F455845
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 269 | 502 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_12540884|Ga0157378_125408841 |
| Length | 137 |
| Sequence | MARVTGIGGVFFKSRKDHQALAAWYEKNLGIKLEPWGGAILRWPDDHGEDKAEDKGVTVWCTAAANTDWFSPSESSFMINYRVDDMAGLLAKLRGADVKIVKGPESHENGKFAWILDPEGNKVELWEPMNWDEKNKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 190 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 235 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 239 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 242 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 244 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 250 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 254 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 267 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 268 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.98 |
| Nodule | 0 |
| Rhizoplane | 2.79 |
| Rhizosphere | 90.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10062662 | 3300003320 | Bacteria | 2250 |
| 2 | Ga0055531_10027319 | 3300003794 | Bacteria | 2006 |
| 3 | Ga0058863_11441775 | 3300004799 | Bacteria | 500 |
| 4 | Ga0065714_10148579 | 3300005288 | Bacteria | 1119 |
| 5 | Ga0065704_10035083 | 3300005289 | Bacteria | 952 |
| 6 | Ga0065704_10355072 | 3300005289 | Unclassified | 805 |
| 7 | Ga0065712_10068047 | 3300005290 | Bacteria | 16179 |
| 8 | Ga0065712_10239804 | 3300005290 | Bacteria | 982 |
| 9 | Ga0065715_10099278 | 3300005293 | Bacteria | 3433 |
| 10 | Ga0065715_10217048 | 3300005293 | Bacteria | 1288 |
| 11 | Ga0065707_10088575 | 3300005295 | Bacteria | 4619 |
| 12 | Ga0070658_10004673 | 3300005327 | Bacteria | 11133 |
| 13 | Ga0070658_10061896 | 3300005327 | Unclassified | 3049 |
| 14 | Ga0070658_10134783 | 3300005327 | Bacteria | 2059 |
| 15 | Ga0070676_11067136 | 3300005328 | Bacteria | 609 |
| 16 | Ga0070690_100005509 | 3300005330 | Bacteria | 7118 |
| 17 | Ga0070690_100007704 | 3300005330 | Bacteria | 6174 |
| 18 | Ga0070690_100461592 | 3300005330 | Bacteria | 943 |
| 19 | Ga0070670_100025220 | 3300005331 | Bacteria | 5117 |
| 20 | Ga0070670_101106628 | 3300005331 | Bacteria | 722 |
| 21 | Ga0070677_10469521 | 3300005333 | Bacteria | 676 |
| 22 | Ga0068869_100014103 | 3300005334 | Bacteria | 5333 |
| 23 | Ga0068869_100080243 | 3300005334 | Bacteria | 2434 |
| 24 | Ga0068869_100744253 | 3300005334 | Bacteria | 839 |
| 25 | Ga0070666_10000767 | 3300005335 | Bacteria | 19409 |
| 26 | Ga0070666_10002699 | 3300005335 | Bacteria | 10708 |
| 27 | Ga0070666_10601297 | 3300005335 | Bacteria | 803 |
| 28 | Ga0068868_100002891 | 3300005338 | Bacteria | 11918 |
| 29 | Ga0068868_100578712 | 3300005338 | Bacteria | 992 |
| 30 | Ga0070660_100000214 | 3300005339 | Bacteria | 38727 |
| 31 | Ga0070689_100003324 | 3300005340 | Bacteria | 10680 |
| 32 | Ga0070689_100016977 | 3300005340 | Bacteria | 5339 |
| 33 | Ga0070689_100638925 | 3300005340 | Bacteria | 925 |
| 34 | Ga0070691_10018421 | 3300005341 | Bacteria | 3219 |
| 35 | Ga0070687_100000241 | 3300005343 | Bacteria | 18833 |
| 36 | Ga0070661_100291351 | 3300005344 | Bacteria | 1268 |
| 37 | Ga0070661_100954738 | 3300005344 | Bacteria | 710 |
| 38 | Ga0070692_10290024 | 3300005345 | Bacteria | 995 |
| 39 | Ga0070692_11162073 | 3300005345 | Bacteria | 548 |
| 40 | Ga0070669_100013220 | 3300005353 | Bacteria | 5868 |
| 41 | Ga0070669_100085492 | 3300005353 | Bacteria | 2355 |
| 42 | Ga0070669_100354866 | 3300005353 | Bacteria | 1191 |
| 43 | Ga0070675_100003764 | 3300005354 | Bacteria | 11517 |
| 44 | Ga0070675_100388693 | 3300005354 | Bacteria | 1243 |
| 45 | Ga0070671_100001794 | 3300005355 | Bacteria | 16314 |
| 46 | Ga0070671_100001940 | 3300005355 | Bacteria | 15865 |
| 47 | Ga0070671_101499379 | 3300005355 | Bacteria | 597 |
| 48 | Ga0070673_100043700 | 3300005364 | Bacteria | 3464 |
| 49 | Ga0070673_100512093 | 3300005364 | Bacteria | 1086 |
| 50 | Ga0070673_100572870 | 3300005364 | Bacteria | 1027 |
| 51 | Ga0070673_100801891 | 3300005364 | Bacteria | 869 |
| 52 | Ga0070673_101273217 | 3300005364 | Bacteria | 690 |
| 53 | Ga0070688_100000389 | 3300005365 | Bacteria | 22221 |
| 54 | Ga0070688_100002574 | 3300005365 | Bacteria | 9188 |
| 55 | Ga0070659_100001202 | 3300005366 | Bacteria | 18849 |
| 56 | Ga0070659_100282771 | 3300005366 | Bacteria | 1380 |
| 57 | Ga0070667_100216359 | 3300005367 | Bacteria | 1704 |
| 58 | Ga0070667_101422651 | 3300005367 | Bacteria | 650 |
| 59 | Ga0070667_101493685 | 3300005367 | Bacteria | 634 |
| 60 | Ga0070705_100014731 | 3300005440 | Bacteria | 4031 |
| 61 | Ga0070700_100000056 | 3300005441 | Bacteria | 83455 |
| 62 | Ga0070700_100384520 | 3300005441 | Bacteria | 1051 |
| 63 | Ga0070678_100050133 | 3300005456 | Bacteria | 3018 |
| 64 | Ga0070662_100001196 | 3300005457 | Bacteria | 15947 |
| 65 | Ga0070662_100007301 | 3300005457 | Bacteria | 7159 |
| 66 | Ga0070662_100669477 | 3300005457 | Bacteria | 876 |
| 67 | Ga0070662_101301249 | 3300005457 | Unclassified | 626 |
| 68 | Ga0070681_10237887 | 3300005458 | Bacteria | 1735 |
| 69 | Ga0068867_100007657 | 3300005459 | Bacteria | 7642 |
| 70 | Ga0068867_100011658 | 3300005459 | Bacteria | 6207 |
| 71 | Ga0070685_10354947 | 3300005466 | Bacteria | 1003 |
| 72 | Ga0070707_100009815 | 3300005468 | Bacteria | 8905 |
| 73 | Ga0070699_100408909 | 3300005518 | Bacteria | 1227 |
| 74 | Ga0070679_101537795 | 3300005530 | Bacteria | 612 |
| 75 | Ga0070684_100045803 | 3300005535 | Bacteria | 3788 |
| 76 | Ga0070684_100063589 | 3300005535 | Bacteria | 3235 |
| 77 | Ga0070697_100006709 | 3300005536 | Bacteria | 8933 |
| 78 | Ga0068853_100603510 | 3300005539 | Bacteria | 1042 |
| 79 | Ga0070672_100051268 | 3300005543 | Bacteria | 3217 |
| 80 | Ga0070672_100707880 | 3300005543 | Unclassified | 882 |
| 81 | Ga0070686_100019907 | 3300005544 | Bacteria | 3965 |
| 82 | Ga0070695_100090724 | 3300005545 | Unclassified | 2040 |
| 83 | Ga0070695_100120119 | 3300005545 | Bacteria | 1797 |
| 84 | Ga0070696_100294029 | 3300005546 | Bacteria | 1242 |
| 85 | Ga0070693_100000641 | 3300005547 | Bacteria | 15412 |
| 86 | Ga0070665_100001521 | 3300005548 | Bacteria | 26874 |
| 87 | Ga0070665_100038653 | 3300005548 | Bacteria | 4797 |
| 88 | Ga0070665_101114833 | 3300005548 | Bacteria | 800 |
| 89 | Ga0070664_100005842 | 3300005564 | Bacteria | 9926 |
| 90 | Ga0070664_100011822 | 3300005564 | Bacteria | 7086 |
| 91 | Ga0070664_101330394 | 3300005564 | Bacteria | 679 |
| 92 | Ga0068857_100001753 | 3300005577 | Bacteria | 17438 |
| 93 | Ga0068857_100436290 | 3300005577 | Unclassified | 1223 |
| 94 | Ga0068857_100672004 | 3300005577 | Bacteria | 983 |
| 95 | Ga0068854_100011914 | 3300005578 | Bacteria | 5681 |
| 96 | Ga0070702_100111708 | 3300005615 | Bacteria | 1695 |
| 97 | Ga0070702_100646871 | 3300005615 | Bacteria | 799 |
| 98 | Ga0070702_100754426 | 3300005615 | Bacteria | 748 |
| 99 | Ga0068852_100112794 | 3300005616 | Bacteria | 2474 |
| 100 | Ga0068852_100227558 | 3300005616 | Bacteria | 1776 |
| 101 | Ga0068859_100019498 | 3300005617 | Bacteria | 6813 |
| 102 | Ga0068859_100245698 | 3300005617 | Bacteria | 1879 |
| 103 | Ga0068859_101049271 | 3300005617 | Unclassified | 896 |
| 104 | Ga0068859_101968757 | 3300005617 | Bacteria | 645 |
| 105 | Ga0068864_100004004 | 3300005618 | Bacteria | 12133 |
| 106 | Ga0068864_100107192 | 3300005618 | Bacteria | 2485 |
| 107 | Ga0068864_100657637 | 3300005618 | Bacteria | 1021 |
| 108 | Ga0068864_101223437 | 3300005618 | Bacteria | 750 |
| 109 | Ga0068866_10006018 | 3300005718 | Bacteria | 5048 |
| 110 | Ga0068866_10090536 | 3300005718 | Bacteria | 1665 |
| 111 | Ga0068861_100000562 | 3300005719 | Bacteria | 22006 |
| 112 | Ga0068861_100000577 | 3300005719 | Bacteria | 21668 |
| 113 | Ga0068861_100032990 | 3300005719 | Bacteria | 3817 |
| 114 | Ga0068861_100095663 | 3300005719 | Bacteria | 2353 |
| 115 | Ga0068861_101011232 | 3300005719 | Bacteria | 794 |
| 116 | Ga0068851_10001093 | 3300005834 | Bacteria | 11764 |
| 117 | Ga0068851_10613007 | 3300005834 | Unclassified | 663 |
| 118 | Ga0068870_10011516 | 3300005840 | Bacteria | 4103 |
| 119 | Ga0068870_10363494 | 3300005840 | Bacteria | 932 |
| 120 | Ga0068870_10413006 | 3300005840 | Bacteria | 881 |
| 121 | Ga0068863_100003717 | 3300005841 | Bacteria | 15093 |
| 122 | Ga0068863_100007517 | 3300005841 | Bacteria | 10656 |
| 123 | Ga0068863_100053869 | 3300005841 | Bacteria | 3813 |
| 124 | Ga0068863_100233295 | 3300005841 | Bacteria | 1775 |
| 125 | Ga0068863_100621813 | 3300005841 | Bacteria | 1070 |
| 126 | Ga0068863_100749024 | 3300005841 | Bacteria | 973 |
| 127 | Ga0068863_100783729 | 3300005841 | Unclassified | 950 |
