863_100749024 Ga0068863_1007490242 134
185 3300005841 Ga0068863_100783729 Ga0068863_1007837292 134
186 3300005842 Ga0068858_100006090 Ga0068858_10000609012 134
187 3300005843 Ga0068860_100174934 Ga0068860_1001749345 134
188 3300005843 Ga0068860_100307078 Ga0068860_1003070782 134
189 3300005843 Ga0068860_100554758 Ga0068860_1005547582 134
190 3300005843 Ga0068860_101092584 Ga0068860_1010925841 134
191 3300005844 Ga0068862_100029895 Ga0068862_1000298955 134
192 3300005844 Ga0068862_100046498 Ga0068862_1000464982 134
193 3300005844 Ga0068862_100359943 Ga0068862_1003599433 134
194 3300005844 Ga0068862_100547847 Ga0068862_1005478472 134
195 3300005844 Ga0068862_101207915 Ga0068862_1012079152 134
196 3300005985 Ga0081539_10035507 Ga0081539_100355073 134
197 3300006042 Ga0075368_10037190 Ga0075368_100371903 134
198 3300006042 Ga0075368_10184516 Ga0075368_101845161 134
199 3300006051 Ga0075364_10002052 Ga0075364_100020523 134
200 3300006177 Ga0075362_10020965 Ga0075362_100209653 134
201 3300006178 Ga0075367_10024806 Ga0075367_100248066 134
202 3300006178 Ga0075367_10312786 Ga0075367_103127863 134
203 3300006195 Ga0075366_10000302 Ga0075366_100003028 134
204 3300006195 Ga0075366_10979768 Ga0075366_109797681 134
205 3300006237 Ga0097621_100010243 Ga0097621_1000102432 134
206 3300006237 Ga0097621_100229527 Ga0097621_1002295274 134
207 3300006353 Ga0075370_10397198 Ga0075370_103971982 134
208 3300006844 Ga0075428_100018514 Ga0075428_1000185142 134
209 3300006844 Ga0075428_100959448 Ga0075428_1009594482 134
210 3300006846 Ga0075430_100010623 Ga0075430_1000106233 134
211 3300006846 Ga0075430_100217121 Ga0075430_1002171212 134
212 3300006846 Ga0075430_100316383 Ga0075430_1003163832 134
213 3300006846 Ga0075430_100494073 Ga0075430_1004940732 134
214 3300006847 Ga0075431_100225523 Ga0075431_1002255232 134
215 3300006852 Ga0075433_10568376 Ga0075433_105683761 134
216 3300006852 Ga0075433_10611119 Ga0075433_106111192 134
217 3300006880 Ga0075429_100036497 Ga0075429_1000364972 134
218 3300006880 Ga0075429_100587891 Ga0075429_1005878911 134
219 3300006881 Ga0068865_100261583 Ga0068865_1002615832 134
220 3300006881 Ga0068865_100938012 Ga0068865_1009380122 134
221 3300006931 Ga0097620_100019499 Ga0097620_1000194994 134
222 3300006931 Ga0097620_100245694 Ga0097620_1002456941 134
223 3300006931 Ga0097620_101969479 Ga0097620_1019694791 134
224 3300007076 Ga0075435_100496256 Ga0075435_1004962562 134
225 3300009093 Ga0105240_10040933 Ga0105240_100409334 134
226 3300009093 Ga0105240_10965091 Ga0105240_109650912 134
227 3300009094 Ga0111539_10000099 Ga0111539_100000998 134
228 3300009094 Ga0111539_10116058 Ga0111539_101160582 134
229 3300009094 Ga0111539_10117917 Ga0111539_101179173 134
230 3300009098 Ga0105245_10000641 Ga0105245_100006418 134
231 3300009098 Ga0105245_12073518 Ga0105245_120735181 134
232 3300009101 Ga0105247_10018198 Ga0105247_100181986 134
233 3300009148 Ga0105243_10077148 Ga0105243_100771482 134
