F455852

General Info

Members Datasets Scaffolds Average Seq Length
502 223 1004 263

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10001438|Ga0213876_1000143811
Length 307
Sequence VNPEAATHSIDRRDEIRHLHDGEPAPAANADDGGAGDDDAPLVELQDVVLRFGKKTVLDGVSLAVYPGERLIVLGGSGSGKSTTLRLIMGILQPTAGRVFFCGHEISALGRRELNVLRARIGMVYQYSALISSLTVRDNLALPMEELSDQKPEEIDRIIDEKLAMVNMGNVKSAMPAELSGGMKKRIGLARALVLDPELILFDEPSAGLDPVTSSIVDELIINLTEQTQTTSIVVTHEMDSAFRIGTRMVMLYEGKIIADGPPEEFRHSSNPVVTQFVEGRTEGPILDSTRHHDPKPEQPATTTAGR

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.98
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 10.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10001438 3300021384 Bacteria 14813
2 CNXas_1000382 3300000545 Bacteria 3455
3 JGI24035J26624_1002346 3300002126 Bacteria 1765
4 JGI25406J46586_10000023 3300003203 Bacteria 76640
5 Ga0065704_10162264 3300005289 Unclassified 1346
6 Ga0065712_10007547 3300005290 Bacteria 2507
7 Ga0065712_10115221 3300005290 Bacteria 1755
8 Ga0065712_10151695 3300005290 Unclassified 1365
9 Ga0065715_10001773 3300005293 Bacteria 9408
10 Ga0065707_10006006 3300005295 Bacteria 3277
11 Ga0070658_10020004 3300005327 Bacteria 5361
12 Ga0070658_10029659 3300005327 Bacteria 4396
13 Ga0070658_10134476 3300005327 Bacteria 2062
14 Ga0070658_10159233 3300005327 Bacteria 1894
15 Ga0070676_10002923 3300005328 Bacteria 8823
16 Ga0070676_10012692 3300005328 Bacteria 4606
17 Ga0070676_10018442 3300005328 Bacteria 3868
18 Ga0070676_10065346 3300005328 Bacteria 2172
19 Ga0070683_100053148 3300005329 Bacteria 3754
20 Ga0070690_100097786 3300005330 Unclassified 1942
21 Ga0070690_100568227 3300005330 Bacteria 857
22 Ga0070670_100005320 3300005331 Bacteria 10856
23 Ga0070670_100006708 3300005331 Bacteria 9755
24 Ga0070670_100026824 3300005331 Bacteria 4955
25 Ga0070670_100112690 3300005331 Viruses 2344
26 Ga0070670_100210319 3300005331 Bacteria 1691
27 Ga0070677_10023490 3300005333 Bacteria 2284
28 Ga0070677_10138660 3300005333 Bacteria 1119
29 Ga0068869_100270956 3300005334 Bacteria 1362
30 Ga0070666_10005510 3300005335 Bacteria 7764
31 Ga0070666_10061459 3300005335 Bacteria 2543
32 Ga0070666_10122269 3300005335 Bacteria 1806
33 Ga0070666_10425795 3300005335 Bacteria 956
34 Ga0068868_100076108 3300005338 Bacteria 2683
35 Ga0068868_100159304 3300005338 Bacteria 1863
36 Ga0068868_100165307 3300005338 Bacteria 1830
37 Ga0068868_100251472 3300005338 Bacteria 1488
38 Ga0068868_100493100 3300005338 Bacteria 1072
39 Ga0070660_100046737 3300005339 Bacteria 3319
40 Ga0070660_100064592 3300005339 Bacteria 2848
41 Ga0070689_100292044 3300005340 Bacteria 1355
42 Ga0070691_10145511 3300005341 Bacteria 1211
43 Ga0070661_100113246 3300005344 Bacteria 2027
44 Ga0070668_100002392 3300005347 Bacteria 13794
45 Ga0070668_100017294 3300005347 Bacteria 5398
46 Ga0070668_100025289 3300005347 Bacteria 4500
47 Ga0070669_100009421 3300005353 Bacteria 6953
48 Ga0070669_100012301 3300005353 Bacteria 6072
49 Ga0070669_100304104 3300005353 Bacteria 1283
50 Ga0070675_100010789 3300005354 Bacteria 7145
51 Ga0070675_100059781 3300005354 Bacteria 3145
52 Ga0070675_100108573 3300005354 Bacteria 2343
53 Ga0070675_100143007 3300005354 Bacteria 2046
54 Ga0070675_100158210 3300005354 Bacteria 1947
55 Ga0070671_100004750 3300005355 Bacteria 10792
56 Ga0070671_100069906 3300005355 Bacteria 2928
57 Ga0070671_100247898 3300005355 Bacteria 1513
58 Ga0070671_100313908 3300005355 Bacteria 1335
59 Ga0070674_100003820 3300005356 Bacteria 8521
60 Ga0070674_100016618 3300005356 Bacteria 4615
61 Ga0070674_100239453 3300005356 Unclassified 1420
62 Ga0070674_100356650 3300005356 Bacteria 1183
63 Ga0070673_100019760 3300005364 Bacteria 4844
64 Ga0070673_100020468 3300005364 Bacteria 4773
65 Ga0070673_100240659 3300005364 Bacteria 1573
66 Ga0070688_100009213 3300005365 Bacteria 5388
67 Ga0070688_100198870 3300005365 Bacteria 1401
68 Ga0070667_100014735 3300005367 Bacteria 6459
69 Ga0070667_100035329 3300005367 Bacteria 4186
70 Ga0070667_100035605 3300005367 Bacteria 4171
71 Ga0070667_100079668 3300005367 Bacteria 2800
72 Ga0070667_100109467 3300005367 Bacteria 2394
73 Ga0070714_100098117 3300005435 Bacteria 2577
74 Ga0070714_100208400 3300005435 Bacteria 1791
75 Ga0070714_100209009 3300005435 Bacteria 1788
76 Ga0070714_100272972 3300005435 Bacteria 1568
77 Ga0070714_100624726 3300005435 Bacteria 1036
78 Ga0070713_100175055 3300005436 Bacteria 1925
79 Ga0070713_100677211 3300005436 Bacteria 984
80 Ga0070711_100025400 3300005439 Unclassified 3876
81 Ga0070711_100033883 3300005439 Bacteria 3403
82 Ga0070711_100201566 3300005439 Bacteria 1536
83 Ga0070700_100528666 3300005441 Bacteria 912
84 Ga0070708_100055215 3300005445 Bacteria 3531
85 Ga0070708_100343544 3300005445 Bacteria 1406