| 128 | Ga0068858_100006090 | 3300005842 | Bacteria | 11767 |
| 129 | Ga0068858_100072795 | 3300005842 | Bacteria | 3189 |
| 130 | Ga0068860_100174934 | 3300005843 | Bacteria | 2075 |
| 131 | Ga0068860_100307078 | 3300005843 | Bacteria | 1555 |
| 132 | Ga0068860_100554758 | 3300005843 | Bacteria | 1151 |
| 133 | Ga0068860_101092584 | 3300005843 | Unclassified | 817 |
| 134 | Ga0068862_100029895 | 3300005844 | Bacteria | 4590 |
| 135 | Ga0068862_100046498 | 3300005844 | Bacteria | 3703 |
| 136 | Ga0068862_100073311 | 3300005844 | Bacteria | 2959 |
| 137 | Ga0068862_100359943 | 3300005844 | Bacteria | 1352 |
| 138 | Ga0068862_100547847 | 3300005844 | Bacteria | 1104 |
| 139 | Ga0068862_101207915 | 3300005844 | Bacteria | 755 |
| 140 | Ga0081539_10035507 | 3300005985 | Bacteria | 2995 |
| 141 | Ga0075368_10037190 | 3300006042 | Bacteria | 1903 |
| 142 | Ga0075368_10184516 | 3300006042 | Bacteria | 880 |
| 143 | Ga0075364_10002052 | 3300006051 | Bacteria | 11243 |
| 144 | Ga0075362_10020965 | 3300006177 | Bacteria | 2736 |
| 145 | Ga0075367_10024806 | 3300006178 | Bacteria | 3383 |
| 146 | Ga0075367_10312786 | 3300006178 | Unclassified | 989 |
| 147 | Ga0075366_10000302 | 3300006195 | Bacteria | 22298 |
| 148 | Ga0075366_10979768 | 3300006195 | Bacteria | 527 |
| 149 | Ga0097621_100010243 | 3300006237 | Bacteria | 6848 |
| 150 | Ga0097621_100229527 | 3300006237 | Bacteria | 1620 |
| 151 | Ga0075370_10397198 | 3300006353 | Unclassified | 827 |
| 152 | Ga0075428_100018514 | 3300006844 | Bacteria | 7700 |
| 153 | Ga0075428_100959448 | 3300006844 | Bacteria | 906 |
| 154 | Ga0075430_100010623 | 3300006846 | Bacteria | 7800 |
| 155 | Ga0075430_100217121 | 3300006846 | Bacteria | 1587 |
| 156 | Ga0075430_100316383 | 3300006846 | Bacteria | 1290 |
| 157 | Ga0075430_100494073 | 3300006846 | Unclassified | 1010 |
| 158 | Ga0075431_100225523 | 3300006847 | Bacteria | 1911 |
| 159 | Ga0075433_10502713 | 3300006852 | Bacteria | 1067 |
| 160 | Ga0075433_10568376 | 3300006852 | Unclassified | 996 |
| 161 | Ga0075433_10611119 | 3300006852 | Bacteria | 957 |
| 162 | Ga0075429_100036497 | 3300006880 | Bacteria | 4275 |
| 163 | Ga0075429_100587891 | 3300006880 | Bacteria | 975 |
| 164 | Ga0068865_100261583 | 3300006881 | Bacteria | 1370 |
| 165 | Ga0068865_100938012 | 3300006881 | Bacteria | 755 |
| 166 | Ga0097620_100019499 | 3300006931 | Bacteria | 6813 |
| 167 | Ga0097620_100245694 | 3300006931 | Bacteria | 1879 |
| 168 | Ga0097620_101049334 | 3300006931 | Unclassified | 896 |
| 169 | Ga0097620_101969479 | 3300006931 | Bacteria | 645 |
| 170 | Ga0075435_100496256 | 3300007076 | Bacteria | 1055 |
| 171 | Ga0105240_10040933 | 3300009093 | Bacteria | 5920 |
| 172 | Ga0105240_10965091 | 3300009093 | Bacteria | 913 |
| 173 | Ga0111539_10000099 | 3300009094 | Bacteria | 91525 |
| 174 | Ga0111539_10116058 | 3300009094 | Bacteria | 3139 |
| 175 | Ga0111539_10117917 | 3300009094 | Bacteria | 3111 |
| 176 | Ga0105245_10000641 | 3300009098 | Bacteria | 31814 |
| 177 | Ga0105245_12073518 | 3300009098 | Bacteria | 622 |
| 178 | Ga0105247_10018198 | 3300009101 | Bacteria | 4214 |
| 179 | Ga0114129_10488508 | 3300009147 | Bacteria | 1610 |
| 180 | Ga0105243_10077148 | 3300009148 | Bacteria | 2709 |
| 181 | Ga0105243_10413777 | 3300009148 | Bacteria | 1255 |
| 182 | Ga0105243_10899161 | 3300009148 | Bacteria | 880 |
| 183 | Ga0105241_10006878 | 3300009174 | Bacteria | 8369 |
| 184 | Ga0105241_10250572 | 3300009174 | Bacteria | 1501 |
| 185 | Ga0105241_10341937 | 3300009174 | Bacteria | 1297 |
| 186 | Ga0105241_10834505 | 3300009174 | Bacteria | 851 |
| 187 | Ga0105242_10080633 | 3300009176 | Unclassified | 2720 |
| 188 | Ga0105242_10106875 | 3300009176 | Bacteria | 2379 |
| 189 | Ga0105242_10425444 | 3300009176 | Bacteria | 1245 |
| 190 | Ga0105248_10005072 | 3300009177 | Bacteria | 14536 |
| 191 | Ga0105237_10626263 | 3300009545 | Bacteria | 1083 |
| 192 | Ga0105238_10060496 | 3300009551 | Bacteria | 3792 |
| 193 | Ga0105249_10001405 | 3300009553 | Bacteria | 21079 |
| 194 | Ga0105249_10015546 | 3300009553 | Bacteria | 6737 |
| 195 | Ga0105249_10049294 | 3300009553 | Bacteria | 3840 |
| 196 | Ga0105249_10067053 | 3300009553 | Bacteria | 3305 |
| 197 | Ga0105249_10102115 | 3300009553 | Bacteria | 2698 |
| 198 | Ga0105249_13332304 | 3300009553 | Bacteria | 517 |
| 199 | Ga0105239_10613032 | 3300010375 | Bacteria | 1242 |
| 200 | Ga0105239_12748558 | 3300010375 | Bacteria | 574 |
| 201 | Ga0105239_13427710 | 3300010375 | Bacteria | 516 |
| 202 | Ga0105246_10069060 | 3300011119 | Bacteria | 2480 |
| 203 | Ga0157371_10557383 | 3300013102 | Bacteria | 850 |
| 204 | Ga0157369_10002451 | 3300013105 | Bacteria | 22260 |
| 205 | Ga0157369_10490476 | 3300013105 | Bacteria | 1271 |
| 206 | Ga0157369_10630962 | 3300013105 | Bacteria | 1105 |
| 207 | Ga0157374_10233982 | 3300013296 | Bacteria | 1805 |
| 208 | Ga0157374_10456119 | 3300013296 | Bacteria | 1280 |
| 209 | Ga0157378_10002122 | 3300013297 | Bacteria | 17643 |
| 210 | Ga0157378_10302074 | 3300013297 | Bacteria | 1549 |
| 211 | Ga0157378_12540884 | 3300013297 | Bacteria | 564 |
| 212 | Ga0163162_10205427 | 3300013306 | Bacteria | 2099 |
| 213 | Ga0157372_10012458 | 3300013307 | Bacteria | 9064 |
| 214 | Ga0157372_10681806 | 3300013307 | Bacteria | 1196 |
| 215 | Ga0163163_10009152 | 3300014325 | Bacteria | 8826 |
| 216 | Ga0157380_10028565 | 3300014326 | Bacteria | 4254 |
| 217 | Ga0157380_10048913 | 3300014326 | Bacteria | 3332 |
| 218 | Ga0157380_11168861 | 3300014326 | Bacteria | 812 |
| 219 | Ga0157377_10003883 | 3300014745 | Bacteria | 6810 |
| 220 | Ga0157379_10007314 | 3300014968 | Bacteria | 9555 |
| 221 | Ga0157379_10127139 | 3300014968 | Bacteria | 2293 |
| 222 | Ga0157379_10836552 | 3300014968 | Bacteria | 870 |
| 223 | Ga0157376_10210208 | 3300014969 | Bacteria | 1796 |
| 224 | Ga0163161_11202889 | 3300017792 | Bacteria | 655 |
| 225 | Ga0213876_10000024 | 3300021384 | Bacteria | 237488 |
| 226 | Ga0209257_1000437 | 3300025304 | Bacteria | 80060 |
| 227 | Ga0207697_10001765 | 3300025315 | Bacteria | 11610 |
| 228 | Ga0207656_10045092 | 3300025321 | Bacteria | 1885 |
| 229 | Ga0207642_10036617 | 3300025899 | Bacteria | 2107 |
| 230 | Ga0207710_10781921 | 3300025900 | Bacteria | 502 |
| 231 | Ga0207688_10000450 | 3300025901 | Bacteria | 19483 |
| 232 | Ga0207688_10014280 | 3300025901 | Bacteria | 4321 |
| 233 | Ga0207680_10005230 | 3300025903 | Bacteria | 6191 |
| 234 | Ga0207680_10578044 | 3300025903 | Bacteria | 803 |
| 235 | Ga0207647_10000019 | 3300025904 | Bacteria | 123924 |
| 236 | Ga0207647_10597039 | 3300025904 | Bacteria | 609 |
| 237 | Ga0207645_10001166 | 3300025907 | Bacteria | 21674 |
| 238 | Ga0207645_10192595 | 3300025907 | Bacteria | 1340 |
| 239 | Ga0207645_10720596 | 3300025907 | Bacteria | 678 |
| 240 | Ga0207643_10000113 | 3300025908 | Bacteria | 55446 |
| 241 | Ga0207643_10088663 | 3300025908 | Bacteria | 1801 |
| 242 | Ga0207643_10667954 | 3300025908 | Unclassified | 671 |
| 243 | Ga0207705_10006527 | 3300025909 | Bacteria | 8639 |
| 244 | Ga0207705_10027757 | 3300025909 | Bacteria | 4037 |
| 245 | Ga0207705_10078343 | 3300025909 | Bacteria | 2405 |
| 246 | Ga0207705_11196320 | 3300025909 | Bacteria | 583 |
| 247 | Ga0207654_10625146 | 3300025911 | Bacteria | 770 |
| 248 | Ga0207654_10794695 | 3300025911 | Bacteria | 683 |
| 249 | Ga0207695_10030334 | 3300025913 | Bacteria | 5954 |
| 250 | Ga0207695_10067526 | 3300025913 | Bacteria | 3668 |
| 251 | Ga0207671_10497768 | 3300025914 | Bacteria | 972 |
| 252 | Ga0207657_10000059 | 3300025919 | Bacteria | 103782 |
| 253 | Ga0207649_10031191 | 3300025920 | Bacteria | 3166 |
| 254 | Ga0207649_10663316 | 3300025920 | Bacteria | 807 |
| 255 | Ga0207652_10030302 | 3300025921 | Bacteria | 4529 |
| 256 | Ga0207681_10031477 | 3300025923 | Bacteria | 3465 |
| 257 | Ga0207694_10001535 | 3300025924 | Bacteria | 19628 |
| 258 | Ga0207650_10000514 | 3300025925 | Bacteria | 32086 |
| 259 | Ga0207650_10034298 | 3300025925 | Bacteria | 3680 |
| 260 | Ga0207650_10319660 | 3300025925 | Unclassified | 1271 |
| 261 | Ga0207659_10212343 | 3300025926 | Bacteria | 1552 |
| 262 | Ga0207644_10005866 | 3300025931 | Bacteria | 8005 |
| 263 | Ga0207644_10377148 | 3300025931 | Bacteria | 1156 |
| 264 | Ga0207644_10599656 | 3300025931 | Bacteria | 914 |
| 265 | Ga0207690_10214456 | 3300025932 | Bacteria | 1469 |
| 266 | Ga0207706_10001171 | 3300025933 | Bacteria | 26598 |
| 267 | Ga0207706_10003006 | 3300025933 | Bacteria | 16254 |
| 268 | Ga0207706_10027587 | 3300025933 | Bacteria | 5076 |
| 269 | Ga0207686_10088922 | 3300025934 | Bacteria | 2034 |
| 270 | Ga0207709_10005185 | 3300025935 | Bacteria | 7422 |