234 3300009148 Ga0105243_10413777 Ga0105243_104137773 134
235 3300009148 Ga0105243_10899161 Ga0105243_108991611 134
236 3300009174 Ga0105241_10006878 Ga0105241_100068782 134
237 3300009174 Ga0105241_10250572 Ga0105241_102505722 134
238 3300009174 Ga0105241_10341937 Ga0105241_103419371 134
239 3300009174 Ga0105241_10834505 Ga0105241_108345052 134
240 3300009176 Ga0105242_10080633 Ga0105242_100806332 134
241 3300009176 Ga0105242_10106875 Ga0105242_101068752 134
242 3300009176 Ga0105242_10425444 Ga0105242_104254442 134
243 3300009177 Ga0105248_10005072 Ga0105248_100050725 134
244 3300009545 Ga0105237_10626263 Ga0105237_106262632 134
245 3300009553 Ga0105249_10001405 Ga0105249_1000140514 134
246 3300009553 Ga0105249_10049294 Ga0105249_100492942 134
247 3300009553 Ga0105249_10067053 Ga0105249_100670531 134
248 3300009553 Ga0105249_10102115 Ga0105249_101021153 134
249 3300010375 Ga0105239_10613032 Ga0105239_106130322 134
250 3300010375 Ga0105239_12748558 Ga0105239_127485581 134
251 3300010375 Ga0105239_13427710 Ga0105239_134277101 134
252 3300011119 Ga0105246_10069060 Ga0105246_100690604 134
253 3300013105 Ga0157369_10002451 Ga0157369_100024511 134
254 3300013105 Ga0157369_10490476 Ga0157369_104904762 134
255 3300013296 Ga0157374_10233982 Ga0157374_102339822 134
256 3300013296 Ga0157374_10456119 Ga0157374_104561192 134
257 3300013297 Ga0157378_10002122 Ga0157378_1000212214 134
258 3300013297 Ga0157378_10302074 Ga0157378_103020742 134
259 3300013306 Ga0163162_10205427 Ga0163162_102054273 134
260 3300013307 Ga0157372_10012458 Ga0157372_100124588 134
261 3300014325 Ga0163163_10009152 Ga0163163_100091522 134
262 3300014326 Ga0157380_10028565 Ga0157380_100285651 134
263 3300014326 Ga0157380_11168861 Ga0157380_111688611 134
264 3300014745 Ga0157377_10003883 Ga0157377_1000388310 134
265 3300014968 Ga0157379_10007314 Ga0157379_100073149 134
266 3300014968 Ga0157379_10127139 Ga0157379_101271392 134
267 3300014968 Ga0157379_10836552 Ga0157379_108365522 134
268 3300014969 Ga0157376_10210208 Ga0157376_102102082 134
269 3300017792 Ga0163161_11202889 Ga0163161_112028891 134
270 3300021384 Ga0213876_10000024 Ga0213876_10000024111 134
271 3300025315 Ga0207697_10001765 Ga0207697_100017659 134
272 3300025321 Ga0207656_10045092 Ga0207656_100450922 134
273 3300025899 Ga0207642_10036617 Ga0207642_100366173 134
274 3300025900 Ga0207710_10781921 Ga0207710_107819211 134
275 3300025901 Ga0207688_10000450 Ga0207688_1000045010 134
276 3300025901 Ga0207688_10014280 Ga0207688_100142803 134
277 3300025903 Ga0207680_10005230 Ga0207680_100052303 134
278 3300025903 Ga0207680_10578044 Ga0207680_105780442 134
279 3300025904 Ga0207647_10000019 Ga0207647_1000001953 134
280 3300025904 Ga0207647_10597039 Ga0207647_105970392 134
281 3300025907 Ga0207645_10001166 Ga0207645_1000116614 134
282 3300025907 Ga0207645_10720596 Ga0207645_107205961 134
283 3300025908 Ga0207643_10000113 Ga0207643_100001139 134
284 3300025908 Ga0207643_10667954 Ga0207643_106679541 134