86 Ga0070708_100398383 3300005445 Bacteria 1298
87 Ga0070678_100134973 3300005456 Bacteria 1967
88 Ga0070678_100139834 3300005456 Unclassified 1936
89 Ga0070678_100240186 3300005456 Bacteria 1514
90 Ga0070662_100278330 3300005457 Bacteria 1353
91 Ga0068867_100006507 3300005459 Bacteria 8255
92 Ga0070706_100000973 3300005467 Bacteria 31247
93 Ga0070706_100025763 3300005467 Bacteria 5412
94 Ga0070706_100085389 3300005467 Bacteria 2925
95 Ga0070706_100086118 3300005467 Bacteria 2911
96 Ga0070706_100086901 3300005467 Unclassified 2898
97 Ga0070706_100152683 3300005467 Unclassified 2156
98 Ga0070706_100192325 3300005467 Unclassified 1906
99 Ga0070706_100208369 3300005467 Bacteria 1825
100 Ga0070706_100334651 3300005467 Unclassified 1412
101 Ga0070707_100019586 3300005468 Bacteria 6377
102 Ga0070707_100035472 3300005468 Bacteria 4758
103 Ga0070707_100053866 3300005468 Bacteria 3857
104 Ga0070707_100060619 3300005468 Unclassified 3628
105 Ga0070707_100125541 3300005468 Unclassified 2493
106 Ga0070707_100143743 3300005468 Bacteria 2322
107 Ga0070707_100764700 3300005468 Unclassified 929
108 Ga0070698_100001144 3300005471 Bacteria 29368
109 Ga0070698_100004844 3300005471 Bacteria 14775
110 Ga0070698_100026631 3300005471 Bacteria 6017
111 Ga0070698_100037336 3300005471 Bacteria 5010
112 Ga0070698_100395986 3300005471 Unclassified 1314
113 Ga0070699_100091499 3300005518 Bacteria 2660
114 Ga0070699_100206480 3300005518 Bacteria 1748
115 Ga0070679_100765796 3300005530 Bacteria 908
116 Ga0070697_100001763 3300005536 Bacteria 16519
117 Ga0070697_100006844 3300005536 Bacteria 8855
118 Ga0070697_100025379 3300005536 Bacteria 4728
119 Ga0070697_100045936 3300005536 Bacteria 3540
120 Ga0070697_100179633 3300005536 Unclassified 1794
121 Ga0070697_100273453 3300005536 Bacteria 1448
122 Ga0070697_100296765 3300005536 Bacteria 1389
123 Ga0068853_100000011 3300005539 Bacteria 246709
124 Ga0070672_100011259 3300005543 Bacteria 6237
125 Ga0070695_100247823 3300005545 Bacteria 1295
126 Ga0070696_100327680 3300005546 Bacteria 1180
127 Ga0070665_100000772 3300005548 Bacteria 42151
128 Ga0070665_100004925 3300005548 Bacteria 13852
129 Ga0070665_100008642 3300005548 Bacteria 10307
130 Ga0070665_100099861 3300005548 Bacteria 2907
131 Ga0070665_100732598 3300005548 Bacteria 1002
132 Ga0068855_100057644 3300005563 Bacteria 4552
133 Ga0068855_100080775 3300005563 Bacteria 3770
134 Ga0068855_100327224 3300005563 Bacteria 1692
135 Ga0068855_100855140 3300005563 Bacteria 964
136 Ga0070664_100136539 3300005564 Bacteria 2157
137 Ga0068856_100340662 3300005614 Bacteria 1517
138 Ga0068859_100874871 3300005617 Bacteria 984
139 Ga0068864_100031014 3300005618 Bacteria 4534
140 Ga0068866_10003045 3300005718 Bacteria 6917
141 Ga0068866_10077663 3300005718 Bacteria 1774
142 Ga0068861_100075982 3300005719 Bacteria 2616
143 Ga0068863_100107086 3300005841 Bacteria 2660
144 Ga0068863_100126845 3300005841 Bacteria 2435
145 Ga0068858_100041846 3300005842 Bacteria 4247
146 Ga0068858_100099131 3300005842 Bacteria 2717
147 Ga0068858_100667818 3300005842 Bacteria 1010
148 Ga0068862_100084148 3300005844 Bacteria 2763
149 Ga0068862_100634234 3300005844 Bacteria 1029
150 Ga0081539_10000014 3300005985 Bacteria 411270
151 Ga0081539_10000710 3300005985 Bacteria 66710
152 Ga0081539_10006328 3300005985 Bacteria 11428
153 Ga0070717_10013229 3300006028 Bacteria 6315
154 Ga0070717_10043561 3300006028 Unclassified 3664
155 Ga0070717_10086635 3300006028 Bacteria 2637
156 Ga0070717_10131430 3300006028 Bacteria 2153
157 Ga0070717_10199955 3300006028 Bacteria 1750
158 Ga0070716_100058213 3300006173 Bacteria 2223
159 Ga0070712_100009931 3300006175 Bacteria 6000
160 Ga0070712_100022325 3300006175 Unclassified 4168
161 Ga0070712_100052217 3300006175 Unclassified 2850
162 Ga0070712_100112065 3300006175 Bacteria 2038
163 Ga0070712_100239676 3300006175 Bacteria 1444
164 Ga0070712_100316698 3300006175 Bacteria 1267
165 Ga0097621_100004502 3300006237 Bacteria 9716
166 Ga0097621_100081762 3300006237 Bacteria 2689
167 Ga0097621_100308188 3300006237 Bacteria 1400
168 Ga0097621_100388288 3300006237 Bacteria 1248
169 Ga0068871_100040008 3300006358 Bacteria 3754
170 Ga0068871_100195222 3300006358 Unclassified 1745
171 Ga0068871_100303880 3300006358 Bacteria 1401
172 Ga0075430_100021635 3300006846 Bacteria 5465
173 Ga0075434_100197461 3300006871 Bacteria 2032
174 Ga0068865_100098170 3300006881 Bacteria 2139
175 Ga0068865_100238865 3300006881 Bacteria 1429
176 Ga0097620_100874702 3300006931 Bacteria 984
177 Ga0099795_10003993 3300007788 Bacteria 3744
178 Ga0099795_10077478 3300007788 Unclassified 1266
179 Ga0105240_10000057 3300009093 Bacteria 222664
180 Ga0105240_10018462 3300009093 Bacteria 9365
181 Ga0111539_10112062 3300009094 Bacteria 3200
182 Ga0111539_10298822 3300009094 Bacteria 1874
183 Ga0105245_10024665 3300009098 Bacteria 5283
184 Ga0105245_10084114 3300009098 Bacteria 2914
185 Ga0105245_10150385 3300009098 Bacteria 2201
186 Ga0105245_10205710 3300009098 Bacteria 1892
187 Ga0105247_10042622 3300009101 Bacteria 2780
188 Ga0114129_10907403 3300009147 Bacteria 1116
189 Ga0105241_10352370 3300009174 Bacteria 1278
190 Ga0105242_10007257 3300009176 Bacteria 8547
191 Ga0105242_10016185 3300009176 Bacteria 5794
192 Ga0105237_10005488 3300009545 Bacteria 14297
193 Ga0105249_10285746 3300009553 Bacteria 1649
194 Ga0099796_10021508 3300010159 Bacteria 1987
195 Ga0105239_10035778 3300010375 Bacteria 5453
196 Ga0105239_10201434 3300010375 Bacteria 2230
197 Ga0105239_10279156 3300010375 Bacteria 1880
198 Ga0157373_10127739 3300013100 Bacteria 1788
199 Ga0157371_10187751 3300013102 Unclassified 1479
200 Ga0157370_10095063 3300013104 Bacteria 2796
201 Ga0157370_10199597 3300013104 Bacteria 1856
202 Ga0157369_10100533 3300013105 Bacteria 3082
203 Ga0157369_10188536 3300013105 Bacteria 2167
204 Ga0157369_10242375 3300013105 Bacteria 1883
205 Ga0157374_10011892 3300013296 Bacteria 7552
206 Ga0157374_10033019 3300013296 Bacteria 4719
207 Ga0157374_10054807 3300013296 Unclassified 3720
208 Ga0157374_10447850 3300013296 Unclassified 1292
209 Ga0157378_10032112 3300013297 Bacteria 4638
210 Ga0157378_10039368 3300013297 Bacteria 4193
211 Ga0157378_10177214 3300013297 Unclassified 2003
212 Ga0157378_10180162 3300013297 Unclassified 1987
213 Ga0163162_10020938 3300013306 Bacteria 6432
214 Ga0163162_10026233 3300013306 Bacteria 5759
215 Ga0163162_10157827 3300013306 Bacteria 2389
216 Ga0163162_10818274 3300013306 Bacteria 1048
217 Ga0157372_10067032 3300013307 Bacteria 4033
218 Ga0157372_10131216 3300013307 Bacteria 2883
219 Ga0157372_10426175 3300013307 Bacteria 1546
220 Ga0157375_10003770 3300013308 Bacteria 13135
221 Ga0157375_10009538 3300013308 Bacteria 8522
222 Ga0157375_10034179 3300013308 Bacteria 4841
223 Ga0157375_10112623 3300013308 Bacteria 2821
224 Ga0157375_10166101 3300013308 Bacteria 2352
225 Ga0157375_10235877 3300013308 Bacteria 1988
226 Ga0157375_10383176 3300013308 Bacteria 1573
227 Ga0163163_10121331 3300014325 Bacteria 2648
228 Ga0157379_10636717 3300014968 Bacteria 997
229 Ga0157376_10007798 3300014969 Bacteria 7672
230 Ga0163161_10000942 3300017792 Bacteria 22392
231 Ga0213872_10011117 3300021361 Bacteria 4265
232 Ga0213872_10021749 3300021361 Unclassified 2954
233 Ga0213872_10043134 3300021361 Unclassified 2056
234 Ga0213872_10081131 3300021361 Bacteria 1457
235 Ga0213872_10100578 3300021361 Unclassified 1289
236 Ga0213874_10015345 3300021377 Bacteria 2019
237 Ga0213876_10015390 3300021384 Bacteria 4048
238 Ga0213871_10004130 3300021441 Bacteria 2876
239 Ga0213871_10015935 3300021441 Unclassified 1804
240 Ga0207673_1003719 3300025290 Bacteria 1797
241 Ga0207697_10000238 3300025315 Bacteria 29919
242 Ga0207697_10000262 3300025315 Bacteria 28988
243 Ga0207697_10018575 3300025315 Bacteria 2851
244 Ga0207697_10099162 3300025315 Bacteria 1241
245 Ga0207642_10139221 3300025899 Bacteria 1277
246 Ga0207688_10000429 3300025901 Bacteria 19807
247 Ga0207688_10000823 3300025901 Bacteria 15526
248 Ga0207680_10026298 3300025903 Bacteria 3224
249 Ga0207680_10031477 3300025903 Bacteria 3005
250 Ga0207680_10040126 3300025903 Bacteria 2721
251 Ga0207680_10156307 3300025903 Bacteria 1525
252 Ga0207699_10004399 3300025906 Bacteria 6739
253 Ga0207699_10183450 3300025906 Bacteria 1408
254 Ga0207699_10315003 3300025906 Bacteria 1096
255 Ga0207699_10349132 3300025906 Bacteria 1044
256 Ga0207645_10000823 3300025907 Bacteria 25996
257 Ga0207645_10015174 3300025907 Bacteria 5130
258 Ga0207645_10040071 3300025907 Bacteria 3000
259 Ga0207645_10091809 3300025907 Bacteria 1953
260 Ga0207705_10058972 3300025909 Bacteria 2769
261 Ga0207684_10001687 3300025910 Bacteria 23476
262 Ga0207684_10049137 3300025910 Bacteria 3579
263 Ga0207684_10120686 3300025910 Bacteria 2247
264 Ga0207684_10152052 3300025910 Bacteria 1991
265 Ga0207684_10188176 3300025910 Unclassified 1780
266 Ga0207684_10214002 3300025910 Unclassified 1662
267 Ga0207684_10238014 3300025910 Bacteria 1570
268 Ga0207684_10307092 3300025910 Viruses 1367
269 Ga0207695_10000072 3300025913 Bacteria 312795
270 Ga0207695_10000450 3300025913 Bacteria 89495
271 Ga0207671_10039468 3300025914 Unclassified 3495
272 Ga0207693_10002474 3300025915 Bacteria 16059
273 Ga0207693_10006817 3300025915 Bacteria 9431
274 Ga0207693_10070160 3300025915 Bacteria 2742
275 Ga0207693_10101281 3300025915 Unclassified 2258
276 Ga0207693_10119018 3300025915 Bacteria 2074
277 Ga0207663_10001758 3300025916 Bacteria 10214
278 Ga0207663_10138907 3300025916 Bacteria 1690
279 Ga0207663_10155606 3300025916 Bacteria 1608
280 Ga0207663_10533298 3300025916 Bacteria 916
281 Ga0207662_10064006 3300025918 Bacteria 2212
282 Ga0207657_10106039 3300025919 Bacteria 2326
283 Ga0207649_10329054 3300025920 Bacteria 1125
284 Ga0207646_10000513 3300025922 Bacteria 51606
285 Ga0207646_10066818 3300025922 Unclassified 3210
286 Ga0207646_10104602 3300025922 Unclassified 2539
287 Ga0207646_10447152 3300025922 Unclassified 1166
288 Ga0207681_10011020 3300025923 Bacteria 5552
289 Ga0207681_10022182 3300025923 Bacteria 4046
290 Ga0207650_10021161 3300025925 Bacteria 4597
291 Ga0207650_10048973 3300025925 Bacteria 3118
292 Ga0207650_10147270 3300025925 Bacteria 1855
293 Ga0207650_10215342 3300025925 Bacteria 1544
294 Ga0207659_10007927 3300025926 Bacteria 6567
295 Ga0207659_10063229 3300025926 Bacteria 2675
296 Ga0207659_10063739 3300025926 Bacteria 2666
297 Ga0207659_10098013 3300025926 Bacteria 2204
298 Ga0207687_10037865 3300025927 Bacteria 3293
299 Ga0207687_10150507 3300025927 Bacteria 1775
300 Ga0207700_10034697 3300025928 Bacteria 3625
301 Ga0207700_10075642 3300025928 Bacteria 2610
302 Ga0207664_10139724 3300025929 Bacteria 2048
303 Ga0207664_10146017 3300025929 Unclassified 2006
304 Ga0207664_10197020 3300025929 Bacteria 1737
305 Ga0207664_10207085 3300025929 Bacteria 1695
306 Ga0207664_10218473 3300025929 Bacteria 1652
307 Ga0207644_10005188 3300025931 Bacteria 8512
308 Ga0207644_10034397 3300025931 Bacteria 3545
309 Ga0207644_10086924 3300025931 Bacteria 2322
310 Ga0207644_10106055 3300025931 Bacteria 2118
311 Ga0207644_10178446 3300025931 Bacteria 1663
312 Ga0207644_10279564 3300025931 Bacteria 1340
313 Ga0207644_10532932 3300025931 Bacteria 971
314 Ga0207690_10108432 3300025932 Bacteria 1996
315 Ga0207706_10036106 3300025933 Bacteria 4391
316 Ga0207706_10084820 3300025933 Bacteria 2785
317 Ga0207706_10151613 3300025933 Unclassified 2038
318 Ga0207686_10008278 3300025934 Bacteria 5611
319 Ga0207686_10311426 3300025934 Unclassified 1173
320 Ga0207670_10553891 3300025936 Bacteria 940
321 Ga0207669_10009962 3300025937 Bacteria 4555
322 Ga0207669_10012468 3300025937 Unclassified 4181
323 Ga0207669_10062587 3300025937 Bacteria 2292
324 Ga0207669_10081094 3300025937 Bacteria 2077
325 Ga0207669_10277044 3300025937 Unclassified 1263
326 Ga0207704_10032009 3300025938 Bacteria 2971
327 Ga0207704_10393596 3300025938 Bacteria 1091
328 Ga0207665_10010290 3300025939 Bacteria 6141
329 Ga0207691_10000306 3300025940 Bacteria 48746
330 Ga0207691_10003086 3300025940 Bacteria 16247
331 Ga0207691_10003406 3300025940 Bacteria 15457
332 Ga0207691_10036248 3300025940 Bacteria 4570
333 Ga0207691_10358566 3300025940 Unclassified 1247
334 Ga0207679_10118737 3300025945 Bacteria 2101
335 Ga0207667_10025782 3300025949 Bacteria 6431
336 Ga0207651_10045287 3300025960 Bacteria 2950
337 Ga0207651_10052267 3300025960 Bacteria 2785
338 Ga0207651_10105071 3300025960 Bacteria 2105
339 Ga0207651_10253309 3300025960 Bacteria 1441
340 Ga0207668_10011447 3300025972 Bacteria 5391
341 Ga0207668_10021024 3300025972 Bacteria 4156
342 Ga0207668_10025525 3300025972 Bacteria 3825
343 Ga0207668_10227849 3300025972 Bacteria 1500
344 Ga0207668_10536475 3300025972 Bacteria 1012
345 Ga0207658_10146322 3300025986 Bacteria 1919
346 Ga0207658_10488118 3300025986 Bacteria 1095
347 Ga0207677_10007188 3300026023 Bacteria 6136
348 Ga0207677_10054821 3300026023 Bacteria 2723
349 Ga0207703_10026174 3300026035 Bacteria 4590
350 Ga0207703_10347165 3300026035 Bacteria 1365
351 Ga0207703_10709336 3300026035 Bacteria 957
352 Ga0207639_10000019 3300026041 Bacteria 246728
353 Ga0207678_10618252 3300026067 Bacteria 950
354 Ga0207702_10045597 3300026078 Bacteria 3688
355 Ga0207702_10148752 3300026078 Bacteria 2128
356 Ga0207641_10025333 3300026088 Bacteria 4891
357 Ga0207641_10136286 3300026088 Bacteria 2210
358 Ga0207648_10014184 3300026089 Bacteria 7369
359 Ga0207676_10102430 3300026095 Bacteria 2377
360 Ga0207674_10003625 3300026116 Bacteria 18829
361 Ga0207683_10002031 3300026121 Bacteria 17894
362 Ga0207683_10019180 3300026121 Bacteria 5840
363 Ga0207683_10021171 3300026121 Bacteria 5565
364 Ga0268266_10010104 3300028379 Bacteria 8274
365 Ga0268266_10020958 3300028379 Bacteria 5572
366 Ga0268266_10279768 3300028379 Bacteria 1551
367 Ga0268266_10342542 3300028379 Bacteria 1403
368 Ga0268266_10428906 3300028379 Bacteria 1254
369 Ga0268265_10049204 3300028380 Bacteria 3169
370 Ga0268265_10575427 3300028380 Bacteria 1073
371 Ga0268264_10043163 3300028381 Bacteria 3736
372 Ga0265330_10150754 3300031235 Bacteria 988
373 Ga0265316_10208554 3300031344 Bacteria 1446
374 Ga0307513_10137766 3300031456 Bacteria 2373
375 Ga0307413_10307916 3300031824 Bacteria 1204
376 Ga0307410_10025821 3300031852 Bacteria 3690
377 Ga0307409_100118727 3300031995 Bacteria 2234
378 Ga0307409_100433081 3300031995 Bacteria 1265
379 Ga0307416_100082683 3300032002 Bacteria 2721
380 Ga0307416_100557434 3300032002 Bacteria 1220
381 Ga0307416_100973830 3300032002 Bacteria 951
382 Ga0307411_10141997 3300032005 Bacteria 1772
383 Ga0373926_0048133 3300035083 Bacteria 1533
384 Ga0373954_0204689 3300035118 Bacteria 970
385 Ga0373943_0128896 3300035170 Bacteria 1352
386 Ga0373946_0011788 3300035171 Bacteria 3268
387 Ga0373955_0020926 3300035172 Bacteria 3294
388 Ga0373924_0036750 3300035410 Bacteria 1992
389 Ga0373931_0214025 3300035691 Bacteria 1157
390 Ga0373935_0010731 3300035692 Bacteria 5504
391 Ga0373935_0076518 3300035692 Bacteria 2167
392 Ga0373947_0033533 3300035725 Bacteria 3032
393 Ga0373937_0007726 3300036401 Bacteria 9320
394 Ga0373937_0142912 3300036401 Bacteria 2239
395 Ga0373937_0393484 3300036401 Bacteria 1315
396 Ga0373925_0174691 3300037068 Bacteria 1697
397 Ga0373925_0539072 3300037068 Bacteria 959
398 Ga0395899_0190865 3300037312 Bacteria 1434
399 Ga0395900_0387631 3300037418 Bacteria 1364
400 Ga0436364_0367939 3300037853 Bacteria 2351
401 Ga0436364_1196405 3300037853 Bacteria 2969
402 Ga0395901_0012233 3300038443 Bacteria 8710
403 Ga0395901_0103973 3300038443 Bacteria 2980
404 Ga0436365_0071258 3300039437 Bacteria 37638
405 Ga0436365_0761885 3300039437 Bacteria 4673
406 Ga0436365_0818660 3300039437 Bacteria 34963
407 Ga0436365_0831869 3300039437 Unclassified 3457
408 Ga0436365_1923965 3300039437 Bacteria 20645
409 Ga0436360_0105884 3300039438 Bacteria 9726
410 Ga0436360_0554333 3300039438 Bacteria 6664
411 Ga0436360_0829103 3300039438 Bacteria 1943
412 Ga0436360_0832359 3300039438 Bacteria 4519
413 Ga0436360_0981398 3300039438 Unclassified 2894
414 Ga0436361_0132728 3300039447 Bacteria 1619
415 Ga0436361_0138991 3300039447 Bacteria 1710
416 Ga0436361_0172514 3300039447 Bacteria 2421
417 Ga0436361_0266084 3300039447 Bacteria 1102
418 Ga0436361_0381704 3300039447 Unclassified 3538
419 Ga0436361_0432650 3300039447 Unclassified 1672
420 Ga0436361_0523568 3300039447 Bacteria 6663
421 Ga0436361_0955202 3300039447 Bacteria 2608
422 Ga0436361_1041738 3300039447 Bacteria 4500
423 Ga0436361_1194033 3300039447 Bacteria 6040
424 Ga0436363_0639431 3300039450 Bacteria 4729
425 Ga0436363_1682874 3300039450 Bacteria 1552
426 Ga0436362_0402008 3300039453 Unclassified 2380
427 Ga0436362_0556011 3300039453 Unclassified 963
428 Ga0451807_0876074 3300041486 Viruses 1087
429 Ga0451576_0033056 3300045051 Bacteria 5500
430 Ga0451576_0803002 3300045051 Bacteria 988
431 Ga0466967_0316681 3300045976 Bacteria 1504
432 Ga0495592_0048276 3300046454 Bacteria 3167
433 Ga0495608_0240038 3300046511 Bacteria 1132
434 Ga0495630_0000483 3300046517 Bacteria 29587
435 Ga0495630_0041259 3300046517 Bacteria 3446
436 Ga0495643_0000105 3300046522 Bacteria 139396
437 Ga0495652_0020595 3300046529 Bacteria 5861
438 Ga0495640_0039060 3300046533 Bacteria 3334
439 Ga0495640_0254874 3300046533 Bacteria 1098
440 Ga0495586_0122231 3300046535 Bacteria 1455
441 Ga0495645_0051896 3300046543 Bacteria 2984
442 Ga0495667_0311402 3300046559 Bacteria 997
443 Ga0495656_0088395 3300046615 Bacteria 1412
444 Ga0495634_0125553 3300046642 Bacteria 1640
445 Ga0495659_0117514 3300046664 Bacteria 1044
446 Ga0495657_0212005 3300046675 Bacteria 1177
447 Ga0495646_0072704 3300046680 Bacteria 2022
448 Ga0495658_0170572 3300046683 Bacteria 1346
449 Ga0495613_0002425 3300046689 Bacteria 14076
450 Ga0495613_0105084 3300046689 Bacteria 2039
451 Ga0495624_0081404 3300046690 Bacteria 2005
452 Ga0495600_0076220 3300046809 Bacteria 2190
453 Ga0495581_0041815 3300047315 Bacteria 2653
454 Ga0495674_0017129 3300047319 Bacteria 6749
455 Ga0495674_0179986 3300047319 Bacteria 1761
456 Ga0495684_0002085 3300047471 Bacteria 16076
457 Ga0495684_0084626 3300047471 Bacteria 2406
458 Ga0495684_0105987 3300047471 Bacteria 2124
459 Ga0495684_0249450 3300047471 Bacteria 1292
460 Ga0496100_0002986 3300048903 Bacteria 8708
461 Ga0496100_0034627 3300048903 Bacteria 3171
462 Ga0496101_0045884 3300048904 Bacteria 3132
463 Ga0496102_0679097 3300048905 Bacteria 953
464 Ga0496103_0003746 3300048906 Bacteria 9248
465 Ga0496104_0014922 3300048907 Bacteria 7024
466 Ga0496104_0141459 3300048907 Unclassified 2311
467 Ga0496104_0224590 3300048907 Bacteria 1790
468 Ga0496106_0000430 3300048909 Bacteria 29885
469 Ga0496107_0000174 3300048910 Bacteria 33216
470 Ga0496108_0017250 3300048911 Bacteria 5905
471 Ga0496108_0452049 3300048911 Bacteria 1122
472 Ga0496108_0627917 3300048911 Unclassified 935
473 Ga0496109_0055891 3300048912 Bacteria 3601
474 Ga0496109_0104354 3300048912 Bacteria 2632
475 Ga0496109_0149302 3300048912 Bacteria 2188
476 Ga0496109_0548937 3300048912 Unclassified 1090
477 Ga0496111_0303169 3300048914 Bacteria 1184
478 Ga0496112_0006024 3300048915 Bacteria 10583
479 Ga0496112_0010611 3300048915 Bacteria 8370
480 Ga0496112_0011331 3300048915 Bacteria 8137
481 Ga0496112_0016762 3300048915 Bacteria 6871
482 Ga0496112_0019136 3300048915 Bacteria 6457
483 Ga0496113_0042830 3300048916 Unclassified 3347
484 Ga0496113_0141403 3300048916 Bacteria 1894
485 Ga0496114_0024795 3300048917 Bacteria 4897
486 Ga0496115_0003485 3300048918 Bacteria 11311
487 Ga0496115_0035536 3300048918 Bacteria 3942
488 Ga0496115_0338787 3300048918 Bacteria 1228
489 Ga0501032_0039123 3300049569 Bacteria 3227
490 Ga0501034_0003936 3300049571 Bacteria 16694
491 Ga0501037_0019049 3300049573 Bacteria 5060
492 Ga0501047_0006754 3300049581 Bacteria 10783
493 Ga0501080_0013875 3300049742 Bacteria 7417
494 Ga0501080_0039506 3300049742 Bacteria 4404
495 Ga0501044_0000774 3300049823 Bacteria 38751
496 Ga0501044_0140375 3300049823 Bacteria 2405
497 nmdc:mga08y16_280607_c1 3300050511 Bacteria 1718
498 nmdc:mga08y16_315830_c1 3300050511 Bacteria 1609
499 nmdc:mga0n895_38298_c1 3300050512 Unclassified 4644
500 nmdc:mga0rr50_261729_c1 3300050513 Unclassified 1439
501 Ga0495601_0134467 3300053077 Bacteria 1611
502 Ga0495619_0116979 3300053085 Bacteria 1825
503 Ga0213876_10001438
504 CNXas_1000382
505 JGI24035J26624_1002346
506 JGI25406J46586_10000023
507 Ga0065704_10162264
508 Ga0065712_10007547
509 Ga0065712_10115221
510 Ga0065712_10151695
511 Ga0065715_10001773
512 Ga0065707_10006006
513 Ga0070658_10020004
514 Ga0070658_10029659
515 Ga0070658_10134476
516 Ga0070658_10159233
517 Ga0070676_10002923
518 Ga0070676_10012692
519 Ga0070676_10018442
520 Ga0070676_10065346
521 Ga0070683_100053148
522 Ga0070690_100097786
523 Ga0070690_100568227
524 Ga0070670_100005320
525 Ga0070670_100006708
526 Ga0070670_100026824
527 Ga0070670_100112690
528 Ga0070670_100210319
529 Ga0070677_10023490
530 Ga0070677_10138660
531 Ga0068869_100270956
532 Ga0070666_10005510
533 Ga0070666_10061459
534 Ga0070666_10122269
535 Ga0070666_10425795
536 Ga0068868_100076108
537 Ga0068868_100159304
538 Ga0068868_100165307
539 Ga0068868_100251472
540 Ga0068868_100493100
541 Ga0070660_100046737
542 Ga0070660_100064592
543 Ga0070689_100292044
544 Ga0070691_10145511
545 Ga0070661_100113246
546 Ga0070668_100002392
547 Ga0070668_100017294
548 Ga0070668_100025289
549 Ga0070669_100009421
550 Ga0070669_100012301
551 Ga0070669_100304104
552 Ga0070675_100010789
553 Ga0070675_100059781
554 Ga0070675_100108573
555 Ga0070675_100143007
556 Ga0070675_100158210
557 Ga0070671_100004750
558 Ga0070671_100069906
559 Ga0070671_100247898
560 Ga0070671_100313908
561 Ga0070674_100003820
562 Ga0070674_100016618
563 Ga0070674_100239453
564 Ga0070674_100356650
565 Ga0070673_100019760
566 Ga0070673_100020468
567 Ga0070673_100240659
568 Ga0070688_100009213
569 Ga0070688_100198870
570 Ga0070667_100014735
571 Ga0070667_100035329
572 Ga0070667_100035605
573 Ga0070667_100079668
574 Ga0070667_100109467
575 Ga0070714_100098117
576 Ga0070714_100208400
577 Ga0070714_100209009
578 Ga0070714_100272972
579 Ga0070714_100624726
580 Ga0070713_100175055
581 Ga0070713_100677211
582 Ga0070711_100025400
583 Ga0070711_100033883
584 Ga0070711_100201566
585 Ga0070700_100528666
586 Ga0070708_100055215
587 Ga0070708_100343544
588 Ga0070708_100398383
589 Ga0070678_100134973
590 Ga0070678_100139834
591 Ga0070678_100240186
592 Ga0070662_100278330
593 Ga0068867_100006507
594 Ga0070706_100000973
595 Ga0070706_100025763
596 Ga0070706_100085389
597 Ga0070706_100086118
598 Ga0070706_100086901
599 Ga0070706_100152683
600 Ga0070706_100192325
601 Ga0070706_100208369
602 Ga0070706_100334651
603 Ga0070707_100019586
604 Ga0070707_100035472
605 Ga0070707_100053866
606 Ga0070707_100060619
607 Ga0070707_100125541
608 Ga0070707_100143743
609 Ga0070707_100764700
610 Ga0070698_100001144
611 Ga0070698_100004844
612 Ga0070698_100026631
613 Ga0070698_100037336
614 Ga0070698_100395986
615 Ga0070699_100091499
616 Ga0070699_100206480
617 Ga0070679_100765796
618 Ga0070697_100001763
619 Ga0070697_100006844
620 Ga0070697_100025379
621 Ga0070697_100045936
622 Ga0070697_100179633
623 Ga0070697_100273453
624 Ga0070697_100296765
625 Ga0068853_100000011
626 Ga0070672_100011259
627 Ga0070695_100247823
628 Ga0070696_100327680
629 Ga0070665_100000772
630 Ga0070665_100004925
631 Ga0070665_100008642
632 Ga0070665_100099861
633 Ga0070665_100732598
634 Ga0068855_100057644
635 Ga0068855_100080775
636 Ga0068855_100327224
637 Ga0068855_100855140
638 Ga0070664_100136539
639 Ga0068856_100340662
640 Ga0068859_100874871
641 Ga0068864_100031014
642 Ga0068866_10003045
643 Ga0068866_10077663
644 Ga0068861_100075982
645 Ga0068863_100107086
646 Ga0068863_100126845
647 Ga0068858_100041846
648 Ga0068858_100099131
649 Ga0068858_100667818
650 Ga0068862_100084148
651 Ga0068862_100634234
652 Ga0081539_10000014
653 Ga0081539_10000710
654 Ga0081539_10006328
655 Ga0070717_10013229
656 Ga0070717_10043561
657 Ga0070717_10086635
658 Ga0070717_10131430
659 Ga0070717_10199955
660 Ga0070716_100058213
661 Ga0070712_100009931
662 Ga0070712_100022325
663 Ga0070712_100052217
664 Ga0070712_100112065
665 Ga0070712_100239676
666 Ga0070712_100316698
667 Ga0097621_100004502
668 Ga0097621_100081762
669 Ga0097621_100308188
670 Ga0097621_100388288
671 Ga0068871_100040008
672 Ga0068871_100195222
673 Ga0068871_100303880
674 Ga0075430_100021635
675 Ga0075434_100197461
676 Ga0068865_100098170
677 Ga0068865_100238865
678 Ga0097620_100874702
679 Ga0099795_10003993
680 Ga0099795_10077478
681 Ga0105240_10000057
682 Ga0105240_10018462
683 Ga0111539_10112062
684 Ga0111539_10298822
685 Ga0105245_10024665
686 Ga0105245_10084114
687 Ga0105245_10150385
688 Ga0105245_10205710
689 Ga0105247_10042622
690 Ga0114129_10907403
691 Ga0105241_10352370
692 Ga0105242_10007257
693 Ga0105242_10016185
694 Ga0105237_10005488
695 Ga0105249_10285746
696 Ga0099796_10021508
697 Ga0105239_10035778
698 Ga0105239_10201434
699 Ga0105239_10279156
700 Ga0157373_10127739
701 Ga0157371_10187751
702 Ga0157370_10095063
703 Ga0157370_10199597
704 Ga0157369_10100533
705 Ga0157369_10188536
706 Ga0157369_10242375
707 Ga0157374_10011892
708 Ga0157374_10033019
709 Ga0157374_10054807
710 Ga0157374_10447850
711 Ga0157378_10032112
712 Ga0157378_10039368
713 Ga0157378_10177214
714 Ga0157378_10180162
715 Ga0163162_10020938
716 Ga0163162_10026233
717 Ga0163162_10157827
718 Ga0163162_10818274
719 Ga0157372_10067032
720 Ga0157372_10131216
721 Ga0157372_10426175
722 Ga0157375_10003770
723 Ga0157375_10009538
724 Ga0157375_10034179
725 Ga0157375_10112623
726 Ga0157375_10166101
727 Ga0157375_10235877
728 Ga0157375_10383176
729 Ga0163163_10121331
730 Ga0157379_10636717
731 Ga0157376_10007798
732 Ga0163161_10000942
733 Ga0213872_10011117
734 Ga0213872_10021749
735 Ga0213872_10043134
736 Ga0213872_10081131
737 Ga0213872_10100578
738 Ga0213874_10015345
739 Ga0213876_10015390
740 Ga0213871_10004130
741 Ga0213871_10015935
742 Ga0207673_1003719
743 Ga0207697_10000238
744 Ga0207697_10000262
745 Ga0207697_10018575
746 Ga0207697_10099162
747 Ga0207642_10139221
748 Ga0207688_10000429
749 Ga0207688_10000823
750 Ga0207680_10026298
751 Ga0207680_10031477
752 Ga0207680_10040126
753 Ga0207680_10156307
754 Ga0207699_10004399
755 Ga0207699_10183450
756 Ga0207699_10315003
757 Ga0207699_10349132
758 Ga0207645_10000823
759 Ga0207645_10015174
760 Ga0207645_10040071
761 Ga0207645_10091809
762 Ga0207705_10058972
763 Ga0207684_10001687
764 Ga0207684_10049137
765 Ga0207684_10120686
766 Ga0207684_10152052
767 Ga0207684_10188176
768 Ga0207684_10214002
769 Ga0207684_10238014
770 Ga0207684_10307092
771 Ga0207695_10000072
772 Ga0207695_10000450
773 Ga0207671_10039468
774 Ga0207693_10002474
775 Ga0207693_10006817
776 Ga0207693_10070160
777 Ga0207693_10101281
778 Ga0207693_10119018
779 Ga0207663_10001758
780 Ga0207663_10138907
781 Ga0207663_10155606
782 Ga0207663_10533298
783 Ga0207662_10064006
784 Ga0207657_10106039
785 Ga0207649_10329054
786 Ga0207646_10000513
787 Ga0207646_10066818
788 Ga0207646_10104602
789 Ga0207646_10447152
790 Ga0207681_10011020
791 Ga0207681_10022182
792 Ga0207650_10021161
793 Ga0207650_10048973
794 Ga0207650_10147270
795 Ga0207650_10215342
796 Ga0207659_10007927
797 Ga0207659_10063229
798 Ga0207659_10063739
799 Ga0207659_10098013
800 Ga0207687_10037865
801 Ga0207687_10150507
802 Ga0207700_10034697
803 Ga0207700_10075642
804 Ga0207664_10139724
805 Ga0207664_10146017
806 Ga0207664_10197020
807 Ga0207664_10207085
808 Ga0207664_10218473
809 Ga0207644_10005188
810 Ga0207644_10034397
811 Ga0207644_10086924
812 Ga0207644_10106055
813 Ga0207644_10178446
814 Ga0207644_10279564
815 Ga0207644_10532932
816 Ga0207690_10108432
817 Ga0207706_10036106
818 Ga0207706_10084820
819 Ga0207706_10151613
820 Ga0207686_10008278
821 Ga0207686_10311426
822 Ga0207670_10553891
823 Ga0207669_10009962
824 Ga0207669_10012468
825 Ga0207669_10062587
826 Ga0207669_10081094
827 Ga0207669_10277044
828 Ga0207704_10032009
829 Ga0207704_10393596
830 Ga0207665_10010290
831 Ga0207691_10000306
832 Ga0207691_10003086
833 Ga0207691_10003406
834 Ga0207691_10036248
835 Ga0207691_10358566
836 Ga0207679_10118737
837 Ga0207667_10025782
838 Ga0207651_10045287
839 Ga0207651_10052267
840 Ga0207651_10105071
841 Ga0207651_10253309
842 Ga0207668_10011447
843 Ga0207668_10021024
844 Ga0207668_10025525
845 Ga0207668_10227849
846 Ga0207668_10536475
847 Ga0207658_10146322
848 Ga0207658_10488118
849 Ga0207677_10007188
850 Ga0207677_10054821
851 Ga0207703_10026174
852 Ga0207703_10347165
853 Ga0207703_10709336
854 Ga0207639_10000019
855 Ga0207678_10618252
856 Ga0207702_10045597
857 Ga0207702_10148752
858 Ga0207641_10025333
859 Ga0207641_10136286
860 Ga0207648_10014184
861 Ga0207676_10102430
862 Ga0207674_10003625
863 Ga0207683_10002031
864 Ga0207683_10019180
865 Ga0207683_10021171
866 Ga0268266_10010104
867 Ga0268266_10020958
868 Ga0268266_10279768
869 Ga0268266_10342542
870 Ga0268266_10428906
871 Ga0268265_10049204
872 Ga0268265_10575427
873 Ga0268264_10043163
874 Ga0265330_10150754
875 Ga0265316_10208554
876 Ga0307513_10137766
877 Ga0307413_10307916
878 Ga0307410_10025821
879 Ga0307409_100118727
880 Ga0307409_100433081
881 Ga0307416_100082683
882 Ga0307416_100557434
883 Ga0307416_100973830
884 Ga0307411_10141997
885 Ga0373926_0048133
886 Ga0373954_0204689
887 Ga0373943_0128896
888 Ga0373946_0011788
889 Ga0373955_0020926
890 Ga0373924_0036750
891 Ga0373931_0214025
892 Ga0373935_0010731
893 Ga0373935_0076518
894 Ga0373947_0033533
895 Ga0373937_0007726
896 Ga0373937_0142912
897 Ga0373937_0393484
898 Ga0373925_0174691
899 Ga0373925_0539072
900 Ga0395899_0190865
901 Ga0395900_0387631
902 Ga0436364_0367939
903 Ga0436364_1196405
904 Ga0395901_0012233
905 Ga0395901_0103973
906 Ga0436365_0071258
907 Ga0436365_0761885
908 Ga0436365_0818660
909 Ga0436365_0831869
910 Ga0436365_1923965
911 Ga0436360_0105884
912 Ga0436360_0554333
913 Ga0436360_0829103
914 Ga0436360_0832359
915 Ga0436360_0981398
916 Ga0436361_0132728
917 Ga0436361_0138991
918 Ga0436361_0172514
919 Ga0436361_0266084
920 Ga0436361_0381704
921 Ga0436361_0432650
922 Ga0436361_0523568
923 Ga0436361_0955202
924 Ga0436361_1041738
925 Ga0436361_1194033
926 Ga0436363_0639431
927 Ga0436363_1682874
928 Ga0436362_0402008
929 Ga0436362_0556011
930 Ga0451807_0876074
931 Ga0451576_0033056
932 Ga0451576_0803002
933 Ga0466967_0316681
934 Ga0495592_0048276
935 Ga0495608_0240038
936 Ga0495630_0000483
937 Ga0495630_0041259
938 Ga0495643_0000105
939 Ga0495652_0020595
940 Ga0495640_0039060
941 Ga0495640_0254874
942 Ga0495586_0122231
943 Ga0495645_0051896
944 Ga0495667_0311402
945 Ga0495656_0088395
946 Ga0495634_0125553
947 Ga0495659_0117514
948 Ga0495657_0212005
949 Ga0495646_0072704
950 Ga0495658_0170572
951 Ga0495613_0002425
952 Ga0495613_0105084
953 Ga0495624_0081404
954 Ga0495600_0076220
955 Ga0495581_0041815
956 Ga0495674_0017129
957 Ga0495674_0179986
958 Ga0495684_0002085
959 Ga0495684_0084626
960 Ga0495684_0105987
961 Ga0495684_0249450
962 Ga0496100_0002986
963 Ga0496100_0034627
964 Ga0496101_0045884
965 Ga0496102_0679097
966 Ga0496103_0003746
967 Ga0496104_0014922
968 Ga0496104_0141459
969 Ga0496104_0224590
970 Ga0496106_0000430
971 Ga0496107_0000174
972 Ga0496108_0017250
973 Ga0496108_0452049
974 Ga0496108_0627917
975 Ga0496109_0055891
976 Ga0496109_0104354
977 Ga0496109_0149302
978 Ga0496109_0548937
979 Ga0496111_0303169
980 Ga0496112_0006024
981 Ga0496112_0010611
982 Ga0496112_0011331
983 Ga0496112_0016762
984 Ga0496112_0019136
985 Ga0496113_0042830
986 Ga0496113_0141403
987 Ga0496114_0024795
988 Ga0496115_0003485
989 Ga0496115_0035536
990 Ga0496115_0338787
991 Ga0501032_0039123
992 Ga0501034_0003936
993 Ga0501037_0019049
994 Ga0501047_0006754
995 Ga0501080_0013875
996 Ga0501080_0039506
997 Ga0501044_0000774
998 Ga0501044_0140375
999 nmdc:mga08y16_280607_c1
1000 nmdc:mga08y16_315830_c1
1001 nmdc:mga0n895_38298_c1
1002 nmdc:mga0rr50_261729_c1
1003 Ga0495601_0134467
1004 Ga0495619_0116979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

207

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

126

240

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9763 4 246
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9719 4 246
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9717 4 245
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9677 4 246
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9628 4 245
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9894 4 245 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9846 1 246 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9657 4 245 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9624 17 242 3.40.50.300
af_P16678_3_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 4 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G0E135-F1-model_v4 ABC transporter ATP-binding protein 0.9924 4 244 GO:0005524
GO:0016887
AF-A0A640P064-F1-model_v4 ABC transporter ATP-binding protein 0.9903 4 245 GO:0005524
GO:0016887
AF-A0A5C7SZM3-F1-model_v4 ABC transporter ATP-binding protein 0.9897 4 246 GO:0005524
GO:0005886
GO:0016887
AF-A0A2N7JK81-F1-model_v4 ABC transporter ATP-binding protein 0.9883 4 246 GO:0005524
GO:0016887
AF-A0A0A8XEL2-F1-model_v4 Toluene tolerance efflux transporter ABC superfamily, ATP-bind 0.9866 4 245 GO:0005524
GO:0016887

Map