| 271 | Ga0207670_10137445 | 3300025936 | Bacteria | 1798 |
| 272 | Ga0207670_10188726 | 3300025936 | Bacteria | 1558 |
| 273 | Ga0207669_10094347 | 3300025937 | Bacteria | 1958 |
| 274 | Ga0207704_10000136 | 3300025938 | Bacteria | 39545 |
| 275 | Ga0207704_10105773 | 3300025938 | Bacteria | 1888 |
| 276 | Ga0207704_10489492 | 3300025938 | Bacteria | 989 |
| 277 | Ga0207665_10785704 | 3300025939 | Bacteria | 752 |
| 278 | Ga0207691_10243695 | 3300025940 | Bacteria | 1553 |
| 279 | Ga0207691_10590868 | 3300025940 | Bacteria | 940 |
| 280 | Ga0207711_10002981 | 3300025941 | Bacteria | 14789 |
| 281 | Ga0207711_10149157 | 3300025941 | Bacteria | 2109 |
| 282 | Ga0207711_11103579 | 3300025941 | Bacteria | 734 |
| 283 | Ga0207689_10000009 | 3300025942 | Bacteria | 127375 |
| 284 | Ga0207689_10081879 | 3300025942 | Bacteria | 2654 |
| 285 | Ga0207661_11169489 | 3300025944 | Bacteria | 708 |
| 286 | Ga0207679_10001112 | 3300025945 | Bacteria | 17128 |
| 287 | Ga0207679_10001337 | 3300025945 | Bacteria | 15592 |
| 288 | Ga0207679_10044140 | 3300025945 | Bacteria | 3215 |
| 289 | Ga0207651_10160275 | 3300025960 | Bacteria | 1763 |
| 290 | Ga0207651_11026635 | 3300025960 | Bacteria | 737 |
| 291 | Ga0207651_11378682 | 3300025960 | Unclassified | 634 |
| 292 | Ga0207651_11622355 | 3300025960 | Bacteria | 583 |
| 293 | Ga0207712_10000601 | 3300025961 | Bacteria | 28655 |
| 294 | Ga0207712_10000977 | 3300025961 | Bacteria | 20523 |
| 295 | Ga0207712_10596962 | 3300025961 | Bacteria | 955 |
| 296 | Ga0207668_10370134 | 3300025972 | Bacteria | 1203 |
| 297 | Ga0207640_10006300 | 3300025981 | Bacteria | 6506 |
| 298 | Ga0207640_10196049 | 3300025981 | Bacteria | 1526 |
| 299 | Ga0207658_10462108 | 3300025986 | Bacteria | 1125 |
| 300 | Ga0207658_11278002 | 3300025986 | Bacteria | 671 |
| 301 | Ga0207677_10092834 | 3300026023 | Bacteria | 2199 |
| 302 | Ga0207703_10000632 | 3300026035 | Bacteria | 35396 |
| 303 | Ga0207703_10056820 | 3300026035 | Bacteria | 3189 |
| 304 | Ga0207703_10146389 | 3300026035 | Bacteria | 2055 |
| 305 | Ga0207703_10348106 | 3300026035 | Bacteria | 1363 |
| 306 | Ga0207703_10982188 | 3300026035 | Bacteria | 810 |
| 307 | Ga0207639_10000117 | 3300026041 | Bacteria | 61185 |
| 308 | Ga0207678_10013247 | 3300026067 | Bacteria | 7236 |
| 309 | Ga0207708_10000089 | 3300026075 | Bacteria | 72013 |
| 310 | Ga0207708_10469712 | 3300026075 | Bacteria | 1050 |
| 311 | Ga0207708_10641688 | 3300026075 | Bacteria | 903 |
| 312 | Ga0207702_10068161 | 3300026078 | Bacteria | 3056 |
| 313 | Ga0207641_10001506 | 3300026088 | Bacteria | 22808 |
| 314 | Ga0207641_10082030 | 3300026088 | Bacteria | 2801 |
| 315 | Ga0207641_10206474 | 3300026088 | Bacteria | 1814 |
| 316 | Ga0207641_10605499 | 3300026088 | Bacteria | 1073 |
| 317 | Ga0207648_10007978 | 3300026089 | Bacteria | 10327 |
| 318 | Ga0207648_10059561 | 3300026089 | Bacteria | 3330 |
| 319 | Ga0207676_10006786 | 3300026095 | Bacteria | 8104 |
| 320 | Ga0207676_10429802 | 3300026095 | Bacteria | 1240 |
| 321 | Ga0207674_10000858 | 3300026116 | Bacteria | 39727 |
| 322 | Ga0207674_10112976 | 3300026116 | Bacteria | 2689 |
| 323 | Ga0207675_100000005 | 3300026118 | Bacteria | 199965 |
| 324 | Ga0207675_100003665 | 3300026118 | Bacteria | 14982 |
| 325 | Ga0207675_100015382 | 3300026118 | Bacteria | 7136 |
| 326 | Ga0207675_100168584 | 3300026118 | Bacteria | 2092 |
| 327 | Ga0207683_10001342 | 3300026121 | Bacteria | 22223 |
| 328 | Ga0207683_10697643 | 3300026121 | Bacteria | 941 |
| 329 | Ga0207698_10055343 | 3300026142 | Bacteria | 3057 |
| 330 | Ga0209813_10009972 | 3300027866 | Unclassified | 2445 |
| 331 | Ga0209813_10082454 | 3300027866 | Bacteria | 1066 |
| 332 | Ga0207428_10000201 | 3300027907 | Bacteria | 83434 |
| 333 | Ga0207428_10016879 | 3300027907 | Bacteria | 6274 |
| 334 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 335 | Ga0268266_10522972 | 3300028379 | Bacteria | 1134 |
| 336 | Ga0268265_10030100 | 3300028380 | Bacteria | 3905 |
| 337 | Ga0268265_10101793 | 3300028380 | Bacteria | 2321 |
| 338 | Ga0268265_10222728 | 3300028380 | Bacteria | 1652 |
| 339 | Ga0268265_10344458 | 3300028380 | Bacteria | 1358 |
| 340 | Ga0268265_11312082 | 3300028380 | Unclassified | 724 |
| 341 | Ga0268264_10001536 | 3300028381 | Bacteria | 21495 |
| 342 | Ga0268264_10189775 | 3300028381 | Bacteria | 1872 |
| 343 | Ga0268264_11420083 | 3300028381 | Bacteria | 705 |
| 344 | Ga0265760_10036224 | 3300031090 | Bacteria | 1463 |
| 345 | Ga0307513_10147147 | 3300031456 | Bacteria | 2271 |
| 346 | Ga0307513_10919903 | 3300031456 | Bacteria | 582 |
| 347 | Ga0307408_101463953 | 3300031548 | Bacteria | 645 |
| 348 | Ga0307516_10029632 | 3300031730 | Bacteria | 5532 |
| 349 | Ga0307405_10019518 | 3300031731 | Bacteria | 3767 |
| 350 | Ga0307405_10058067 | 3300031731 | Bacteria | 2433 |
| 351 | Ga0307405_10059360 | 3300031731 | Unclassified | 2410 |
| 352 | Ga0316577_10020123 | 3300031733 | Bacteria | 3699 |
| 353 | Ga0307413_10000482 | 3300031824 | Bacteria | 13035 |
| 354 | Ga0307413_10073191 | 3300031824 | Bacteria | 2165 |
| 355 | Ga0307413_10170852 | 3300031824 | Bacteria | 1538 |
| 356 | Ga0307413_10919382 | 3300031824 | Unclassified | 744 |
| 357 | Ga0307410_10001582 | 3300031852 | Bacteria | 10425 |
| 358 | Ga0307410_10019234 | 3300031852 | Bacteria | 4149 |
| 359 | Ga0307410_10073529 | 3300031852 | Bacteria | 2377 |
| 360 | Ga0307410_10608632 | 3300031852 | Bacteria | 912 |
| 361 | Ga0307406_10012030 | 3300031901 | Bacteria | 4923 |
| 362 | Ga0307406_10263352 | 3300031901 | Bacteria | 1306 |
| 363 | Ga0307406_10803779 | 3300031901 | Bacteria | 794 |
| 364 | Ga0307406_10999681 | 3300031901 | Bacteria | 717 |
| 365 | Ga0307407_10001104 | 3300031903 | Bacteria | 9423 |
| 366 | Ga0307407_10149132 | 3300031903 | Bacteria | 1517 |
| 367 | Ga0307412_10295751 | 3300031911 | Unclassified | 1277 |
| 368 | Ga0307409_100001611 | 3300031995 | Bacteria | 11291 |
| 369 | Ga0307409_100017862 | 3300031995 | Bacteria | 4744 |
| 370 | Ga0307409_100459574 | 3300031995 | Bacteria | 1230 |
| 371 | Ga0307416_100194876 | 3300032002 | Unclassified | 1915 |
| 372 | Ga0307416_100239706 | 3300032002 | Bacteria | 1756 |
| 373 | Ga0307416_100549192 | 3300032002 | Unclassified | 1228 |
| 374 | Ga0307416_101615747 | 3300032002 | Bacteria | 753 |
| 375 | Ga0307414_10020614 | 3300032004 | Bacteria | 4113 |
| 376 | Ga0307414_10045985 | 3300032004 | Bacteria | 2993 |
| 377 | Ga0307414_10084730 | 3300032004 | Bacteria | 2332 |
| 378 | Ga0307414_10088793 | 3300032004 | Bacteria | 2289 |
| 379 | Ga0307411_10003392 | 3300032005 | Bacteria | 7380 |
| 380 | Ga0307411_10874392 | 3300032005 | Bacteria | 797 |
| 381 | Ga0307415_100007314 | 3300032126 | Bacteria | 6030 |
| 382 | Ga0307415_100035794 | 3300032126 | Bacteria | 3246 |
| 383 | Ga0307415_100139544 | 3300032126 | Bacteria | 1849 |
| 384 | Ga0307415_100266116 | 3300032126 | Unclassified | 1402 |
| 385 | Ga0307415_100509266 | 3300032126 | Bacteria | 1054 |
| 386 | Ga0373955_0412676 | 3300035172 | Bacteria | 821 |
| 387 | Ga0395900_0041747 | 3300037418 | Bacteria | 4728 |
| 388 | Ga0395905_0015900 | 3300037471 | Bacteria | 7149 |
| 389 | Ga0395901_1458318 | 3300038443 | Bacteria | 641 |
| 390 | Ga0436365_0861406 | 3300039437 | Bacteria | 61112 |
| 391 | Ga0436365_0947596 | 3300039437 | Bacteria | 3628 |
| 392 | Ga0436365_1839233 | 3300039437 | Bacteria | 2872 |
| 393 | Ga0436365_1926687 | 3300039437 | Bacteria | 2586 |
| 394 | Ga0436360_1040944 | 3300039438 | Unclassified | 554 |
| 395 | Ga0436363_1307533 | 3300039450 | Bacteria | 637 |
| 396 | Ga0451804_1119475 | 3300041463 | Bacteria | 618 |
| 397 | Ga0451843_0715407 | 3300041509 | Bacteria | 728 |
| 398 | Ga0439441_104615 | 3300042001 | Bacteria | 638 |
| 399 | Ga0451577_0022276 | 3300042876 | Bacteria | 5785 |
| 400 | Ga0451577_0279088 | 3300042876 | Bacteria | 1513 |
| 401 | Ga0451577_0335525 | 3300042876 | Bacteria | 1371 |
| 402 | Ga0466972_0001665 | 3300044658 | Bacteria | 10868 |
| 403 | Ga0466965_0186806 | 3300044683 | Bacteria | 1095 |
| 404 | Ga0453684_0035312 | 3300044712 | Bacteria | 6913 |
| 405 | Ga0453684_0764850 | 3300044712 | Bacteria | 1044 |
| 406 | Ga0466970_0005725 | 3300044765 | Bacteria | 6175 |
| 407 | Ga0466960_0002003 | 3300044901 | Bacteria | 7561 |
| 408 | Ga0451576_1011184 | 3300045051 | Bacteria | 871 |
| 409 | Ga0495607_0019656 | 3300046501 | Bacteria | 4286 |
| 410 | Ga0495628_0007266 | 3300046516 | Bacteria | 9595 |
| 411 | Ga0495630_0061512 | 3300046517 | Bacteria | 2819 |
| 412 | Ga0495663_0000453 | 3300046525 | Bacteria | 15016 |
| 413 | Ga0495586_0008975 | 3300046535 | Bacteria | 5321 |