285 3300025909 Ga0207705_10006527 Ga0207705_100065272 134
286 3300025909 Ga0207705_10027757 Ga0207705_100277574 134
287 3300025909 Ga0207705_10078343 Ga0207705_100783434 134
288 3300025909 Ga0207705_11196320 Ga0207705_111963202 134
289 3300025911 Ga0207654_10625146 Ga0207654_106251462 134
290 3300025911 Ga0207654_10794695 Ga0207654_107946951 134
291 3300025913 Ga0207695_10030334 Ga0207695_100303344 134
292 3300025913 Ga0207695_10067526 Ga0207695_100675266 134
293 3300025914 Ga0207671_10497768 Ga0207671_104977681 134
294 3300025919 Ga0207657_10000059 Ga0207657_1000005951 134
295 3300025920 Ga0207649_10031191 Ga0207649_100311911 134
296 3300025920 Ga0207649_10663316 Ga0207649_106633161 134
297 3300025921 Ga0207652_10030302 Ga0207652_100303023 134
298 3300025923 Ga0207681_10031477 Ga0207681_100314772 134
299 3300025924 Ga0207694_10001535 Ga0207694_1000153520 134
300 3300025925 Ga0207650_10000514 Ga0207650_1000051412 134
301 3300025925 Ga0207650_10034298 Ga0207650_100342985 134
302 3300025925 Ga0207650_10319660 Ga0207650_103196602 134
303 3300025926 Ga0207659_10212343 Ga0207659_102123433 134
304 3300025931 Ga0207644_10005866 Ga0207644_100058662 134
305 3300025931 Ga0207644_10377148 Ga0207644_103771482 134
306 3300025931 Ga0207644_10599656 Ga0207644_105996561 134
307 3300025932 Ga0207690_10214456 Ga0207690_102144561 134
308 3300025933 Ga0207706_10001171 Ga0207706_1000117114 134
309 3300025933 Ga0207706_10003006 Ga0207706_1000300613 134
310 3300025933 Ga0207706_10027587 Ga0207706_100275879 134
311 3300025934 Ga0207686_10088922 Ga0207686_100889223 134
312 3300025935 Ga0207709_10005185 Ga0207709_100051853 134
313 3300025936 Ga0207670_10137445 Ga0207670_101374453 134
314 3300025936 Ga0207670_10188726 Ga0207670_101887262 134
315 3300025937 Ga0207669_10094347 Ga0207669_100943472 134
316 3300025938 Ga0207704_10000136 Ga0207704_1000013623 134
317 3300025938 Ga0207704_10105773 Ga0207704_101057731 134
318 3300025938 Ga0207704_10489492 Ga0207704_104894921 134
319 3300025939 Ga0207665_10785704 Ga0207665_107857041 134
320 3300025940 Ga0207691_10243695 Ga0207691_102436952 134
321 3300025940 Ga0207691_10590868 Ga0207691_105908681 134
322 3300025941 Ga0207711_10002981 Ga0207711_1000298115 134
323 3300025941 Ga0207711_10149157 Ga0207711_101491571 134
324 3300025941 Ga0207711_11103579 Ga0207711_111035792 134
325 3300025942 Ga0207689_10000009 Ga0207689_1000000996 134
326 3300025942 Ga0207689_10081879 Ga0207689_100818792 134
327 3300025945 Ga0207679_10001112 Ga0207679_1000111211 134
328 3300025945 Ga0207679_10001337 Ga0207679_100013372 134
329 3300025945 Ga0207679_10044140 Ga0207679_100441404 134
330 3300025960 Ga0207651_10160275 Ga0207651_101602751 134
331 3300025960 Ga0207651_11026635 Ga0207651_110266352 134
332 3300025960 Ga0207651_11622355 Ga0207651_116223551 134
333 3300025961 Ga0207712_10000601 Ga0207712_1000060127 134
334 3300025961 Ga0207712_10000977 Ga0207712_100009772 134
335 3300025961 Ga0207712_10596962 Ga0207712_105969622 134