| 414 | Ga0495598_0000091 | 3300046537 | Bacteria | 14636 |
| 415 | Ga0495621_0000163 | 3300046539 | Bacteria | 14912 |
| 416 | Ga0495634_0088614 | 3300046642 | Bacteria | 2012 |
| 417 | Ga0495599_0070158 | 3300046678 | Bacteria | 2187 |
| 418 | Ga0495670_0390107 | 3300046691 | Bacteria | 752 |
| 419 | Ga0495636_0004660 | 3300047318 | Bacteria | 5378 |
| 420 | Ga0495674_0005575 | 3300047319 | Bacteria | 12067 |
| 421 | Ga0495672_0006846 | 3300047320 | Bacteria | 8704 |
| 422 | Ga0495684_0021130 | 3300047471 | Bacteria | 5015 |
| 423 | Ga0495684_0267135 | 3300047471 | Bacteria | 1239 |
| 424 | Ga0495615_0162996 | 3300048090 | Bacteria | 670 |
| 425 | Ga0496101_0120527 | 3300048904 | Unclassified | 1983 |
| 426 | Ga0496103_0266791 | 3300048906 | Bacteria | 1101 |
| 427 | Ga0496104_0570473 | 3300048907 | Bacteria | 1042 |
| 428 | Ga0496107_0532032 | 3300048910 | Bacteria | 871 |
| 429 | Ga0496108_0185944 | 3300048911 | Bacteria | 1800 |
| 430 | Ga0496109_0015254 | 3300048912 | Bacteria | 6690 |
| 431 | Ga0496109_0122696 | 3300048912 | Bacteria | 2421 |
| 432 | Ga0496109_0238027 | 3300048912 | Bacteria | 1713 |
| 433 | Ga0496110_0067624 | 3300048913 | Bacteria | 3162 |
| 434 | Ga0496110_0182458 | 3300048913 | Bacteria | 1906 |
| 435 | Ga0496112_0486006 | 3300048915 | Bacteria | 1171 |
| 436 | Ga0496113_0259178 | 3300048916 | Bacteria | 1389 |
| 437 | Ga0496113_0283461 | 3300048916 | Bacteria | 1325 |
| 438 | Ga0501292_043533 | 3300049515 | Bacteria | 781 |
| 439 | Ga0501292_059774 | 3300049515 | Bacteria | 690 |
| 440 | Ga0501036_0044709 | 3300049572 | Bacteria | 3752 |
| 441 | Ga0501040_0103368 | 3300049576 | Bacteria | 1989 |
| 442 | Ga0501041_0042731 | 3300049577 | Bacteria | 2755 |
| 443 | Ga0501042_0245760 | 3300049578 | Bacteria | 1291 |
| 444 | Ga0501048_0025190 | 3300049582 | Bacteria | 4336 |
| 445 | Ga0501067_0000953 | 3300049583 | Bacteria | 15496 |
| 446 | Ga0501072_0293392 | 3300049588 | Bacteria | 1293 |
| 447 | Ga0501072_1499401 | 3300049588 | Bacteria | 521 |
| 448 | Ga0501073_0015295 | 3300049589 | Bacteria | 5564 |
| 449 | Ga0501075_0440401 | 3300049591 | Unclassified | 994 |
| 450 | Ga0501076_0005699 | 3300049592 | Bacteria | 8982 |
| 451 | Ga0501077_0826578 | 3300049593 | Bacteria | 596 |
| 452 | Ga0501209_124033 | 3300049656 | Bacteria | 768 |
| 453 | Ga0501224_013541 | 3300049664 | Bacteria | 1205 |
| 454 | Ga0501224_085191 | 3300049664 | Bacteria | 507 |
| 455 | Ga0501233_050989 | 3300049668 | Bacteria | 1002 |
| 456 | Ga0501235_073882 | 3300049669 | Bacteria | 809 |
| 457 | Ga0501235_132271 | 3300049669 | Bacteria | 632 |
| 458 | Ga0501235_162646 | 3300049669 | Bacteria | 585 |
| 459 | Ga0501243_135385 | 3300049675 | Unclassified | 517 |
| 460 | Ga0501248_005350 | 3300049678 | Bacteria | 1007 |
| 461 | Ga0501249_003610 | 3300049679 | Bacteria | 3114 |
| 462 | Ga0501257_007050 | 3300049686 | Bacteria | 2505 |
| 463 | Ga0501259_054134 | 3300049688 | Bacteria | 822 |
| 464 | Ga0501219_008541 | 3300049703 | Bacteria | 750 |
| 465 | Ga0501221_009345 | 3300049704 | Bacteria | 1720 |
| 466 | Ga0501079_0629964 | 3300049741 | Bacteria | 844 |
| 467 | Ga0501083_1073306 | 3300049744 | Unclassified | 524 |
| 468 | Ga0501270_000837 | 3300049767 | Bacteria | 2781 |
| 469 | Ga0501272_002131 | 3300049769 | Bacteria | 1947 |
| 470 | Ga0501273_001165 | 3300049770 | Bacteria | 2424 |
| 471 | nmdc:mga03683_2448_c1 | 3300050489 | Bacteria | 5765 |
| 472 | nmdc:mga03n38_30403_c1 | 3300050490 | Bacteria | 2270 |
| 473 | nmdc:mga0yw44_339809_c1 | 3300050492 | Bacteria | 1010 |
| 474 | nmdc:mga0k408_1673_c1 | 3300050493 | Bacteria | 11970 |
| 475 | nmdc:mga06z11_2949_c1 | 3300050494 | Bacteria | 6552 |
| 476 | nmdc:mga04h51_96103_c1 | 3300050495 | Bacteria | 1073 |
| 477 | nmdc:mga04h51_9615_c1 | 3300050495 | Unclassified | 2629 |
| 478 | nmdc:mga07m45_373662_c1 | 3300050496 | Unclassified | 828 |
| 479 | nmdc:mga05p37_693918_c1 | 3300050507 | Bacteria | 1132 |
| 480 | nmdc:mga09592_409997_c1 | 3300050508 | Bacteria | 1171 |
| 481 | nmdc:mga09592_948080_c1 | 3300050508 | Unclassified | 721 |
| 482 | nmdc:mga0qj67_26271_c1 | 3300050509 | Bacteria | 4507 |
| 483 | nmdc:mga0qj67_673843_c1 | 3300050509 | Bacteria | 824 |
| 484 | nmdc:mga0qj67_80814_c1 | 3300050509 | Bacteria | 2605 |
| 485 | nmdc:mga06r32_51065_c1 | 3300050510 | Bacteria | 3957 |
| 486 | nmdc:mga08y16_122_c1 | 3300050511 | Bacteria | 67305 |
| 487 | nmdc:mga08y16_5289_c1 | 3300050511 | Bacteria | 13497 |
| 488 | nmdc:mga08y16_781514_c1 | 3300050511 | Bacteria | 949 |
| 489 | nmdc:mga0n895_2041112_c1 | 3300050512 | Unclassified | 531 |
| 490 | nmdc:mga0rr50_736205_c1 | 3300050513 | Bacteria | 841 |
| 491 | nmdc:mga0a205_360479_c1 | 3300050515 | Bacteria | 1320 |
| 492 | nmdc:mga0a205_455565_c1 | 3300050515 | Bacteria | 1139 |
| 493 | nmdc:mga0a205_607789_c1 | 3300050515 | Unclassified | 946 |
| 494 | nmdc:mga0a205_659341_c1 | 3300050515 | Bacteria | 897 |
| 495 | nmdc:mga0a205_801438_c1 | 3300050515 | Bacteria | 790 |
| 496 | Ga0495601_0046681 | 3300053077 | Bacteria | 2726 |
| 497 | Ga0500658_0093189 | 3300053134 | Bacteria | 1306 |
| 498 | Ga0500622_0005971 | 3300053156 | Bacteria | 7166 |
| 499 | Ga0500622_0093379 | 3300053156 | Bacteria | 1490 |
| 500 | Ga0500637_0002574 | 3300053178 | Bacteria | 8104 |
| 501 | Ga0501084_0279871 | 3300054114 | Bacteria | 1409 |
| 502 | Ga0501084_0400088 | 3300054114 | Bacteria | 1161 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10488508 | Ga0114129_104885081 | 125 |
| 2 | 3300050507 | nmdc:mga05p37_693918_c1 | nmdc:mga05p37_693918_c1_269_646 | 125 |
| 3 | 3300005719 | Ga0068861_100000562 | Ga0068861_10000056218 | 129 |
| 4 | 3300005842 | Ga0068858_100072795 | Ga0068858_1000727954 | 129 |
| 5 | 3300009553 | Ga0105249_13332304 | Ga0105249_133323041 | 129 |
| 6 | 3300026035 | Ga0207703_10146389 | Ga0207703_101463893 | 129 |
| 7 | 3300026118 | Ga0207675_100003665 | Ga0207675_10000366513 | 129 |
| 8 | 3300005844 | Ga0068862_100073311 | Ga0068862_1000733112 | 130 |
| 9 | 3300009551 | Ga0105238_10060496 | Ga0105238_100604962 | 130 |
| 10 | 3300009553 | Ga0105249_10015546 | Ga0105249_100155467 | 130 |
| 11 | 3300003794 | Ga0055531_10027319 | Ga0055531_100273193 | 133 |
| 12 | 3300005333 | Ga0070677_10469521 | Ga0070677_104695211 | 133 |
| 13 | 3300005364 | Ga0070673_101273217 | Ga0070673_1012732172 | 133 |
| 14 | 3300005539 | Ga0068853_100603510 | Ga0068853_1006035102 | 133 |
| 15 | 3300005617 | Ga0068859_101049271 | Ga0068859_1010492712 | 133 |
| 16 | 3300005834 | Ga0068851_10613007 | Ga0068851_106130071 | 133 |
| 17 | 3300005840 | Ga0068870_10363494 | Ga0068870_103634942 | 133 |
| 18 | 3300006852 | Ga0075433_10502713 | Ga0075433_105027132 | 133 |
| 19 | 3300006931 | Ga0097620_101049334 | Ga0097620_1010493342 | 133 |
| 20 | 3300013102 | Ga0157371_10557383 | Ga0157371_105573832 | 133 |
| 21 | 3300013105 | Ga0157369_10630962 | Ga0157369_106309622 | 133 |
| 22 | 3300013297 | Ga0157378_12540884 | Ga0157378_125408841 | 133 |
| 23 | 3300013307 | Ga0157372_10681806 | Ga0157372_106818062 | 133 |
| 24 | 3300014326 | Ga0157380_10048913 | Ga0157380_100489132 | 133 |
| 25 | 3300025304 | Ga0209257_1000437 | Ga0209257_100043758 | 133 |
| 26 | 3300025907 | Ga0207645_10192595 | Ga0207645_101925952 | 133 |
| 27 | 3300025908 | Ga0207643_10088663 | Ga0207643_100886633 | 133 |
| 28 | 3300025944 | Ga0207661_11169489 | Ga0207661_111694891 | 133 |
| 29 | 3300025960 | Ga0207651_11378682 | Ga0207651_113786822 | 133 |
| 30 | 3300025981 | Ga0207640_10196049 | Ga0207640_101960492 | 133 |
| 31 | 3300031731 | Ga0307405_10019518 | Ga0307405_100195189 | 133 |
| 32 | 3300031824 | Ga0307413_10170852 | Ga0307413_101708523 | 133 |
| 33 | 3300031824 | Ga0307413_10919382 | Ga0307413_109193821 | 133 |
| 34 | 3300031852 | Ga0307410_10019234 | Ga0307410_100192349 | 133 |
| 35 | 3300031901 | Ga0307406_10012030 | Ga0307406_100120307 | 133 |
| 36 | 3300031901 | Ga0307406_10803779 | Ga0307406_108037792 | 133 |
| 37 | 3300031903 | Ga0307407_10149132 | Ga0307407_101491324 | 133 |
| 38 | 3300031995 | Ga0307409_100459574 | Ga0307409_1004595742 | 133 |
| 39 | 3300032002 | Ga0307416_100239706 | Ga0307416_1002397064 | 133 |
| 40 | 3300032004 | Ga0307414_10084730 | Ga0307414_100847305 | 133 |
| 41 | 3300032005 | Ga0307411_10003392 | Ga0307411_100033925 | 133 |
| 42 | 3300032005 | Ga0307411_10874392 | Ga0307411_108743921 | 133 |
| 43 | 3300032126 | Ga0307415_100007314 | Ga0307415_10000731410 | 133 |
| 44 | 3300037418 | Ga0395900_0041747 | Ga0395900_0041747_2186_2587 | 133 |
| 45 | 3300037471 | Ga0395905_0015900 | Ga0395905_0015900_2380_2781 | 133 |
| 46 | 3300038443 | Ga0395901_1458318 | Ga0395901_1458318_57_458 | 133 |