336 3300025972 Ga0207668_10370134 Ga0207668_103701341 134
337 3300025981 Ga0207640_10006300 Ga0207640_100063007 134
338 3300025986 Ga0207658_10462108 Ga0207658_104621082 134
339 3300025986 Ga0207658_11278002 Ga0207658_112780022 134
340 3300026023 Ga0207677_10092834 Ga0207677_100928343 134
341 3300026035 Ga0207703_10000632 Ga0207703_1000063215 134
342 3300026035 Ga0207703_10056820 Ga0207703_100568202 134
343 3300026035 Ga0207703_10348106 Ga0207703_103481062 134
344 3300026035 Ga0207703_10982188 Ga0207703_109821882 134
345 3300026041 Ga0207639_10000117 Ga0207639_1000011740 134
346 3300026067 Ga0207678_10013247 Ga0207678_100132476 134
347 3300026075 Ga0207708_10000089 Ga0207708_100000897 134
348 3300026075 Ga0207708_10469712 Ga0207708_104697122 134
349 3300026075 Ga0207708_10641688 Ga0207708_106416881 134
350 3300026078 Ga0207702_10068161 Ga0207702_100681613 134
351 3300026088 Ga0207641_10001506 Ga0207641_100015061 134
352 3300026088 Ga0207641_10082030 Ga0207641_100820302 134
353 3300026088 Ga0207641_10206474 Ga0207641_102064743 134
354 3300026088 Ga0207641_10605499 Ga0207641_106054991 134
355 3300026089 Ga0207648_10007978 Ga0207648_100079788 134
356 3300026089 Ga0207648_10059561 Ga0207648_100595611 134
357 3300026095 Ga0207676_10006786 Ga0207676_100067867 134
358 3300026095 Ga0207676_10429802 Ga0207676_104298023 134
359 3300026116 Ga0207674_10000858 Ga0207674_1000085810 134
360 3300026116 Ga0207674_10112976 Ga0207674_101129765 134
361 3300026118 Ga0207675_100000005 Ga0207675_100000005120 134
362 3300026118 Ga0207675_100015382 Ga0207675_10001538210 134
363 3300026118 Ga0207675_100168584 Ga0207675_1001685844 134
364 3300026121 Ga0207683_10001342 Ga0207683_1000134215 134
365 3300026121 Ga0207683_10697643 Ga0207683_106976431 134
366 3300026142 Ga0207698_10055343 Ga0207698_100553436 134
367 3300027866 Ga0209813_10009972 Ga0209813_100099722 134
368 3300027866 Ga0209813_10082454 Ga0209813_100824542 134
369 3300027907 Ga0207428_10000201 Ga0207428_100002019 134
370 3300027907 Ga0207428_10016879 Ga0207428_100168792 134
371 3300028379 Ga0268266_10000007 Ga0268266_10000007514 134
372 3300028379 Ga0268266_10522972 Ga0268266_105229722 134
373 3300028380 Ga0268265_10030100 Ga0268265_100301006 134
374 3300028380 Ga0268265_10101793 Ga0268265_101017932 134
375 3300028380 Ga0268265_10222728 Ga0268265_102227282 134
376 3300028380 Ga0268265_10344458 Ga0268265_103444583 134
377 3300028380 Ga0268265_11312082 Ga0268265_113120822 134
378 3300028381 Ga0268264_10001536 Ga0268264_100015362 134
379 3300028381 Ga0268264_10189775 Ga0268264_101897754 134
380 3300028381 Ga0268264_11420083 Ga0268264_114200832 134
381 3300031090 Ga0265760_10036224 Ga0265760_100362243 134
382 3300031456 Ga0307513_10147147 Ga0307513_101471471 134
383 3300031456 Ga0307513_10919903 Ga0307513_109199031 134
384 3300031548 Ga0307408_101463953 Ga0307408_1014639532 134
385 3300031730 Ga0307516_10029632 Ga0307516_100296327 134
386 3300031731 Ga0307405_10058067 Ga0307405_100580672 134