| 47 | 3300039437 | Ga0436365_1926687 | Ga0436365_1926687_1736_2137 | 133 |
| 48 | 3300039438 | Ga0436360_1040944 | Ga0436360_1040944_110_511 | 133 |
| 49 | 3300042001 | Ga0439441_104615 | Ga0439441_104615_117_518 | 133 |
| 50 | 3300049515 | Ga0501292_043533 | Ga0501292_043533_54_455 | 133 |
| 51 | 3300049583 | Ga0501067_0000953 | Ga0501067_0000953_6229_6630 | 133 |
| 52 | 3300049589 | Ga0501073_0015295 | Ga0501073_0015295_3101_3502 | 133 |
| 53 | 3300049664 | Ga0501224_013541 | Ga0501224_013541_612_1013 | 133 |
| 54 | 3300049669 | Ga0501235_073882 | Ga0501235_073882_343_744 | 133 |
| 55 | 3300049669 | Ga0501235_132271 | Ga0501235_132271_29_430 | 133 |
| 56 | 3300049678 | Ga0501248_005350 | Ga0501248_005350_542_943 | 133 |
| 57 | 3300049679 | Ga0501249_003610 | Ga0501249_003610_1202_1603 | 133 |
| 58 | 3300049686 | Ga0501257_007050 | Ga0501257_007050_2013_2414 | 133 |
| 59 | 3300049688 | Ga0501259_054134 | Ga0501259_054134_268_669 | 133 |
| 60 | 3300049703 | Ga0501219_008541 | Ga0501219_008541_324_725 | 133 |
| 61 | 3300049704 | Ga0501221_009345 | Ga0501221_009345_1202_1603 | 133 |
| 62 | 3300049767 | Ga0501270_000837 | Ga0501270_000837_2136_2537 | 133 |
| 63 | 3300049769 | Ga0501272_002131 | Ga0501272_002131_1235_1636 | 133 |
| 64 | 3300049770 | Ga0501273_001165 | Ga0501273_001165_150_551 | 133 |
| 65 | 3300050508 | nmdc:mga09592_948080_c1 | nmdc:mga09592_948080_c1_181_585 | 133 |
| 66 | 3300050515 | nmdc:mga0a205_455565_c1 | nmdc:mga0a205_455565_c1_511_918 | 133 |
| 67 | 3300003320 | rootH2_10062662 | rootH2_100626622 | 134 |
| 68 | 3300004799 | Ga0058863_11441775 | Ga0058863_114417751 | 134 |
| 69 | 3300005288 | Ga0065714_10148579 | Ga0065714_101485793 | 134 |
| 70 | 3300005289 | Ga0065704_10035083 | Ga0065704_100350831 | 134 |
| 71 | 3300005289 | Ga0065704_10355072 | Ga0065704_103550721 | 134 |
| 72 | 3300005290 | Ga0065712_10068047 | Ga0065712_100680475 | 134 |
| 73 | 3300005290 | Ga0065712_10239804 | Ga0065712_102398041 | 134 |
| 74 | 3300005293 | Ga0065715_10099278 | Ga0065715_100992783 | 134 |
| 75 | 3300005293 | Ga0065715_10217048 | Ga0065715_102170482 | 134 |
| 76 | 3300005295 | Ga0065707_10088575 | Ga0065707_100885752 | 134 |
| 77 | 3300005327 | Ga0070658_10004673 | Ga0070658_1000467314 | 134 |
| 78 | 3300005327 | Ga0070658_10061896 | Ga0070658_100618962 | 134 |
| 79 | 3300005327 | Ga0070658_10134783 | Ga0070658_101347832 | 134 |
| 80 | 3300005328 | Ga0070676_11067136 | Ga0070676_110671361 | 134 |
| 81 | 3300005330 | Ga0070690_100005509 | Ga0070690_1000055094 | 134 |
| 82 | 3300005330 | Ga0070690_100007704 | Ga0070690_1000077046 | 134 |
| 83 | 3300005330 | Ga0070690_100461592 | Ga0070690_1004615922 | 134 |
| 84 | 3300005331 | Ga0070670_100025220 | Ga0070670_1000252204 | 134 |
| 85 | 3300005331 | Ga0070670_101106628 | Ga0070670_1011066282 | 134 |
| 86 | 3300005334 | Ga0068869_100014103 | Ga0068869_1000141033 | 134 |
| 87 | 3300005334 | Ga0068869_100080243 | Ga0068869_1000802431 | 134 |
| 88 | 3300005334 | Ga0068869_100744253 | Ga0068869_1007442532 | 134 |
| 89 | 3300005335 | Ga0070666_10000767 | Ga0070666_100007672 | 134 |
| 90 | 3300005335 | Ga0070666_10002699 | Ga0070666_1000269910 | 134 |
| 91 | 3300005335 | Ga0070666_10601297 | Ga0070666_106012972 | 134 |
| 92 | 3300005338 | Ga0068868_100002891 | Ga0068868_1000028916 | 134 |
| 93 | 3300005338 | Ga0068868_100578712 | Ga0068868_1005787121 | 134 |
| 94 | 3300005339 | Ga0070660_100000214 | Ga0070660_1000002142 | 134 |
| 95 | 3300005340 | Ga0070689_100003324 | Ga0070689_1000033246 | 134 |
| 96 | 3300005340 | Ga0070689_100016977 | Ga0070689_1000169778 | 134 |
| 97 | 3300005340 | Ga0070689_100638925 | Ga0070689_1006389252 | 134 |
| 98 | 3300005341 | Ga0070691_10018421 | Ga0070691_100184212 | 134 |
| 99 | 3300005343 | Ga0070687_100000241 | Ga0070687_1000002419 | 134 |
| 100 | 3300005344 | Ga0070661_100291351 | Ga0070661_1002913513 | 134 |
| 101 | 3300005344 | Ga0070661_100954738 | Ga0070661_1009547381 | 134 |
| 102 | 3300005345 | Ga0070692_10290024 | Ga0070692_102900243 | 134 |
| 103 | 3300005345 | Ga0070692_11162073 | Ga0070692_111620731 | 134 |
| 104 | 3300005353 | Ga0070669_100013220 | Ga0070669_1000132206 | 134 |
| 105 | 3300005353 | Ga0070669_100085492 | Ga0070669_1000854922 | 134 |
| 106 | 3300005353 | Ga0070669_100354866 | Ga0070669_1003548661 | 134 |
| 107 | 3300005354 | Ga0070675_100003764 | Ga0070675_10000376410 | 134 |
| 108 | 3300005354 | Ga0070675_100388693 | Ga0070675_1003886932 | 134 |
| 109 | 3300005355 | Ga0070671_100001794 | Ga0070671_10000179411 | 134 |
| 110 | 3300005355 | Ga0070671_100001940 | Ga0070671_10000194011 | 134 |
| 111 | 3300005355 | Ga0070671_101499379 | Ga0070671_1014993791 | 134 |
| 112 | 3300005364 | Ga0070673_100043700 | Ga0070673_1000437003 | 134 |
| 113 | 3300005364 | Ga0070673_100512093 | Ga0070673_1005120932 | 134 |
| 114 | 3300005364 | Ga0070673_100572870 | Ga0070673_1005728702 | 134 |
| 115 | 3300005364 | Ga0070673_100801891 | Ga0070673_1008018912 | 134 |
| 116 | 3300005365 | Ga0070688_100000389 | Ga0070688_1000003892 | 134 |
| 117 | 3300005365 | Ga0070688_100002574 | Ga0070688_1000025742 | 134 |
| 118 | 3300005366 | Ga0070659_100001202 | Ga0070659_10000120212 | 134 |
| 119 | 3300005366 | Ga0070659_100282771 | Ga0070659_1002827712 | 134 |
| 120 | 3300005367 | Ga0070667_100216359 | Ga0070667_1002163594 | 134 |
| 121 | 3300005367 | Ga0070667_101422651 | Ga0070667_1014226512 | 134 |
| 122 | 3300005367 | Ga0070667_101493685 | Ga0070667_1014936851 | 134 |
| 123 | 3300005440 | Ga0070705_100014731 | Ga0070705_1000147313 | 134 |
| 124 | 3300005441 | Ga0070700_100000056 | Ga0070700_10000005617 | 134 |
| 125 | 3300005441 | Ga0070700_100384520 | Ga0070700_1003845202 | 134 |
| 126 | 3300005456 | Ga0070678_100050133 | Ga0070678_1000501332 | 134 |
| 127 | 3300005457 | Ga0070662_100001196 | Ga0070662_1000011962 | 134 |
| 128 | 3300005457 | Ga0070662_100007301 | Ga0070662_1000073018 | 134 |
| 129 | 3300005457 | Ga0070662_100669477 | Ga0070662_1006694771 | 134 |
| 130 | 3300005457 | Ga0070662_101301249 | Ga0070662_1013012491 | 134 |
| 131 | 3300005458 | Ga0070681_10237887 | Ga0070681_102378872 | 134 |
| 132 | 3300005459 | Ga0068867_100007657 | Ga0068867_1000076573 | 134 |
| 133 | 3300005459 | Ga0068867_100011658 | Ga0068867_1000116586 | 134 |
| 134 | 3300005466 | Ga0070685_10354947 | Ga0070685_103549471 | 134 |
| 135 | 3300005468 | Ga0070707_100009815 | Ga0070707_1000098157 | 134 |
| 136 | 3300005518 | Ga0070699_100408909 | Ga0070699_1004089092 | 134 |
| 137 | 3300005530 | Ga0070679_101537795 | Ga0070679_1015377951 | 134 |
| 138 | 3300005535 | Ga0070684_100045803 | Ga0070684_1000458034 | 134 |
| 139 | 3300005535 | Ga0070684_100063589 | Ga0070684_1000635892 | 134 |
| 140 | 3300005536 | Ga0070697_100006709 | Ga0070697_1000067099 | 134 |
| 141 | 3300005543 | Ga0070672_100051268 | Ga0070672_1000512683 | 134 |
| 142 | 3300005543 | Ga0070672_100707880 | Ga0070672_1007078802 | 134 |
| 143 | 3300005544 | Ga0070686_100019907 | Ga0070686_1000199072 | 134 |
| 144 | 3300005545 | Ga0070695_100090724 | Ga0070695_1000907244 | 134 |
| 145 | 3300005545 | Ga0070695_100120119 | Ga0070695_1001201193 | 134 |
| 146 | 3300005546 | Ga0070696_100294029 | Ga0070696_1002940293 | 134 |
| 147 | 3300005547 | Ga0070693_100000641 | Ga0070693_1000006416 | 134 |
| 148 | 3300005548 | Ga0070665_100001521 | Ga0070665_10000152113 | 134 |
| 149 | 3300005548 | Ga0070665_100038653 | Ga0070665_1000386535 | 134 |
| 150 | 3300005548 | Ga0070665_101114833 | Ga0070665_1011148332 | 134 |
| 151 | 3300005564 | Ga0070664_100005842 | Ga0070664_1000058423 | 134 |
| 152 | 3300005564 | Ga0070664_100011822 | Ga0070664_1000118226 | 134 |
| 153 | 3300005564 | Ga0070664_101330394 | Ga0070664_1013303942 | 134 |
| 154 | 3300005577 | Ga0068857_100001753 | Ga0068857_1000017532 | 134 |
| 155 | 3300005577 | Ga0068857_100436290 | Ga0068857_1004362902 | 134 |
| 156 | 3300005577 | Ga0068857_100672004 | Ga0068857_1006720042 | 134 |
| 157 | 3300005578 | Ga0068854_100011914 | Ga0068854_1000119144 | 134 |
| 158 | 3300005615 | Ga0070702_100111708 | Ga0070702_1001117082 | 134 |
| 159 | 3300005615 | Ga0070702_100646871 | Ga0070702_1006468712 | 134 |
| 160 | 3300005615 | Ga0070702_100754426 | Ga0070702_1007544262 | 134 |
| 161 | 3300005616 | Ga0068852_100112794 | Ga0068852_1001127941 | 134 |
| 162 | 3300005616 | Ga0068852_100227558 | Ga0068852_1002275582 | 134 |
| 163 | 3300005617 | Ga0068859_100019498 | Ga0068859_1000194987 | 134 |
| 164 | 3300005617 | Ga0068859_100245698 | Ga0068859_1002456981 | 134 |
| 165 | 3300005617 | Ga0068859_101968757 | Ga0068859_1019687571 | 134 |
| 166 | 3300005618 | Ga0068864_100004004 | Ga0068864_10000400415 | 134 |
| 167 | 3300005618 | Ga0068864_100107192 | Ga0068864_1001071923 | 134 |
| 168 | 3300005618 | Ga0068864_100657637 | Ga0068864_1006576372 | 134 |
| 169 | 3300005618 | Ga0068864_101223437 | Ga0068864_1012234372 | 134 |
| 170 | 3300005718 | Ga0068866_10006018 | Ga0068866_100060182 | 134 |
| 171 | 3300005718 | Ga0068866_10090536 | Ga0068866_100905362 | 134 |
| 172 | 3300005719 | Ga0068861_100000577 | Ga0068861_1000005772 | 134 |
| 173 | 3300005719 | Ga0068861_100032990 | Ga0068861_1000329903 | 134 |
| 174 | 3300005719 | Ga0068861_100095663 | Ga0068861_1000956632 | 134 |
| 175 | 3300005719 | Ga0068861_101011232 | Ga0068861_1010112322 | 134 |
| 176 | 3300005834 | Ga0068851_10001093 | Ga0068851_100010931 | 134 |
| 177 | 3300005840 | Ga0068870_10011516 | Ga0068870_100115167 | 134 |
| 178 | 3300005840 | Ga0068870_10413006 | Ga0068870_104130062 | 134 |
| 179 | 3300005841 | Ga0068863_100003717 | Ga0068863_10000371717 | 134 |
| 180 | 3300005841 | Ga0068863_100007517 | Ga0068863_1000075176 | 134 |
| 181 | 3300005841 | Ga0068863_100053869 | Ga0068863_1000538693 | 134 |
| 182 | 3300005841 | Ga0068863_100233295 | Ga0068863_1002332952 | 134 |
| 183 | 3300005841 | Ga0068863_100621813 | Ga0068863_1006218131 | 134 |
| 184 | 3300005841 | Ga0068863_100749024 | Ga0068863_1007490242 | 134 |
| 185 | 3300005841 | Ga0068863_100783729 | Ga0068863_1007837292 | 134 |
| 186 | 3300005842 | Ga0068858_100006090 | Ga0068858_10000609012 | 134 |
| 187 | 3300005843 | Ga0068860_100174934 | Ga0068860_1001749345 | 134 |
| 188 | 3300005843 | Ga0068860_100307078 | Ga0068860_1003070782 | 134 |
| 189 | 3300005843 | Ga0068860_100554758 | Ga0068860_1005547582 | 134 |
| 190 | 3300005843 | Ga0068860_101092584 | Ga0068860_1010925841 | 134 |
| 191 | 3300005844 | Ga0068862_100029895 | Ga0068862_1000298955 | 134 |
| 192 | 3300005844 | Ga0068862_100046498 | Ga0068862_1000464982 | 134 |
| 193 | 3300005844 | Ga0068862_100359943 | Ga0068862_1003599433 | 134 |
| 194 | 3300005844 | Ga0068862_100547847 | Ga0068862_1005478472 | 134 |
| 195 | 3300005844 | Ga0068862_101207915 | Ga0068862_1012079152 | 134 |
| 196 | 3300005985 | Ga0081539_10035507 | Ga0081539_100355073 | 134 |
| 197 | 3300006042 | Ga0075368_10037190 | Ga0075368_100371903 | 134 |
| 198 | 3300006042 | Ga0075368_10184516 | Ga0075368_101845161 | 134 |
| 199 | 3300006051 | Ga0075364_10002052 | Ga0075364_100020523 | 134 |
| 200 | 3300006177 | Ga0075362_10020965 | Ga0075362_100209653 | 134 |
| 201 | 3300006178 | Ga0075367_10024806 | Ga0075367_100248066 | 134 |
| 202 | 3300006178 | Ga0075367_10312786 | Ga0075367_103127863 | 134 |
| 203 | 3300006195 | Ga0075366_10000302 | Ga0075366_100003028 | 134 |
| 204 | 3300006195 | Ga0075366_10979768 | Ga0075366_109797681 | 134 |
| 205 | 3300006237 | Ga0097621_100010243 | Ga0097621_1000102432 | 134 |
| 206 | 3300006237 | Ga0097621_100229527 | Ga0097621_1002295274 | 134 |
| 207 | 3300006353 | Ga0075370_10397198 | Ga0075370_103971982 | 134 |
| 208 | 3300006844 | Ga0075428_100018514 | Ga0075428_1000185142 | 134 |
| 209 | 3300006844 | Ga0075428_100959448 | Ga0075428_1009594482 | 134 |
| 210 | 3300006846 | Ga0075430_100010623 | Ga0075430_1000106233 | 134 |
| 211 | 3300006846 | Ga0075430_100217121 | Ga0075430_1002171212 | 134 |
| 212 | 3300006846 | Ga0075430_100316383 | Ga0075430_1003163832 | 134 |
| 213 | 3300006846 | Ga0075430_100494073 | Ga0075430_1004940732 | 134 |
| 214 | 3300006847 | Ga0075431_100225523 | Ga0075431_1002255232 | 134 |
| 215 | 3300006852 | Ga0075433_10568376 | Ga0075433_105683761 | 134 |
| 216 | 3300006852 | Ga0075433_10611119 | Ga0075433_106111192 | 134 |
| 217 | 3300006880 | Ga0075429_100036497 | Ga0075429_1000364972 | 134 |
| 218 | 3300006880 | Ga0075429_100587891 | Ga0075429_1005878911 | 134 |
| 219 | 3300006881 | Ga0068865_100261583 | Ga0068865_1002615832 | 134 |
| 220 | 3300006881 | Ga0068865_100938012 | Ga0068865_1009380122 | 134 |
| 221 | 3300006931 | Ga0097620_100019499 | Ga0097620_1000194994 | 134 |
| 222 | 3300006931 | Ga0097620_100245694 | Ga0097620_1002456941 | 134 |
| 223 | 3300006931 | Ga0097620_101969479 | Ga0097620_1019694791 | 134 |
| 224 | 3300007076 | Ga0075435_100496256 | Ga0075435_1004962562 | 134 |
| 225 | 3300009093 | Ga0105240_10040933 | Ga0105240_100409334 | 134 |
| 226 | 3300009093 | Ga0105240_10965091 | Ga0105240_109650912 | 134 |
| 227 | 3300009094 | Ga0111539_10000099 | Ga0111539_100000998 | 134 |
| 228 | 3300009094 | Ga0111539_10116058 | Ga0111539_101160582 | 134 |
| 229 | 3300009094 | Ga0111539_10117917 | Ga0111539_101179173 | 134 |
| 230 | 3300009098 | Ga0105245_10000641 | Ga0105245_100006418 | 134 |
| 231 | 3300009098 | Ga0105245_12073518 | Ga0105245_120735181 | 134 |
| 232 | 3300009101 | Ga0105247_10018198 | Ga0105247_100181986 | 134 |
| 233 | 3300009148 | Ga0105243_10077148 | Ga0105243_100771482 | 134 |
| 234 | 3300009148 | Ga0105243_10413777 | Ga0105243_104137773 | 134 |
| 235 | 3300009148 | Ga0105243_10899161 | Ga0105243_108991611 | 134 |
| 236 | 3300009174 | Ga0105241_10006878 | Ga0105241_100068782 | 134 |
| 237 | 3300009174 | Ga0105241_10250572 | Ga0105241_102505722 | 134 |
| 238 | 3300009174 | Ga0105241_10341937 | Ga0105241_103419371 | 134 |
| 239 | 3300009174 | Ga0105241_10834505 | Ga0105241_108345052 | 134 |
| 240 | 3300009176 | Ga0105242_10080633 | Ga0105242_100806332 | 134 |
| 241 | 3300009176 | Ga0105242_10106875 | Ga0105242_101068752 | 134 |
| 242 | 3300009176 | Ga0105242_10425444 | Ga0105242_104254442 | 134 |
| 243 | 3300009177 | Ga0105248_10005072 | Ga0105248_100050725 | 134 |
| 244 | 3300009545 | Ga0105237_10626263 | Ga0105237_106262632 | 134 |
| 245 | 3300009553 | Ga0105249_10001405 | Ga0105249_1000140514 | 134 |
| 246 | 3300009553 | Ga0105249_10049294 | Ga0105249_100492942 | 134 |
| 247 | 3300009553 | Ga0105249_10067053 | Ga0105249_100670531 | 134 |
| 248 | 3300009553 | Ga0105249_10102115 | Ga0105249_101021153 | 134 |
| 249 | 3300010375 | Ga0105239_10613032 | Ga0105239_106130322 | 134 |
| 250 | 3300010375 | Ga0105239_12748558 | Ga0105239_127485581 | 134 |
| 251 | 3300010375 | Ga0105239_13427710 | Ga0105239_134277101 | 134 |
| 252 | 3300011119 | Ga0105246_10069060 | Ga0105246_100690604 | 134 |
| 253 | 3300013105 | Ga0157369_10002451 | Ga0157369_100024511 | 134 |
| 254 | 3300013105 | Ga0157369_10490476 | Ga0157369_104904762 | 134 |
| 255 | 3300013296 | Ga0157374_10233982 | Ga0157374_102339822 | 134 |
| 256 | 3300013296 | Ga0157374_10456119 | Ga0157374_104561192 | 134 |
| 257 | 3300013297 | Ga0157378_10002122 | Ga0157378_1000212214 | 134 |
| 258 | 3300013297 | Ga0157378_10302074 | Ga0157378_103020742 | 134 |
| 259 | 3300013306 | Ga0163162_10205427 | Ga0163162_102054273 | 134 |
| 260 | 3300013307 | Ga0157372_10012458 | Ga0157372_100124588 | 134 |
| 261 | 3300014325 | Ga0163163_10009152 | Ga0163163_100091522 | 134 |
| 262 | 3300014326 | Ga0157380_10028565 | Ga0157380_100285651 | 134 |
| 263 | 3300014326 | Ga0157380_11168861 | Ga0157380_111688611 | 134 |
| 264 | 3300014745 | Ga0157377_10003883 | Ga0157377_1000388310 | 134 |
| 265 | 3300014968 | Ga0157379_10007314 | Ga0157379_100073149 | 134 |
| 266 | 3300014968 | Ga0157379_10127139 | Ga0157379_101271392 | 134 |
| 267 | 3300014968 | Ga0157379_10836552 | Ga0157379_108365522 | 134 |
| 268 | 3300014969 | Ga0157376_10210208 | Ga0157376_102102082 | 134 |
| 269 | 3300017792 | Ga0163161_11202889 | Ga0163161_112028891 | 134 |
| 270 | 3300021384 | Ga0213876_10000024 | Ga0213876_10000024111 | 134 |
| 271 | 3300025315 | Ga0207697_10001765 | Ga0207697_100017659 | 134 |
| 272 | 3300025321 | Ga0207656_10045092 | Ga0207656_100450922 | 134 |
| 273 | 3300025899 | Ga0207642_10036617 | Ga0207642_100366173 | 134 |
| 274 | 3300025900 | Ga0207710_10781921 | Ga0207710_107819211 | 134 |
| 275 | 3300025901 | Ga0207688_10000450 | Ga0207688_1000045010 | 134 |
| 276 | 3300025901 | Ga0207688_10014280 | Ga0207688_100142803 | 134 |
| 277 | 3300025903 | Ga0207680_10005230 | Ga0207680_100052303 | 134 |
| 278 | 3300025903 | Ga0207680_10578044 | Ga0207680_105780442 | 134 |
| 279 | 3300025904 | Ga0207647_10000019 | Ga0207647_1000001953 | 134 |
| 280 | 3300025904 | Ga0207647_10597039 | Ga0207647_105970392 | 134 |
| 281 | 3300025907 | Ga0207645_10001166 | Ga0207645_1000116614 | 134 |
| 282 | 3300025907 | Ga0207645_10720596 | Ga0207645_107205961 | 134 |
| 283 | 3300025908 | Ga0207643_10000113 | Ga0207643_100001139 | 134 |
| 284 | 3300025908 | Ga0207643_10667954 | Ga0207643_106679541 | 134 |
| 285 | 3300025909 | Ga0207705_10006527 | Ga0207705_100065272 | 134 |
| 286 | 3300025909 | Ga0207705_10027757 | Ga0207705_100277574 | 134 |
| 287 | 3300025909 | Ga0207705_10078343 | Ga0207705_100783434 | 134 |
| 288 | 3300025909 | Ga0207705_11196320 | Ga0207705_111963202 | 134 |