387 3300031731 Ga0307405_10059360 Ga0307405_100593604 134
388 3300031733 Ga0316577_10020123 Ga0316577_100201233 134
389 3300031824 Ga0307413_10000482 Ga0307413_100004828 134
390 3300031824 Ga0307413_10073191 Ga0307413_100731912 134
391 3300031852 Ga0307410_10001582 Ga0307410_100015822 134
392 3300031852 Ga0307410_10073529 Ga0307410_100735291 134
393 3300031852 Ga0307410_10608632 Ga0307410_106086321 134
394 3300031901 Ga0307406_10263352 Ga0307406_102633523 134
395 3300031901 Ga0307406_10999681 Ga0307406_109996811 134
396 3300031903 Ga0307407_10001104 Ga0307407_100011049 134
397 3300031911 Ga0307412_10295751 Ga0307412_102957512 134
398 3300031995 Ga0307409_100001611 Ga0307409_10000161117 134
399 3300031995 Ga0307409_100017862 Ga0307409_1000178622 134
400 3300032002 Ga0307416_100194876 Ga0307416_1001948762 134
401 3300032002 Ga0307416_100549192 Ga0307416_1005491922 134
402 3300032002 Ga0307416_101615747 Ga0307416_1016157472 134
403 3300032004 Ga0307414_10020614 Ga0307414_100206147 134
404 3300032004 Ga0307414_10045985 Ga0307414_100459856 134
405 3300032004 Ga0307414_10088793 Ga0307414_100887933 134
406 3300032126 Ga0307415_100035794 Ga0307415_1000357942 134
407 3300032126 Ga0307415_100139544 Ga0307415_1001395442 134
408 3300032126 Ga0307415_100266116 Ga0307415_1002661162 134
409 3300032126 Ga0307415_100509266 Ga0307415_1005092662 134
410 3300035172 Ga0373955_0412676 Ga0373955_0412676_51_455 134
411 3300039437 Ga0436365_0861406 Ga0436365_0861406_13383_13787 134
412 3300039437 Ga0436365_0947596 Ga0436365_0947596_2986_3390 134
413 3300039437 Ga0436365_1839233 Ga0436365_1839233_953_1393 134
414 3300039450 Ga0436363_1307533 Ga0436363_1307533_41_445 134
415 3300041463 Ga0451804_1119475 Ga0451804_1119475_174_581 134
416 3300041509 Ga0451843_0715407 Ga0451843_0715407_286_690 134
417 3300042876 Ga0451577_0022276 Ga0451577_0022276_619_1023 134
418 3300042876 Ga0451577_0279088 Ga0451577_0279088_212_616 134
419 3300042876 Ga0451577_0335525 Ga0451577_0335525_18_422 134
420 3300044658 Ga0466972_0001665 Ga0466972_0001665_5230_5634 134
421 3300044683 Ga0466965_0186806 Ga0466965_0186806_205_789 134
422 3300044712 Ga0453684_0035312 Ga0453684_0035312_1703_2107 134
423 3300044712 Ga0453684_0764850 Ga0453684_0764850_408_812 134
424 3300044765 Ga0466970_0005725 Ga0466970_0005725_512_916 134
425 3300044901 Ga0466960_0002003 Ga0466960_0002003_5024_5440 134
426 3300045051 Ga0451576_1011184 Ga0451576_1011184_262_666 134
427 3300046501 Ga0495607_0019656 Ga0495607_0019656_143_547 134
428 3300046516 Ga0495628_0007266 Ga0495628_0007266_6355_6759 134
429 3300046517 Ga0495630_0061512 Ga0495630_0061512_635_1039 134
430 3300046525 Ga0495663_0000453 Ga0495663_0000453_84_488 134
431 3300046535 Ga0495586_0008975 Ga0495586_0008975_138_542 134
432 3300046537 Ga0495598_0000091 Ga0495598_0000091_13493_13897 134
433 3300046539 Ga0495621_0000163 Ga0495621_0000163_13715_14119 134
434 3300046642 Ga0495634_0088614 Ga0495634_0088614_824_1228 134
435 3300046678 Ga0495599_0070158 Ga0495599_0070158_1657_2061 134
436 3300046691 Ga0495670_0390107 Ga0495670_0390107_317_721 134
437 3300047318 Ga0495636_0004660 Ga0495636_0004660_1905_2309 134
438 3300047319 Ga0495674_0005575 Ga0495674_0005575_3146_3550 134
439 3300047320 Ga0495672_0006846 Ga0495672_0006846_2214_2618 134
440 3300047471 Ga0495684_0021130 Ga0495684_0021130_60_464 134
441 3300047471 Ga0495684_0267135 Ga0495684_0267135_619_1023 134
442 3300048090 Ga0495615_0162996 Ga0495615_0162996_110_514 134
443 3300048904 Ga0496101_0120527 Ga0496101_0120527_492_896 134
444 3300048906 Ga0496103_0266791 Ga0496103_0266791_99_503 134
445 3300048907 Ga0496104_0570473 Ga0496104_0570473_205_609 134
446 3300048910 Ga0496107_0532032 Ga0496107_0532032_412_816 134
447 3300048911 Ga0496108_0185944 Ga0496108_0185944_750_1154 134
448 3300048912 Ga0496109_0015254 Ga0496109_0015254_2256_2660 134
449 3300048912 Ga0496109_0122696 Ga0496109_0122696_1796_2200 134
450 3300048912 Ga0496109_0238027 Ga0496109_0238027_702_1106 134
451 3300048913 Ga0496110_0067624 Ga0496110_0067624_2271_2675 134
452 3300048913 Ga0496110_0182458 Ga0496110_0182458_1284_1688 134
453 3300048915 Ga0496112_0486006 Ga0496112_0486006_737_1141 134
454 3300048916 Ga0496113_0259178 Ga0496113_0259178_837_1241 134
455 3300048916 Ga0496113_0283461 Ga0496113_0283461_575_979 134
456 3300049515 Ga0501292_059774 Ga0501292_059774_121_525 134
457 3300049572 Ga0501036_0044709 Ga0501036_0044709_1691_2125 134
458 3300049576 Ga0501040_0103368 Ga0501040_0103368_175_609 134
459 3300049577 Ga0501041_0042731 Ga0501041_0042731_1092_1526 134
460 3300049578 Ga0501042_0245760 Ga0501042_0245760_33_467 134
461 3300049582 Ga0501048_0025190 Ga0501048_0025190_559_993 134
462 3300049588 Ga0501072_0293392 Ga0501072_0293392_860_1264 134
463 3300049588 Ga0501072_1499401 Ga0501072_1499401_85_489 134
464 3300049591 Ga0501075_0440401 Ga0501075_0440401_321_725 134
465 3300049592 Ga0501076_0005699 Ga0501076_0005699_5941_6375 134
466 3300049593 Ga0501077_0826578 Ga0501077_0826578_16_420 134
467 3300049656 Ga0501209_124033 Ga0501209_124033_283_687 134
468 3300049664 Ga0501224_085191 Ga0501224_085191_61_465 134
469 3300049668 Ga0501233_050989 Ga0501233_050989_158_574 134
470 3300049669 Ga0501235_162646 Ga0501235_162646_105_509 134
471 3300049675 Ga0501243_135385 Ga0501243_135385_73_477 134
472 3300049741 Ga0501079_0629964 Ga0501079_0629964_105_509 134
473 3300049744 Ga0501083_1073306 Ga0501083_1073306_15_509 134
474 3300050489 nmdc:mga03683_2448_c1 nmdc:mga03683_2448_c1_2885_3289 134
475 3300050490 nmdc:mga03n38_30403_c1 nmdc:mga03n38_30403_c1_1833_2237 134
476 3300050492 nmdc:mga0yw44_339809_c1 nmdc:mga0yw44_339809_c1_335_739 134
477 3300050493 nmdc:mga0k408_1673_c1 nmdc:mga0k408_1673_c1_7699_8103 134
478 3300050494 nmdc:mga06z11_2949_c1 nmdc:mga06z11_2949_c1_2587_2991 134
479 3300050495 nmdc:mga04h51_96103_c1 nmdc:mga04h51_96103_c1_608_1012 134
480 3300050495 nmdc:mga04h51_9615_c1 nmdc:mga04h51_9615_c1_1750_2154 134
481 3300050496 nmdc:mga07m45_373662_c1 nmdc:mga07m45_373662_c1_153_557 134
482 3300050508 nmdc:mga09592_409997_c1 nmdc:mga09592_409997_c1_51_455 134
483 3300050509 nmdc:mga0qj67_26271_c1 nmdc:mga0qj67_26271_c1_2296_2700 134
484 3300050509 nmdc:mga0qj67_673843_c1 nmdc:mga0qj67_673843_c1_37_441 134
485 3300050509 nmdc:mga0qj67_80814_c1 nmdc:mga0qj67_80814_c1_684_1136 134
486 3300050510 nmdc:mga06r32_51065_c1 nmdc:mga06r32_51065_c1_137_541 134
487 3300050511 nmdc:mga08y16_122_c1 nmdc:mga08y16_122_c1_9208_9612 134
488 3300050511 nmdc:mga08y16_5289_c1 nmdc:mga08y16_5289_c1_4135_4539 134
489 3300050511 nmdc:mga08y16_781514_c1 nmdc:mga08y16_781514_c1_187_591 134
490 3300050512 nmdc:mga0n895_2041112_c1 nmdc:mga0n895_2041112_c1_73_477 134
491 3300050513 nmdc:mga0rr50_736205_c1 nmdc:mga0rr50_736205_c1_379_783 134
492 3300050515 nmdc:mga0a205_360479_c1 nmdc:mga0a205_360479_c1_50_454 134
493 3300050515 nmdc:mga0a205_607789_c1 nmdc:mga0a205_607789_c1_39_443 134
494 3300050515 nmdc:mga0a205_659341_c1 nmdc:mga0a205_659341_c1_242_646 134
495 3300050515 nmdc:mga0a205_801438_c1 nmdc:mga0a205_801438_c1_40_444 134
496 3300053077 Ga0495601_0046681 Ga0495601_0046681_1709_2113 134
497 3300053134 Ga0500658_0093189 Ga0500658_0093189_835_1239 134
498 3300053156 Ga0500622_0005971 Ga0500622_0005971_1829_2233 134
499 3300053156 Ga0500622_0093379 Ga0500622_0093379_391_795 134
500 3300053178 Ga0500637_0002574 Ga0500637_0002574_5602_6006 134
501 3300054114 Ga0501084_0279871 Ga0501084_0279871_30_458 134
502 3300054114 Ga0501084_0400088 Ga0501084_0400088_729_1133 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

9

126

0.91

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

125

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gus-assembly1.cif.gz_B mopii from clostridium pasteurianum (apo1) 0.7163 94 124
4z25-assembly4.cif.gz_J mimivirus r135 (residues 51-702) 0.7146 94 123
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.7063 3 126
3ic8-assembly2.cif.gz_A the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a 0.7031 101 124
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.6998 3 128
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9123 74 121 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8907 74 125 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8307 74 121 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8254 76 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8202 74 125 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A090E412-F1-model_v4 Glyoxalase-like domain-containing protein 0.9768 74 125
AF-A0A850JMV8-F1-model_v4 VOC family protein 0.9745 74 125
AF-A0A7W5TGB5-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9737 76 125 GO:0016829
AF-A0A136MF62-F1-model_v4 deleted 0.9735 74 125
AF-A0A1H2S8F6-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9718 76 125

Feature Viewer

pLDDT pTM Quality
91.06 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map