| 289 | 3300025911 | Ga0207654_10625146 | Ga0207654_106251462 | 134 |
| 290 | 3300025911 | Ga0207654_10794695 | Ga0207654_107946951 | 134 |
| 291 | 3300025913 | Ga0207695_10030334 | Ga0207695_100303344 | 134 |
| 292 | 3300025913 | Ga0207695_10067526 | Ga0207695_100675266 | 134 |
| 293 | 3300025914 | Ga0207671_10497768 | Ga0207671_104977681 | 134 |
| 294 | 3300025919 | Ga0207657_10000059 | Ga0207657_1000005951 | 134 |
| 295 | 3300025920 | Ga0207649_10031191 | Ga0207649_100311911 | 134 |
| 296 | 3300025920 | Ga0207649_10663316 | Ga0207649_106633161 | 134 |
| 297 | 3300025921 | Ga0207652_10030302 | Ga0207652_100303023 | 134 |
| 298 | 3300025923 | Ga0207681_10031477 | Ga0207681_100314772 | 134 |
| 299 | 3300025924 | Ga0207694_10001535 | Ga0207694_1000153520 | 134 |
| 300 | 3300025925 | Ga0207650_10000514 | Ga0207650_1000051412 | 134 |
| 301 | 3300025925 | Ga0207650_10034298 | Ga0207650_100342985 | 134 |
| 302 | 3300025925 | Ga0207650_10319660 | Ga0207650_103196602 | 134 |
| 303 | 3300025926 | Ga0207659_10212343 | Ga0207659_102123433 | 134 |
| 304 | 3300025931 | Ga0207644_10005866 | Ga0207644_100058662 | 134 |
| 305 | 3300025931 | Ga0207644_10377148 | Ga0207644_103771482 | 134 |
| 306 | 3300025931 | Ga0207644_10599656 | Ga0207644_105996561 | 134 |
| 307 | 3300025932 | Ga0207690_10214456 | Ga0207690_102144561 | 134 |
| 308 | 3300025933 | Ga0207706_10001171 | Ga0207706_1000117114 | 134 |
| 309 | 3300025933 | Ga0207706_10003006 | Ga0207706_1000300613 | 134 |
| 310 | 3300025933 | Ga0207706_10027587 | Ga0207706_100275879 | 134 |
| 311 | 3300025934 | Ga0207686_10088922 | Ga0207686_100889223 | 134 |
| 312 | 3300025935 | Ga0207709_10005185 | Ga0207709_100051853 | 134 |
| 313 | 3300025936 | Ga0207670_10137445 | Ga0207670_101374453 | 134 |
| 314 | 3300025936 | Ga0207670_10188726 | Ga0207670_101887262 | 134 |
| 315 | 3300025937 | Ga0207669_10094347 | Ga0207669_100943472 | 134 |
| 316 | 3300025938 | Ga0207704_10000136 | Ga0207704_1000013623 | 134 |
| 317 | 3300025938 | Ga0207704_10105773 | Ga0207704_101057731 | 134 |
| 318 | 3300025938 | Ga0207704_10489492 | Ga0207704_104894921 | 134 |
| 319 | 3300025939 | Ga0207665_10785704 | Ga0207665_107857041 | 134 |
| 320 | 3300025940 | Ga0207691_10243695 | Ga0207691_102436952 | 134 |
| 321 | 3300025940 | Ga0207691_10590868 | Ga0207691_105908681 | 134 |
| 322 | 3300025941 | Ga0207711_10002981 | Ga0207711_1000298115 | 134 |
| 323 | 3300025941 | Ga0207711_10149157 | Ga0207711_101491571 | 134 |
| 324 | 3300025941 | Ga0207711_11103579 | Ga0207711_111035792 | 134 |
| 325 | 3300025942 | Ga0207689_10000009 | Ga0207689_1000000996 | 134 |
| 326 | 3300025942 | Ga0207689_10081879 | Ga0207689_100818792 | 134 |
| 327 | 3300025945 | Ga0207679_10001112 | Ga0207679_1000111211 | 134 |
| 328 | 3300025945 | Ga0207679_10001337 | Ga0207679_100013372 | 134 |
| 329 | 3300025945 | Ga0207679_10044140 | Ga0207679_100441404 | 134 |
| 330 | 3300025960 | Ga0207651_10160275 | Ga0207651_101602751 | 134 |
| 331 | 3300025960 | Ga0207651_11026635 | Ga0207651_110266352 | 134 |
| 332 | 3300025960 | Ga0207651_11622355 | Ga0207651_116223551 | 134 |
| 333 | 3300025961 | Ga0207712_10000601 | Ga0207712_1000060127 | 134 |
| 334 | 3300025961 | Ga0207712_10000977 | Ga0207712_100009772 | 134 |
| 335 | 3300025961 | Ga0207712_10596962 | Ga0207712_105969622 | 134 |
| 336 | 3300025972 | Ga0207668_10370134 | Ga0207668_103701341 | 134 |
| 337 | 3300025981 | Ga0207640_10006300 | Ga0207640_100063007 | 134 |
| 338 | 3300025986 | Ga0207658_10462108 | Ga0207658_104621082 | 134 |
| 339 | 3300025986 | Ga0207658_11278002 | Ga0207658_112780022 | 134 |
| 340 | 3300026023 | Ga0207677_10092834 | Ga0207677_100928343 | 134 |
| 341 | 3300026035 | Ga0207703_10000632 | Ga0207703_1000063215 | 134 |
| 342 | 3300026035 | Ga0207703_10056820 | Ga0207703_100568202 | 134 |
| 343 | 3300026035 | Ga0207703_10348106 | Ga0207703_103481062 | 134 |
| 344 | 3300026035 | Ga0207703_10982188 | Ga0207703_109821882 | 134 |
| 345 | 3300026041 | Ga0207639_10000117 | Ga0207639_1000011740 | 134 |
| 346 | 3300026067 | Ga0207678_10013247 | Ga0207678_100132476 | 134 |
| 347 | 3300026075 | Ga0207708_10000089 | Ga0207708_100000897 | 134 |
| 348 | 3300026075 | Ga0207708_10469712 | Ga0207708_104697122 | 134 |
| 349 | 3300026075 | Ga0207708_10641688 | Ga0207708_106416881 | 134 |
| 350 | 3300026078 | Ga0207702_10068161 | Ga0207702_100681613 | 134 |
| 351 | 3300026088 | Ga0207641_10001506 | Ga0207641_100015061 | 134 |
| 352 | 3300026088 | Ga0207641_10082030 | Ga0207641_100820302 | 134 |
| 353 | 3300026088 | Ga0207641_10206474 | Ga0207641_102064743 | 134 |
| 354 | 3300026088 | Ga0207641_10605499 | Ga0207641_106054991 | 134 |
| 355 | 3300026089 | Ga0207648_10007978 | Ga0207648_100079788 | 134 |
| 356 | 3300026089 | Ga0207648_10059561 | Ga0207648_100595611 | 134 |
| 357 | 3300026095 | Ga0207676_10006786 | Ga0207676_100067867 | 134 |
| 358 | 3300026095 | Ga0207676_10429802 | Ga0207676_104298023 | 134 |
| 359 | 3300026116 | Ga0207674_10000858 | Ga0207674_1000085810 | 134 |
| 360 | 3300026116 | Ga0207674_10112976 | Ga0207674_101129765 | 134 |
| 361 | 3300026118 | Ga0207675_100000005 | Ga0207675_100000005120 | 134 |
| 362 | 3300026118 | Ga0207675_100015382 | Ga0207675_10001538210 | 134 |
| 363 | 3300026118 | Ga0207675_100168584 | Ga0207675_1001685844 | 134 |
| 364 | 3300026121 | Ga0207683_10001342 | Ga0207683_1000134215 | 134 |
| 365 | 3300026121 | Ga0207683_10697643 | Ga0207683_106976431 | 134 |
| 366 | 3300026142 | Ga0207698_10055343 | Ga0207698_100553436 | 134 |
| 367 | 3300027866 | Ga0209813_10009972 | Ga0209813_100099722 | 134 |
| 368 | 3300027866 | Ga0209813_10082454 | Ga0209813_100824542 | 134 |
| 369 | 3300027907 | Ga0207428_10000201 | Ga0207428_100002019 | 134 |
| 370 | 3300027907 | Ga0207428_10016879 | Ga0207428_100168792 | 134 |
| 371 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007514 | 134 |
| 372 | 3300028379 | Ga0268266_10522972 | Ga0268266_105229722 | 134 |
| 373 | 3300028380 | Ga0268265_10030100 | Ga0268265_100301006 | 134 |
| 374 | 3300028380 | Ga0268265_10101793 | Ga0268265_101017932 | 134 |
| 375 | 3300028380 | Ga0268265_10222728 | Ga0268265_102227282 | 134 |
| 376 | 3300028380 | Ga0268265_10344458 | Ga0268265_103444583 | 134 |
| 377 | 3300028380 | Ga0268265_11312082 | Ga0268265_113120822 | 134 |
| 378 | 3300028381 | Ga0268264_10001536 | Ga0268264_100015362 | 134 |
| 379 | 3300028381 | Ga0268264_10189775 | Ga0268264_101897754 | 134 |
| 380 | 3300028381 | Ga0268264_11420083 | Ga0268264_114200832 | 134 |
| 381 | 3300031090 | Ga0265760_10036224 | Ga0265760_100362243 | 134 |
| 382 | 3300031456 | Ga0307513_10147147 | Ga0307513_101471471 | 134 |
| 383 | 3300031456 | Ga0307513_10919903 | Ga0307513_109199031 | 134 |
| 384 | 3300031548 | Ga0307408_101463953 | Ga0307408_1014639532 | 134 |
| 385 | 3300031730 | Ga0307516_10029632 | Ga0307516_100296327 | 134 |
| 386 | 3300031731 | Ga0307405_10058067 | Ga0307405_100580672 | 134 |
| 387 | 3300031731 | Ga0307405_10059360 | Ga0307405_100593604 | 134 |
| 388 | 3300031733 | Ga0316577_10020123 | Ga0316577_100201233 | 134 |
| 389 | 3300031824 | Ga0307413_10000482 | Ga0307413_100004828 | 134 |
| 390 | 3300031824 | Ga0307413_10073191 | Ga0307413_100731912 | 134 |
| 391 | 3300031852 | Ga0307410_10001582 | Ga0307410_100015822 | 134 |
| 392 | 3300031852 | Ga0307410_10073529 | Ga0307410_100735291 | 134 |
| 393 | 3300031852 | Ga0307410_10608632 | Ga0307410_106086321 | 134 |
| 394 | 3300031901 | Ga0307406_10263352 | Ga0307406_102633523 | 134 |
| 395 | 3300031901 | Ga0307406_10999681 | Ga0307406_109996811 | 134 |
| 396 | 3300031903 | Ga0307407_10001104 | Ga0307407_100011049 | 134 |
| 397 | 3300031911 | Ga0307412_10295751 | Ga0307412_102957512 | 134 |
| 398 | 3300031995 | Ga0307409_100001611 | Ga0307409_10000161117 | 134 |
| 399 | 3300031995 | Ga0307409_100017862 | Ga0307409_1000178622 | 134 |
| 400 | 3300032002 | Ga0307416_100194876 | Ga0307416_1001948762 | 134 |
| 401 | 3300032002 | Ga0307416_100549192 | Ga0307416_1005491922 | 134 |
| 402 | 3300032002 | Ga0307416_101615747 | Ga0307416_1016157472 | 134 |
| 403 | 3300032004 | Ga0307414_10020614 | Ga0307414_100206147 | 134 |
| 404 | 3300032004 | Ga0307414_10045985 | Ga0307414_100459856 | 134 |
| 405 | 3300032004 | Ga0307414_10088793 | Ga0307414_100887933 | 134 |
| 406 | 3300032126 | Ga0307415_100035794 | Ga0307415_1000357942 | 134 |
| 407 | 3300032126 | Ga0307415_100139544 | Ga0307415_1001395442 | 134 |
| 408 | 3300032126 | Ga0307415_100266116 | Ga0307415_1002661162 | 134 |
| 409 | 3300032126 | Ga0307415_100509266 | Ga0307415_1005092662 | 134 |
| 410 | 3300035172 | Ga0373955_0412676 | Ga0373955_0412676_51_455 | 134 |
| 411 | 3300039437 | Ga0436365_0861406 | Ga0436365_0861406_13383_13787 | 134 |
| 412 | 3300039437 | Ga0436365_0947596 | Ga0436365_0947596_2986_3390 | 134 |
| 413 | 3300039437 | Ga0436365_1839233 | Ga0436365_1839233_953_1393 | 134 |
| 414 | 3300039450 | Ga0436363_1307533 | Ga0436363_1307533_41_445 | 134 |
| 415 | 3300041463 | Ga0451804_1119475 | Ga0451804_1119475_174_581 | 134 |
| 416 | 3300041509 | Ga0451843_0715407 | Ga0451843_0715407_286_690 | 134 |
| 417 | 3300042876 | Ga0451577_0022276 | Ga0451577_0022276_619_1023 | 134 |
| 418 | 3300042876 | Ga0451577_0279088 | Ga0451577_0279088_212_616 | 134 |
| 419 | 3300042876 | Ga0451577_0335525 | Ga0451577_0335525_18_422 | 134 |
| 420 | 3300044658 | Ga0466972_0001665 | Ga0466972_0001665_5230_5634 | 134 |
| 421 | 3300044683 | Ga0466965_0186806 | Ga0466965_0186806_205_789 | 134 |
| 422 | 3300044712 | Ga0453684_0035312 | Ga0453684_0035312_1703_2107 | 134 |
| 423 | 3300044712 | Ga0453684_0764850 | Ga0453684_0764850_408_812 | 134 |
| 424 | 3300044765 | Ga0466970_0005725 | Ga0466970_0005725_512_916 | 134 |
| 425 | 3300044901 | Ga0466960_0002003 | Ga0466960_0002003_5024_5440 | 134 |
| 426 | 3300045051 | Ga0451576_1011184 | Ga0451576_1011184_262_666 | 134 |
| 427 | 3300046501 | Ga0495607_0019656 | Ga0495607_0019656_143_547 | 134 |
| 428 | 3300046516 | Ga0495628_0007266 | Ga0495628_0007266_6355_6759 | 134 |
| 429 | 3300046517 | Ga0495630_0061512 | Ga0495630_0061512_635_1039 | 134 |
| 430 | 3300046525 | Ga0495663_0000453 | Ga0495663_0000453_84_488 | 134 |
| 431 | 3300046535 | Ga0495586_0008975 | Ga0495586_0008975_138_542 | 134 |
| 432 | 3300046537 | Ga0495598_0000091 | Ga0495598_0000091_13493_13897 | 134 |
| 433 | 3300046539 | Ga0495621_0000163 | Ga0495621_0000163_13715_14119 | 134 |
| 434 | 3300046642 | Ga0495634_0088614 | Ga0495634_0088614_824_1228 | 134 |
| 435 | 3300046678 | Ga0495599_0070158 | Ga0495599_0070158_1657_2061 | 134 |
| 436 | 3300046691 | Ga0495670_0390107 | Ga0495670_0390107_317_721 | 134 |
| 437 | 3300047318 | Ga0495636_0004660 | Ga0495636_0004660_1905_2309 | 134 |
| 438 | 3300047319 | Ga0495674_0005575 | Ga0495674_0005575_3146_3550 | 134 |
| 439 | 3300047320 | Ga0495672_0006846 | Ga0495672_0006846_2214_2618 | 134 |
| 440 | 3300047471 | Ga0495684_0021130 | Ga0495684_0021130_60_464 | 134 |
| 441 | 3300047471 | Ga0495684_0267135 | Ga0495684_0267135_619_1023 | 134 |
| 442 | 3300048090 | Ga0495615_0162996 | Ga0495615_0162996_110_514 | 134 |
| 443 | 3300048904 | Ga0496101_0120527 | Ga0496101_0120527_492_896 | 134 |
| 444 | 3300048906 | Ga0496103_0266791 | Ga0496103_0266791_99_503 | 134 |
| 445 | 3300048907 | Ga0496104_0570473 | Ga0496104_0570473_205_609 | 134 |
| 446 | 3300048910 | Ga0496107_0532032 | Ga0496107_0532032_412_816 | 134 |
| 447 | 3300048911 | Ga0496108_0185944 | Ga0496108_0185944_750_1154 | 134 |
| 448 | 3300048912 | Ga0496109_0015254 | Ga0496109_0015254_2256_2660 | 134 |
| 449 | 3300048912 | Ga0496109_0122696 | Ga0496109_0122696_1796_2200 | 134 |
| 450 | 3300048912 | Ga0496109_0238027 | Ga0496109_0238027_702_1106 | 134 |
| 451 | 3300048913 | Ga0496110_0067624 | Ga0496110_0067624_2271_2675 | 134 |
| 452 | 3300048913 | Ga0496110_0182458 | Ga0496110_0182458_1284_1688 | 134 |
| 453 | 3300048915 | Ga0496112_0486006 | Ga0496112_0486006_737_1141 | 134 |
| 454 | 3300048916 | Ga0496113_0259178 | Ga0496113_0259178_837_1241 | 134 |
| 455 | 3300048916 | Ga0496113_0283461 | Ga0496113_0283461_575_979 | 134 |
| 456 | 3300049515 | Ga0501292_059774 | Ga0501292_059774_121_525 | 134 |
| 457 | 3300049572 | Ga0501036_0044709 | Ga0501036_0044709_1691_2125 | 134 |
| 458 | 3300049576 | Ga0501040_0103368 | Ga0501040_0103368_175_609 | 134 |
| 459 | 3300049577 | Ga0501041_0042731 | Ga0501041_0042731_1092_1526 | 134 |
| 460 | 3300049578 | Ga0501042_0245760 | Ga0501042_0245760_33_467 | 134 |
| 461 | 3300049582 | Ga0501048_0025190 | Ga0501048_0025190_559_993 | 134 |
| 462 | 3300049588 | Ga0501072_0293392 | Ga0501072_0293392_860_1264 | 134 |
| 463 | 3300049588 | Ga0501072_1499401 | Ga0501072_1499401_85_489 | 134 |
| 464 | 3300049591 | Ga0501075_0440401 | Ga0501075_0440401_321_725 | 134 |
| 465 | 3300049592 | Ga0501076_0005699 | Ga0501076_0005699_5941_6375 | 134 |
| 466 | 3300049593 | Ga0501077_0826578 | Ga0501077_0826578_16_420 | 134 |
| 467 | 3300049656 | Ga0501209_124033 | Ga0501209_124033_283_687 | 134 |
| 468 | 3300049664 | Ga0501224_085191 | Ga0501224_085191_61_465 | 134 |
| 469 | 3300049668 | Ga0501233_050989 | Ga0501233_050989_158_574 | 134 |
| 470 | 3300049669 | Ga0501235_162646 | Ga0501235_162646_105_509 | 134 |
| 471 | 3300049675 | Ga0501243_135385 | Ga0501243_135385_73_477 | 134 |
| 472 | 3300049741 | Ga0501079_0629964 | Ga0501079_0629964_105_509 | 134 |
| 473 | 3300049744 | Ga0501083_1073306 | Ga0501083_1073306_15_509 | 134 |
| 474 | 3300050489 | nmdc:mga03683_2448_c1 | nmdc:mga03683_2448_c1_2885_3289 | 134 |
| 475 | 3300050490 | nmdc:mga03n38_30403_c1 | nmdc:mga03n38_30403_c1_1833_2237 | 134 |
| 476 | 3300050492 | nmdc:mga0yw44_339809_c1 | nmdc:mga0yw44_339809_c1_335_739 | 134 |
| 477 | 3300050493 | nmdc:mga0k408_1673_c1 | nmdc:mga0k408_1673_c1_7699_8103 | 134 |
| 478 | 3300050494 | nmdc:mga06z11_2949_c1 | nmdc:mga06z11_2949_c1_2587_2991 | 134 |
| 479 | 3300050495 | nmdc:mga04h51_96103_c1 | nmdc:mga04h51_96103_c1_608_1012 | 134 |
| 480 | 3300050495 | nmdc:mga04h51_9615_c1 | nmdc:mga04h51_9615_c1_1750_2154 | 134 |
| 481 | 3300050496 | nmdc:mga07m45_373662_c1 | nmdc:mga07m45_373662_c1_153_557 | 134 |
| 482 | 3300050508 | nmdc:mga09592_409997_c1 | nmdc:mga09592_409997_c1_51_455 | 134 |
| 483 | 3300050509 | nmdc:mga0qj67_26271_c1 | nmdc:mga0qj67_26271_c1_2296_2700 | 134 |
| 484 | 3300050509 | nmdc:mga0qj67_673843_c1 | nmdc:mga0qj67_673843_c1_37_441 | 134 |
| 485 | 3300050509 | nmdc:mga0qj67_80814_c1 | nmdc:mga0qj67_80814_c1_684_1136 | 134 |
| 486 | 3300050510 | nmdc:mga06r32_51065_c1 | nmdc:mga06r32_51065_c1_137_541 | 134 |
| 487 | 3300050511 | nmdc:mga08y16_122_c1 | nmdc:mga08y16_122_c1_9208_9612 | 134 |
| 488 | 3300050511 | nmdc:mga08y16_5289_c1 | nmdc:mga08y16_5289_c1_4135_4539 | 134 |
| 489 | 3300050511 | nmdc:mga08y16_781514_c1 | nmdc:mga08y16_781514_c1_187_591 | 134 |
| 490 | 3300050512 | nmdc:mga0n895_2041112_c1 | nmdc:mga0n895_2041112_c1_73_477 | 134 |
| 491 | 3300050513 | nmdc:mga0rr50_736205_c1 | nmdc:mga0rr50_736205_c1_379_783 | 134 |
| 492 | 3300050515 | nmdc:mga0a205_360479_c1 | nmdc:mga0a205_360479_c1_50_454 | 134 |
| 493 | 3300050515 | nmdc:mga0a205_607789_c1 | nmdc:mga0a205_607789_c1_39_443 | 134 |
| 494 | 3300050515 | nmdc:mga0a205_659341_c1 | nmdc:mga0a205_659341_c1_242_646 | 134 |
| 495 | 3300050515 | nmdc:mga0a205_801438_c1 | nmdc:mga0a205_801438_c1_40_444 | 134 |
| 496 | 3300053077 | Ga0495601_0046681 | Ga0495601_0046681_1709_2113 | 134 |
| 497 | 3300053134 | Ga0500658_0093189 | Ga0500658_0093189_835_1239 | 134 |
| 498 | 3300053156 | Ga0500622_0005971 | Ga0500622_0005971_1829_2233 | 134 |
| 499 | 3300053156 | Ga0500622_0093379 | Ga0500622_0093379_391_795 | 134 |
| 500 | 3300053178 | Ga0500637_0002574 | Ga0500637_0002574_5602_6006 | 134 |
| 501 | 3300054114 | Ga0501084_0279871 | Ga0501084_0279871_30_458 | 134 |
| 502 | 3300054114 | Ga0501084_0400088 | Ga0501084_0400088_729_1133 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gus-assembly1.cif.gz_B | mopii from clostridium pasteurianum (apo1) | 0.7163 | 94 | 124 |
| 4z25-assembly4.cif.gz_J | mimivirus r135 (residues 51-702) | 0.7146 | 94 | 123 |
| 6xbs-assembly1.cif.gz_A-2 | streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa | 0.7063 | 3 | 126 |
| 3ic8-assembly2.cif.gz_A | the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a | 0.7031 | 101 | 124 |
| 6wf7-assembly1.cif.gz_A | methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ | 0.6998 | 3 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9123 | 74 | 121 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8907 | 74 | 125 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8307 | 74 | 121 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8254 | 76 | 126 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8202 | 74 | 125 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090E412-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9768 | 74 | 125 |
|
| AF-A0A850JMV8-F1-model_v4 | VOC family protein | 0.9745 | 74 | 125 |
|
| AF-A0A7W5TGB5-F1-model_v4 | Putative enzyme related to lactoylglutathione lyase | 0.9737 | 76 | 125 |
GO:0016829
|
| AF-A0A136MF62-F1-model_v4 | deleted | 0.9735 | 74 | 125 |
|
| AF-A0A1H2S8F6-F1-model_v4 | Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein | 0.9718 | 76 | 125 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar