F455886

General Info

Members Datasets Scaffolds Average Seq Length
502 316 1005 165

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0261163|Ga0451793_0261163_159_722
Length 181
Sequence LQQRARPPGLPRRAFLFEATGHAMKQALLTLDRWTSSFSMAVACLMLTIASALGVFQIVTRFVLEQPAEWSEILIRMSLIWMVFMGIPTAFRQGAMVSVDVLYRWSPPEFRRVLDWVVCLAALVWWGWDYAQRGGVQSMAGLESVSMFWAYLAMPVGGLFCVIGILANLADPQRNELDTAQ

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
137 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
138 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
139 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
140 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
159 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
164 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
179 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
180 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
181 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
184 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
232 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
246 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
251 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
252 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
253 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
254 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
255 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
267 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
271 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
275 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
281 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
282 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
283 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
284 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
287 2643221570 Acidovorax sp. Root568 Isolate Unclassified
288 2643221596 Acidovorax sp. Root70 Isolate Unclassified
289 2643221609 Acidovorax sp. Root217 Isolate Unclassified
290 2643221611 Acidovorax sp. Root219 Isolate Unclassified
291 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
292 2643221652 Acidovorax sp. Root402 Isolate Unclassified
293 2643221658 Variovorax sp. Root411 Isolate Unclassified
294 2643221672 Variovorax sp. Root434 Isolate Unclassified
295 2643221683 Variovorax sp. Root473 Isolate Unclassified
296 2643221717 Acidovorax sp. Root267 Isolate Unclassified
297 2738541277 Variovorax sp. GV051 Isolate Unclassified
298 2738543019 Variovorax sp. GV040 Isolate Unclassified
299 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
300 2842677519 Variovorax sp. R-72495 Isolate Unclassified
301 2842747753 Variovorax sp. R-72060 Isolate Unclassified
302 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
303 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
304 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
305 2885198086 Variovorax sp. 679 Isolate Unclassified
306 2885211737 Variovorax sp. 553 Isolate Unclassified
307 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
308 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
309 2904456579 Variovorax sp. 2002 Isolate Unclassified
310 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
311 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
312 2929520902 Variovorax beijingensis 502 Isolate Unclassified
313 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
314 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
315 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
316 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.82
Metatranscriptomes 0.2
Isolates 5.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.3
Nodule 0.8
Rhizoplane 4.18
Rhizosphere 59.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_0261163 3300041452 Bacteria 739
2 SwRhRL2b_contig_1147302 2162886007 Bacteria 815
3 JGI25156J39149_1000148 3300002705 Bacteria 51890
4 JGI25154J39366_1000155 3300002738 Bacteria 52889
5 JGI25157J39369_1000183 3300002741 Bacteria 52889
6 JGI25152J39213_1003568 3300002773 Bacteria 5266
7 JGI25159J45721_1007514 3300002987 Bacteria 3116
8 JGI25151J46595_10016629 3300003187 Bacteria 3212
9 JGI25153J46596_10014853 3300003215 Bacteria 3212
10 rootH1_10052795 3300003316 Bacteria 1283
11 rootH1_10052795 3300003323 Bacteria 11001
12 JGI25160J50197_1031205 3300003354 Bacteria 1376
13 Ga0006562J51391_1062293 3300003578 Bacteria 800
14 Ga0055526_1003224 3300003771 Bacteria 10518
15 Ga0055526_1007263 3300003771 Bacteria 5806
16 Ga0055537_1000067 3300003773 Bacteria 75689
17 Ga0055537_1000086 3300003773 Bacteria 67416
18 Ga0055524_1000279 3300003775 Bacteria 50624
19 Ga0055536_1001302 3300003781 Bacteria 15354
20 Ga0055536_1005425 3300003781 Bacteria 6237
21 Ga0055534_1000079 3300003784 Bacteria 75689
22 Ga0055534_1002371 3300003784 Bacteria 6573
23 Ga0055534_1039205 3300003784 Bacteria 703
24 Ga0055528_1001037 3300003790 Bacteria 18378
25 Ga0055528_1005743 3300003790 Bacteria 5716
26 Ga0055528_1013543 3300003790 Bacteria 3082
27 Ga0055530_10000730 3300003791 Bacteria 27505
28 Ga0055530_10001255 3300003791 Bacteria 19265
29 Ga0055530_10002701 3300003791 Bacteria 11037
30 Ga0055530_10006113 3300003791 Bacteria 5473
31 Ga0055540_1000553 3300003792 Bacteria 27912
32 Ga0055540_1008030 3300003792 Bacteria 3861
33 Ga0055540_1015457 3300003792 Bacteria 2221
34 Ga0055531_10000726 3300003794 Bacteria 27911
35 Ga0055531_10000873 3300003794 Bacteria 24722
36 Ga0055531_10021958 3300003794 Bacteria 2452
37 Ga0065165_1007358 3300005262 Bacteria 5441
38 Ga0065165_1031470 3300005262 Bacteria 1676
39 Ga0065714_10208485 3300005288 Bacteria 872
40 Ga0065714_10220428 3300005288 Bacteria 840
41 Ga0065714_10244725 3300005288 Bacteria 787
42 Ga0065704_10092299 3300005289 Bacteria 2663
43 Ga0065704_10101719 3300005289 Bacteria 2228
44 Ga0070676_10448286 3300005328 Bacteria 907
45 Ga0070676_10763020 3300005328 Bacteria 711
46 Ga0070670_100257843 3300005331 Bacteria 1520
47 Ga0070677_10037328 3300005333 Bacteria 1895
48 Ga0070666_10035821 3300005335 Bacteria 3291
49 Ga0068868_100174139 3300005338 Bacteria 1783
50 Ga0070675_100350489 3300005354 Bacteria 1309
51 Ga0070675_100911185 3300005354 Bacteria 806
52 Ga0070671_100020401 3300005355 Bacteria 5405
53 Ga0070674_100286594 3300005356 Bacteria 1308
54 Ga0070673_100058082 3300005364 Bacteria 3058
55 Ga0070667_100157089 3300005367 Bacteria 2001
56 Ga0070678_100138986 3300005456 Bacteria 1941
57 Ga0070678_100182054 3300005456 Bacteria 1721
58 Ga0070678_100880435 3300005456 Bacteria 817
59 Ga0070662_100005845 3300005457 Bacteria 7895
60 Ga0068867_100014481 3300005459 Bacteria 5589
61 Ga0068867_101379558 3300005459 Bacteria 653
62 Ga0068853_100008771 3300005539 Bacteria 8133
63 Ga0068853_100353919 3300005539 Bacteria 1366
64 Ga0068853_101351582 3300005539 Bacteria 689
65 Ga0070672_100109451 3300005543 Bacteria 2250
66 Ga0070665_100045803 3300005548 Bacteria 4393
67 Ga0070664_100367553 3300005564 Bacteria 1311
68 Ga0068857_100251748 3300005577 Bacteria 1619
69 Ga0068852_100516348 3300005616 Bacteria 1191
70 Ga0068859_100165698 3300005617 Bacteria 2290
71 Ga0068859_100180589 3300005617 Bacteria 2193
72 Ga0068859_102118244 3300005617 Bacteria 621
73 Ga0068864_100282451 3300005618 Bacteria 1550
74 Ga0068870_10733247 3300005840 Bacteria 685
75 Ga0068863_100106076 3300005841 Bacteria 2673
76 Ga0068863_100187941 3300005841 Bacteria 1985
77 Ga0068860_100274847 3300005843 Bacteria 1645
78 Ga0068860_100559990 3300005843 Bacteria 1146
79 Ga0068860_100690603 3300005843 Bacteria 1030
80 Ga0081455_10467828 3300005937 Bacteria 856
81 Ga0075365_10694402 3300006038 Bacteria 719
82 Ga0075363_100017606 3300006048 Bacteria 3546
83 Ga0075364_10130605 3300006051 Bacteria 1686
84 Ga0075364_10154607 3300006051 Bacteria 1547
85 Ga0075362_10060604 3300006177 Bacteria 1711
86 Ga0075367_10021333 3300006178 Bacteria 3618
87 Ga0075369_10061085 3300006186 Bacteria 1644
88 Ga0097621_100220761 3300006237 Bacteria 1652
89 Ga0097621_100347164 3300006237 Bacteria 1319
90 Ga0097621_100621599 3300006237 Bacteria 989
91 Ga0075370_10000356 3300006353 Bacteria 16689
92 Ga0075370_10000594 3300006353 Bacteria 13976
93 Ga0075370_10006193 3300006353 Bacteria 6003
94 Ga0075370_10140276 3300006353 Bacteria 1413
95 Ga0075370_10235640 3300006353 Bacteria 1083
96 Ga0068871_100020569 3300006358 Bacteria 5058
97 Ga0075430_100071251 3300006846 Bacteria 2916
98 Ga0068865_100319692 3300006881 Bacteria 1248
99 Ga0097620_100165698 3300006931 Bacteria 2290
100 Ga0097620_100180598 3300006931 Bacteria 2193
101 Ga0097620_102117822 3300006931 Bacteria 621
102 Ga0079104_1035134 3300006946 Bacteria 1212
103 Ga0099826_10023668 3300006948 Bacteria 4572
104 Ga0105244_10007302 3300009036 Bacteria 7030
105 Ga0105240_10176561 3300009093 Bacteria 2525
106 Ga0105243_10001470 3300009148 Bacteria 20672
107 Ga0105243_10192604 3300009148 Bacteria 1782
108 Ga0105242_10425674 3300009176 Bacteria 1245
109 Ga0105248_10021049 3300009177 Bacteria 7226
110 Ga0105237_10498930 3300009545 Bacteria 1224
111 Ga0105249_10384831 3300009553 Bacteria 1430
112 Ga0105246_10010775 3300011119 Bacteria 5667
113 Ga0157373_10266450 3300013100 Bacteria 1213
114 Ga0157371_10197097 3300013102 Bacteria 1443
115 Ga0157370_10393191 3300013104 Bacteria 1276
116 Ga0157370_10700836 3300013104 Bacteria 924
117 Ga0163162_10764197 3300013306 Bacteria 1085
118 Ga0163162_10790687 3300013306 Bacteria 1067
119 Ga0163162_11416703 3300013306 Bacteria 791
120 Ga0157375_10069884 3300013308 Bacteria 3519
121 Ga0157375_10455269 3300013308 Bacteria 1445
122 Ga0157375_10484430 3300013308 Bacteria 1402
123 Ga0163163_10062944 3300014325 Bacteria 3678
124 Ga0182008_10000330 3300014497 Bacteria 37364
125 Ga0182008_10002376 3300014497 Bacteria 11835
126 Ga0182008_10003615 3300014497 Bacteria 9255
127 Ga0182008_10175802 3300014497 Bacteria 1082
128 Ga0157379_10640779 3300014968 Bacteria 994
129 Ga0157379_10979629 3300014968 Bacteria 805
130 Ga0157376_11660253 3300014969 Bacteria 674
131 Ga0182006_1001221 3300015261 Bacteria 16037
132 Ga0182006_1029509 3300015261 Bacteria 2221
133 Ga0182007_10003876 3300015262 Bacteria 6937
134 Ga0182007_10014003 3300015262 Bacteria 3039
135 Ga0182005_1022863 3300015265 Bacteria 1711
136 Ga0163161_10080119 3300017792 Bacteria 2403
137 Ga0163161_10375954 3300017792 Bacteria 1134
138 Ga0209435_100014 3300025206 Bacteria 322129
139 Ga0207425_1004043 3300025245 Bacteria 4498
140 Ga0207425_1005751 3300025245 Bacteria 3490
141 Ga0209646_1000001 3300025246 Bacteria 3092932
142 Ga0209026_1000137 3300025250 Bacteria 116282
143 Ga0209759_1000013 3300025256 Bacteria 399300
144 Ga0209129_1004105 3300025258 Bacteria 5923
145 Ga0209565_1000028 3300025263 Bacteria 348536
146 Ga0209565_1000040 3300025263 Bacteria 266543
147 Ga0209565_1037363 3300025263 Bacteria 919
148 Ga0209673_1000035 3300025273 Bacteria 328411
149 Ga0209673_1000109 3300025273 Bacteria 183000
150 Ga0209130_1000759 3300025284 Bacteria 27970
151 Ga0209130_1008079 3300025284 Bacteria 3152
152 Ga0209675_1000024 3300025291 Bacteria 312615
153 Ga0209675_1000111 3300025291 Bacteria 114805
154 Ga0209675_1002085 3300025291 Bacteria 10625
155 Ga0209675_1041061 3300025291 Bacteria 1012
156 Ga0209676_1000005 3300025292 Bacteria 1076001
157 Ga0209676_1000254 3300025292 Bacteria 113136
158 Ga0209676_1000634 3300025292 Bacteria 50573
159 Ga0209025_1001864 3300025294 Bacteria 24710
160 Ga0209025_1006211 3300025294 Bacteria 9376
161 Ga0209025_1007844 3300025294 Bacteria 7837
162 Ga0209025_1023144 3300025294 Bacteria 3261
163 Ga0209025_1030314 3300025294 Bacteria 2592
164 Ga0209564_1000531 3300025295 Bacteria 62085
165 Ga0209564_1000714 3300025295 Bacteria 48032
166 Ga0209564_1006417 3300025295 Bacteria 6350
167 Ga0209564_1042932 3300025295 Bacteria 1192
168 Ga0209758_1019515 3300025297 Bacteria 3264
169 Ga0209050_1000007 3300025298 Bacteria 1187891
170 Ga0209050_1000023 3300025298 Bacteria 537172
171 Ga0209050_1000497 3300025298 Bacteria 66982
172 Ga0209050_1021478 3300025298 Bacteria 2351
173 Ga0209256_1000003 3300025299 Bacteria 1661127
174 Ga0207426_1007615 3300025302 Bacteria 4505
175 Ga0207426_1011012 3300025302 Bacteria 3474
176 Ga0209051_1000009 3300025303 Bacteria 706778
177 Ga0209051_1000017 3300025303 Bacteria 537172
178 Ga0209051_1000073 3300025303 Bacteria 208874
179 Ga0209051_1000262 3300025303 Bacteria 87898
180 Ga0209257_1000011 3300025304 Bacteria 1112630
181 Ga0209257_1000041 3300025304 Bacteria 537172
182 Ga0209257_1000139 3300025304 Bacteria 202285
183 Ga0207655_1005174 3300025728 Bacteria 8973
184 Ga0207680_10069218 3300025903 Bacteria 2180
185 Ga0207680_10145949 3300025903 Bacteria 1573
186 Ga0207645_10071330 3300025907 Bacteria 2223
187 Ga0207705_10314981 3300025909 Bacteria 1201
188 Ga0207671_10080902 3300025914 Bacteria 2436
189 Ga0207681_10084608 3300025923 Bacteria 2249
190 Ga0207650_10250350 3300025925 Bacteria 1434
191 Ga0207659_10020357 3300025926 Bacteria 4384
192 Ga0207659_10095802 3300025926 Bacteria 2226
193 Ga0207659_11242150 3300025926 Bacteria 640
194 Ga0207690_11056496 3300025932 Bacteria 676
195 Ga0207706_10021250 3300025933 Bacteria 5830
196 Ga0207686_10860614 3300025934 Bacteria 730
197 Ga0207709_10012378 3300025935 Bacteria 4701
198 Ga0207669_10263647 3300025937 Bacteria 1290
199 Ga0207669_10490385 3300025937 Bacteria 981
200 Ga0207691_10003024 3300025940 Bacteria 16412
201 Ga0207691_10842993 3300025940 Bacteria 769
202 Ga0207711_10138409 3300025941 Bacteria 2188
203 Ga0207689_10452042 3300025942 Bacteria 1074
204 Ga0207679_10565213 3300025945 Bacteria 1022
205 Ga0207651_10205333 3300025960 Bacteria 1582
206 Ga0207712_10314886 3300025961 Bacteria 1289
207 Ga0207658_10314216 3300025986 Bacteria 1354
208 Ga0207658_10760107 3300025986 Bacteria 878
209 Ga0207708_10223560 3300026075 Bacteria 1509
210 Ga0207641_10196883 3300026088 Bacteria 1855
211 Ga0207641_10325008 3300026088 Bacteria 1459
212 Ga0207648_10096297 3300026089 Bacteria 2590
213 Ga0207676_10266574 3300026095 Bacteria 1549
214 Ga0207674_10099674 3300026116 Bacteria 2887
215 Ga0207674_10526484 3300026116 Bacteria 1142
216 Ga0207683_10120290 3300026121 Bacteria 2357
217 Ga0207683_10164173 3300026121 Bacteria 2009
218 Ga0207683_10166039 3300026121 Bacteria 1997
219 Ga0207683_10217897 3300026121 Bacteria 1739
220 Ga0207698_10637899 3300026142 Bacteria 1054
221 Ga0209969_1009798 3300027360 Bacteria 1367
222 Ga0209282_1021662 3300027666 Bacteria 4060
223 Ga0209971_1003310 3300027682 Bacteria 3830
224 Ga0268265_10344320 3300028380 Bacteria 1359
225 Ga0268264_10165665 3300028381 Bacteria 1995
226 Ga0307512_10176703 3300030522 Bacteria 1210
227 Ga0316176_1137038 3300030732 Bacteria 1256
228 Ga0314311_1236547 3300030733 Bacteria 2986
229 Ga0316178_1079536 3300030735 Bacteria 1854
230 Ga0316183_1023302 3300030742 Bacteria 3715
231 Ga0316181_1018571 3300030744 Bacteria 1058
232 Ga0316182_1304162 3300030745 Bacteria 2476
233 Ga0307513_10000011 3300031456 Bacteria 354929
234 Ga0307408_100000048 3300031548 Bacteria 165579
235 Ga0307408_100015366 3300031548 Bacteria 5095
236 Ga0307408_100123977 3300031548 Bacteria 2006
237 Ga0307408_100138275 3300031548 Bacteria 1908
238 Ga0307408_100195513 3300031548 Bacteria 1633
239 Ga0307408_100245264 3300031548 Bacteria 1474
240 Ga0307408_100340198 3300031548 Bacteria 1270
241 Ga0307408_100393913 3300031548 Bacteria 1187
242 Ga0307514_10009341 3300031649 Bacteria 8255
243 Ga0307514_10023261 3300031649 Bacteria 5027
244 Ga0307516_10029170 3300031730 Bacteria 5579
245 Ga0307516_10035762 3300031730 Bacteria 4979
246 Ga0307405_10136890 3300031731 Bacteria 1701
247 Ga0307405_10168019 3300031731 Bacteria 1561
248 Ga0307405_10568583 3300031731 Bacteria 920
249 Ga0307405_10769957 3300031731 Bacteria 803
250 Ga0307413_11174528 3300031824 Bacteria 666
251 Ga0307406_10000230 3300031901 Bacteria 34225
252 Ga0307406_10002497 3300031901 Bacteria 10022
253 Ga0307406_10007292 3300031901 Bacteria 6125
254 Ga0307406_10445149 3300031901 Bacteria 1038
255 Ga0307406_10556642 3300031901 Bacteria 939
256 Ga0307406_11112723 3300031901 Bacteria 682
257 Ga0307412_10055484 3300031911 Bacteria 2635
258 Ga0307412_10110408 3300031911 Bacteria 1962
259 Ga0307412_10571721 3300031911 Bacteria 952
260 Ga0307412_10621723 3300031911 Bacteria 917
261 Ga0307412_10729195 3300031911 Bacteria 853
262 Ga0307412_10788973 3300031911 Bacteria 823
263 Ga0307412_11091550 3300031911 Bacteria 710
264 Ga0307409_100623054 3300031995 Bacteria 1069
265 Ga0307416_101489273 3300032002 Bacteria 782
266 Ga0307414_10033311 3300032004 Bacteria 3404
267 Ga0307414_10112577 3300032004 Bacteria 2075
268 Ga0307414_10231508 3300032004 Bacteria 1524
269 Ga0307411_10482188 3300032005 Bacteria 1044
270 Ga0307411_10738926 3300032005 Bacteria 861
271 Ga0307411_10776498 3300032005 Bacteria 841
272 Ga0395905_0471821 3300037471 Bacteria 1154
273 Ga0395901_0377624 3300038443 Bacteria 1459
274 Ga0439436_0006824 3300041404 Bacteria 3507
275 Ga0439439_0006453 3300041406 Bacteria 2713
276 Ga0439439_0059505 3300041406 Bacteria 1012
277 Ga0439447_039502 3300041407 Bacteria 1155
278 Ga0439447_061694 3300041407 Bacteria 881
279 Ga0439461_0019374 3300041410 Bacteria 1339
280 Ga0439461_0084070 3300041410 Bacteria 755
281 Ga0439461_0151518 3300041410 Bacteria 599
282 Ga0439466_0005061 3300041411 Bacteria 5054
283 Ga0439466_0069519 3300041411 Bacteria 1123
284 Ga0439466_0086335 3300041411 Bacteria 986
285 Ga0439465_0016273 3300041413 Bacteria 2320
286 Ga0451800_0179475 3300041459 Bacteria 665
287 Ga0451804_1144560 3300041463 Bacteria 822
288 Ga0439431_0007487 3300041997 Bacteria 2436
289 Ga0439431_0029454 3300041997 Bacteria 1356
290 Ga0439431_0055697 3300041997 Bacteria 1033
291 Ga0439433_0046054 3300041999 Bacteria 1021
292 Ga0439442_010382 3300042002 Bacteria 1888
293 Ga0439442_084137 3300042002 Bacteria 682
294 Ga0439445_0139342 3300042004 Bacteria 703
295 Ga0439432_010077 3300042006 Bacteria 3284
296 Ga0439432_017417 3300042006 Bacteria 2411
297 Ga0439449_0000754 3300042007 Bacteria 12445
298 Ga0439449_0005184 3300042007 Bacteria 5000
299 Ga0439449_0031419 3300042007 Bacteria 1979
300 Ga0439452_001220 3300042010 Bacteria 10956
301 Ga0439452_019313 3300042010 Bacteria 1804
302 Ga0439452_088832 3300042010 Bacteria 669
303 Ga0439457_010767 3300042014 Bacteria 2094
304 Ga0439457_027632 3300042014 Bacteria 1256
305 Ga0439457_055070 3300042014 Bacteria 896
306 Ga0439462_0024040 3300042015 Bacteria 1598
307 Ga0439463_069823 3300042016 Bacteria 900
308 Ga0450911_013255 3300042115 Bacteria 1104
309 Ga0450920_018295 3300042122 Bacteria 1341
310 Ga0450923_022881 3300042125 Bacteria 1228
311 Ga0450923_036391 3300042125 Bacteria 1021
312 Ga0450894_009230 3300042131 Bacteria 1278
313 Ga0450894_020521 3300042131 Bacteria 891
314 Ga0450896_019672 3300042133 Bacteria 984
315 Ga0450896_021543 3300042133 Bacteria 947
316 Ga0450898_008927 3300042134 Bacteria 1595
317 Ga0450898_053837 3300042134 Bacteria 782
318 Ga0450906_017883 3300042145 Bacteria 1275
319 Ga0439446_0004216 3300042156 Bacteria 3631
320 Ga0439446_0029334 3300042156 Bacteria 1588
321 Ga0439446_0060591 3300042156 Bacteria 1143
322 Ga0439446_0137222 3300042156 Bacteria 797
323 Ga0450908_021845 3300042184 Bacteria 1122
324 Ga0450909_013522 3300042185 Bacteria 1200
325 Ga0439434_0026284 3300042435 Bacteria 1758
326 Ga0439434_0045576 3300042435 Bacteria 1352
327 Ga0450918_000576 3300042531 Bacteria 7808
328 Ga0450893_0013954 3300042532 Bacteria 1343
329 Ga0451577_0513680 3300042876 Bacteria 1088
330 Ga0451577_0793830 3300042876 Bacteria 855
331 Ga0451577_0826802 3300042876 Bacteria 836
332 Ga0453683_0002555 3300044673 Bacteria 14028
333 Ga0466965_0268136 3300044683 Bacteria 919
334 Ga0453684_0439615 3300044712 Bacteria 1454
335 Ga0466957_0372756 3300044842 Bacteria 972
336 Ga0451576_0005954 3300045051 Bacteria 15100
337 Ga0451576_0106333 3300045051 Bacteria 2920
338 Ga0451576_0462944 3300045051 Bacteria 1331
339 Ga0495629_0176217 3300046459 Bacteria 1483
340 Ga0495639_0126317 3300046475 Bacteria 1222
341 Ga0495643_0260772 3300046522 Bacteria 805
342 Ga0495654_0121872 3300046530 Bacteria 1179
343 Ga0495586_0348926 3300046535 Bacteria 850
344 Ga0495598_0079599 3300046537 Bacteria 1049
345 Ga0495633_0016027 3300046558 Bacteria 3876
346 Ga0495656_0000146 3300046615 Bacteria 26151
347 Ga0495656_0244350 3300046615 Bacteria 905
348 Ga0495625_0000311 3300046660 Bacteria 74209
349 Ga0495624_0285694 3300046690 Bacteria 996
350 Ga0495670_0400172 3300046691 Bacteria 742
351 Ga0495676_0043440 3300047321 Bacteria 3677
352 Ga0495687_193505 3300047443 Bacteria 652
353 Ga0495593_0147258 3300047673 Bacteria 1191
354 Ga0495602_0457935 3300048088 Bacteria 899
355 Ga0495614_0165206 3300048089 Bacteria 991
356 Ga0495615_0096438 3300048090 Bacteria 830
357 Ga0496101_0277432 3300048904 Bacteria 1309
358 Ga0496102_0002798 3300048905 Bacteria 14877
359 Ga0496102_0129322 3300048905 Bacteria 2362
360 Ga0496103_0472189 3300048906 Bacteria 804
361 Ga0496104_0605881 3300048907 Bacteria 1005
362 Ga0496104_1002775 3300048907 Bacteria 739
363 Ga0496105_0005741 3300048908 Bacteria 9450
364 Ga0496105_0685876 3300048908 Bacteria 788
365 Ga0496107_0226725 3300048910 Bacteria 1390
366 Ga0496108_0096914 3300048911 Bacteria 2513
367 Ga0496108_0525103 3300048911 Bacteria 1033
368 Ga0496109_0034261 3300048912 Bacteria 4572
369 Ga0496109_0760717 3300048912 Bacteria 907
370 Ga0496109_1750037 3300048912 Bacteria 555
371 Ga0496110_0008724 3300048913 Bacteria 8164
372 Ga0496110_0614486 3300048913 Bacteria 985
373 Ga0496111_0089744 3300048914 Bacteria 2251
374 Ga0496114_0121789 3300048917 Bacteria 2244
375 Ga0496116_0200411 3300048919 Bacteria 1045
376 Ga0496116_0222155 3300048919 Bacteria 967
377 Ga0496117_0144309 3300048920 Bacteria 1420
378 Ga0496117_0241529 3300048920 Bacteria 991
379 Ga0496117_0250293 3300048920 Bacteria 967
380 Ga0496117_0292954 3300048920 Bacteria 865
381 Ga0496118_0182517 3300048921 Bacteria 1266
382 Ga0496121_0006746 3300048924 Bacteria 14087
383 Ga0496122_0000584 3300048925 Bacteria 74681
384 Ga0496122_0201300 3300048925 Bacteria 1164
385 Ga0496122_0314711 3300048925 Bacteria 836
386 Ga0496123_0000308 3300048926 Bacteria 94712
387 Ga0496123_0181687 3300048926 Bacteria 1098
388 Ga0496124_0106701 3300048927 Bacteria 2261
389 Ga0496124_0191943 3300048927 Bacteria 1562
390 Ga0496124_0355612 3300048927 Bacteria 1034
391 Ga0496124_0408737 3300048927 Bacteria 939
392 Ga0496125_0082446 3300048928 Bacteria 2451
393 Ga0496125_0176709 3300048928 Bacteria 1427
394 Ga0496125_0274414 3300048928 Bacteria 1048
395 Ga0496125_0347498 3300048928 Bacteria 887
396 Ga0496125_0428685 3300048928 Bacteria 764
397 Ga0496126_0496864 3300048929 Bacteria 975
398 Ga0501290_010270 3300049513 Bacteria 1195
399 Ga0501300_001662 3300049523 Bacteria 3333
400 Ga0501033_0303206 3300049570 Bacteria 1124
401 Ga0501033_0637174 3300049570 Bacteria 729
402 Ga0501034_0060330 3300049571 Bacteria 3810
403 Ga0501034_0726737 3300049571 Bacteria 890
404 Ga0501034_0771196 3300049571 Bacteria 856
405 Ga0501034_1282971 3300049571 Bacteria 609
406 Ga0501037_0708799 3300049573 Bacteria 669
407 Ga0501038_0505211 3300049574 Bacteria 924
408 Ga0501039_0289034 3300049575 Bacteria 1289
409 Ga0501043_0571055 3300049579 Bacteria 838
410 Ga0501046_0045145 3300049580 Bacteria 3502
411 Ga0501047_0166235 3300049581 Bacteria 2076
412 Ga0501047_0332958 3300049581 Bacteria 1357
413 Ga0501068_0454608 3300049584 Bacteria 829
414 Ga0501208_074831 3300049655 Bacteria 687
415 Ga0501223_019950 3300049663 Bacteria 1315
416 Ga0501223_048760 3300049663 Bacteria 822
417 Ga0501224_014937 3300049664 Bacteria 1150
418 Ga0501238_012280 3300049671 Bacteria 1158
419 Ga0501243_093686 3300049675 Bacteria 599
420 Ga0501225_0001856 3300049705 Bacteria 6635
421 Ga0501080_0131877 3300049742 Bacteria 2314
422 Ga0501083_0664160 3300049744 Bacteria 678
423 Ga0501241_045820 3300049758 Bacteria 856
424 Ga0501262_013621 3300049759 Bacteria 1050
425 Ga0501262_019844 3300049759 Bacteria 913
426 Ga0501263_005145 3300049760 Bacteria 1467
427 Ga0501266_019127 3300049763 Bacteria 925
428 Ga0501269_033318 3300049766 Bacteria 667
429 Ga0501282_000221 3300049778 Bacteria 6989
430 Ga0501035_0133202 3300049822 Bacteria 2165
431 Ga0501044_0073607 3300049823 Bacteria 3472
432 Ga0501044_0312943 3300049823 Bacteria 1496
433 Ga0501226_010089 3300049853 Bacteria 1048
434 nmdc:mga03683_166491_c1 3300050489 Bacteria 1000
435 nmdc:mga03683_182863_c1 3300050489 Bacteria 957
436 nmdc:mga03n38_271103_c1 3300050490 Bacteria 903
437 nmdc:mga00v17_760827_c1 3300050491 Bacteria 619
438 nmdc:mga0yw44_449218_c1 3300050492 Bacteria 873
439 nmdc:mga0k408_153545_c1 3300050493 Bacteria 1371
440 nmdc:mga0k408_436925_c1 3300050493 Bacteria 778
441 nmdc:mga07m45_113368_c1 3300050496 Bacteria 1563
442 nmdc:mga07m45_369795_c1 3300050496 Bacteria 833
443 nmdc:mga07m45_494936_c1 3300050496 Bacteria 708
444 nmdc:mga07m45_60103_c1 3300050496 Bacteria 2151
445 nmdc:mga07m45_7933_c1 3300050496 Bacteria 5437
446 nmdc:mga09592_759124_c1 3300050508 Bacteria 822
447 Ga0500643_054372 3300053087 Bacteria 1136
448 Ga0500644_0001052 3300053088 Bacteria 8211
449 Ga0500651_0000738 3300053093 Bacteria 15959
450 Ga0500651_0221541 3300053093 Bacteria 1109
451 Ga0500566_0259457 3300053094 Bacteria 840
452 Ga0500571_141612 3300053110 Bacteria 1070
453 Ga0500593_000927 3300053117 Bacteria 10879
454 Ga0500594_0044317 3300053118 Bacteria 1230
455 Ga0500608_118018 3300053122 Bacteria 1207
456 Ga0500618_023355 3300053125 Bacteria 1498
457 Ga0500618_058990 3300053125 Bacteria 864
458 Ga0500618_112447 3300053125 Bacteria 615
459 Ga0500626_193117 3300053128 Bacteria 809
460 Ga0500658_0002871 3300053134 Bacteria 6610
461 Ga0500559_0077820 3300053136 Bacteria 1503
462 Ga0500559_0244701 3300053136 Bacteria 845
463 Ga0500564_202176 3300053138 Bacteria 815
464 Ga0500573_0171645 3300053140 Bacteria 1172
465 Ga0500574_052531 3300053141 Bacteria 1167
466 Ga0500604_0192185 3300053151 Bacteria 701
467 Ga0500619_203355 3300053154 Bacteria 664
468 Ga0500634_0160001 3300053161 Bacteria 1040
469 Ga0500638_115227 3300053162 Bacteria 1236
470 Ga0500645_000320 3300053730 Bacteria 34158
471 Ga0500645_010338 3300053730 Bacteria 3091
472 Ga0500645_064068 3300053730 Bacteria 1060
473 Ga0500596_021813 3300053735 Bacteria 966
474 2643866626 2643221570 Bacteria 5103772
475 2643991394 2643221596 Bacteria 5006805
476 2644062777 2643221609 Bacteria 6756331
477 2644076728 2643221611 Bacteria 6820941
478 2644162920 2643221628 Bacteria 5745828
479 2644296319 2643221652 Bacteria 5140275
480 2644329535 2643221658 Bacteria 6064537
481 2644398303 2643221672 Bacteria 6322190
482 2644465370 2643221683 Bacteria 5749203
483 2644647720 2643221717 Bacteria 5676132
484 2738722863 2738541277 Bacteria 7458140
485 2739283434 2738543019 Bacteria 7459457
486 2831270401 2831265667 Bacteria 7184833
487 2842680121 2842677519 Bacteria 5615038
488 2842748126 2842747753 Bacteria 5578255
489 2857578485 2857576091 Bacteria 5465855
490 2881101401 2881101125 Bacteria 4590519
491 2885196293 2885192300 Bacteria 5882526
492 2885199761 2885198086 Bacteria 7212419
493 2885213412 2885211737 Bacteria 7212420
494 2894025541 2894023352 Bacteria 5167372
495 2904454711 2904449895 Bacteria 6927402
496 2904460366 2904456579 Bacteria 6819253
497 2919464173 2919462493 Bacteria 5817112
498 2928120323 2928115317 Bacteria 6477646
499 2929524563 2929520902 Bacteria 6765052
500 2945946989 2945945610 Bacteria 5951079
501 2945976666 2945972063 Bacteria 6086495
502 2954771733 2954767861 Bacteria 5535784
503 2990712186 2990710928 Bacteria 5002431
504 Ga0451793_0261163
505 SwRhRL2b_contig_1147302
506 JGI25156J39149_1000148
507 JGI25154J39366_1000155
508 JGI25157J39369_1000183
509 JGI25152J39213_1003568
510 JGI25159J45721_1007514
511 JGI25151J46595_10016629
512 JGI25153J46596_10014853
513 rootH1_10052795
514 JGI25160J50197_1031205
515 Ga0006562J51391_1062293
516 Ga0055526_1003224
517 Ga0055526_1007263
518 Ga0055537_1000067
519 Ga0055537_1000086
520 Ga0055524_1000279
521 Ga0055536_1001302
522 Ga0055536_1005425
523 Ga0055534_1000079
524 Ga0055534_1002371
525 Ga0055534_1039205
526 Ga0055528_1001037
527 Ga0055528_1005743
528 Ga0055528_1013543
529 Ga0055530_10000730
530 Ga0055530_10001255
531 Ga0055530_10002701
532 Ga0055530_10006113
533 Ga0055540_1000553
534 Ga0055540_1008030
535 Ga0055540_1015457
536 Ga0055531_10000726
537 Ga0055531_10000873
538 Ga0055531_10021958
539 Ga0065165_1007358
540 Ga0065165_1031470
541 Ga0065714_10208485
542 Ga0065714_10220428
543 Ga0065714_10244725
544 Ga0065704_10092299
545 Ga0065704_10101719
546 Ga0070676_10448286
547 Ga0070676_10763020
548 Ga0070670_100257843
549 Ga0070677_10037328
550 Ga0070666_10035821
551 Ga0068868_100174139
552 Ga0070675_100350489
553 Ga0070675_100911185
554 Ga0070671_100020401
555 Ga0070674_100286594
556 Ga0070673_100058082
557 Ga0070667_100157089
558 Ga0070678_100138986
559 Ga0070678_100182054
560 Ga0070678_100880435
561 Ga0070662_100005845
562 Ga0068867_100014481
563 Ga0068867_101379558
564 Ga0068853_100008771
565 Ga0068853_100353919
566 Ga0068853_101351582
567 Ga0070672_100109451
568 Ga0070665_100045803
569 Ga0070664_100367553
570 Ga0068857_100251748
571 Ga0068852_100516348
572 Ga0068859_100165698
573 Ga0068859_100180589
574 Ga0068859_102118244
575 Ga0068864_100282451
576 Ga0068870_10733247
577 Ga0068863_100106076
578 Ga0068863_100187941
579 Ga0068860_100274847
580 Ga0068860_100559990
581 Ga0068860_100690603
582 Ga0081455_10467828
583 Ga0075365_10694402
584 Ga0075363_100017606
585 Ga0075364_10130605
586 Ga0075364_10154607
587 Ga0075362_10060604
588 Ga0075367_10021333
589 Ga0075369_10061085
590 Ga0097621_100220761
591 Ga0097621_100347164
592 Ga0097621_100621599
593 Ga0075370_10000356
594 Ga0075370_10000594
595 Ga0075370_10006193
596 Ga0075370_10140276
597 Ga0075370_10235640
598 Ga0068871_100020569
599 Ga0075430_100071251
600 Ga0068865_100319692
601 Ga0097620_100165698
602 Ga0097620_100180598
603 Ga0097620_102117822
604 Ga0079104_1035134
605 Ga0099826_10023668
606 Ga0105244_10007302
607 Ga0105240_10176561
608 Ga0105243_10001470
609 Ga0105243_10192604
610 Ga0105242_10425674
611 Ga0105248_10021049
612 Ga0105237_10498930
613 Ga0105249_10384831
614 Ga0105246_10010775
615 Ga0157373_10266450
616 Ga0157371_10197097
617 Ga0157370_10393191
618 Ga0157370_10700836
619 Ga0163162_10764197
620 Ga0163162_10790687
621 Ga0163162_11416703
622 Ga0157375_10069884
623 Ga0157375_10455269
624 Ga0157375_10484430
625 Ga0163163_10062944
626 Ga0182008_10000330
627 Ga0182008_10002376
628 Ga0182008_10003615
629 Ga0182008_10175802
630 Ga0157379_10640779
631 Ga0157379_10979629
632 Ga0157376_11660253
633 Ga0182006_1001221
634 Ga0182006_1029509
635 Ga0182007_10003876
636 Ga0182007_10014003
637 Ga0182005_1022863
638 Ga0163161_10080119
639 Ga0163161_10375954
640 Ga0209435_100014
641 Ga0207425_1004043
642 Ga0207425_1005751
643 Ga0209646_1000001
644 Ga0209026_1000137
645 Ga0209759_1000013
646 Ga0209129_1004105
647 Ga0209565_1000028
648 Ga0209565_1000040
649 Ga0209565_1037363
650 Ga0209673_1000035
651 Ga0209673_1000109
652 Ga0209130_1000759
653 Ga0209130_1008079
654 Ga0209675_1000024
655 Ga0209675_1000111
656 Ga0209675_1002085
657 Ga0209675_1041061
658 Ga0209676_1000005
659 Ga0209676_1000254
660 Ga0209676_1000634
661 Ga0209025_1001864
662 Ga0209025_1006211
663 Ga0209025_1007844
664 Ga0209025_1023144
665 Ga0209025_1030314
666 Ga0209564_1000531
667 Ga0209564_1000714
668 Ga0209564_1006417
669 Ga0209564_1042932
670 Ga0209758_1019515
671 Ga0209050_1000007
672 Ga0209050_1000023
673 Ga0209050_1000497
674 Ga0209050_1021478
675 Ga0209256_1000003
676 Ga0207426_1007615
677 Ga0207426_1011012
678 Ga0209051_1000009
679 Ga0209051_1000017
680 Ga0209051_1000073
681 Ga0209051_1000262
682 Ga0209257_1000011
683 Ga0209257_1000041
684 Ga0209257_1000139
685 Ga0207655_1005174
686 Ga0207680_10069218
687 Ga0207680_10145949
688 Ga0207645_10071330
689 Ga0207705_10314981
690 Ga0207671_10080902
691 Ga0207681_10084608
692 Ga0207650_10250350
693 Ga0207659_10020357
694 Ga0207659_10095802
695 Ga0207659_11242150
696 Ga0207690_11056496
697 Ga0207706_10021250
698 Ga0207686_10860614
699 Ga0207709_10012378
700 Ga0207669_10263647
701 Ga0207669_10490385
702 Ga0207691_10003024
703 Ga0207691_10842993
704 Ga0207711_10138409
705 Ga0207689_10452042
706 Ga0207679_10565213
707 Ga0207651_10205333
708 Ga0207712_10314886
709 Ga0207658_10314216
710 Ga0207658_10760107
711 Ga0207708_10223560
712 Ga0207641_10196883
713 Ga0207641_10325008
714 Ga0207648_10096297
715 Ga0207676_10266574
716 Ga0207674_10099674
717 Ga0207674_10526484
718 Ga0207683_10120290
719 Ga0207683_10164173
720 Ga0207683_10166039
721 Ga0207683_10217897
722 Ga0207698_10637899
723 Ga0209969_1009798
724 Ga0209282_1021662
725 Ga0209971_1003310
726 Ga0268265_10344320
727 Ga0268264_10165665
728 Ga0307512_10176703
729 Ga0316176_1137038
730 Ga0314311_1236547
731 Ga0316178_1079536
732 Ga0316183_1023302
733 Ga0316181_1018571
734 Ga0316182_1304162
735 Ga0307513_10000011
736 Ga0307408_100000048
737 Ga0307408_100015366
738 Ga0307408_100123977
739 Ga0307408_100138275
740 Ga0307408_100195513
741 Ga0307408_100245264
742 Ga0307408_100340198
743 Ga0307408_100393913
744 Ga0307514_10009341
745 Ga0307514_10023261
746 Ga0307516_10029170
747 Ga0307516_10035762
748 Ga0307405_10136890
749 Ga0307405_10168019
750 Ga0307405_10568583
751 Ga0307405_10769957
752 Ga0307413_11174528
753 Ga0307406_10000230
754 Ga0307406_10002497
755 Ga0307406_10007292
756 Ga0307406_10445149
757 Ga0307406_10556642
758 Ga0307406_11112723
759 Ga0307412_10055484
760 Ga0307412_10110408
761 Ga0307412_10571721
762 Ga0307412_10621723
763 Ga0307412_10729195
764 Ga0307412_10788973
765 Ga0307412_11091550
766 Ga0307409_100623054
767 Ga0307416_101489273
768 Ga0307414_10033311
769 Ga0307414_10112577
770 Ga0307414_10231508
771 Ga0307411_10482188
772 Ga0307411_10738926
773 Ga0307411_10776498
774 Ga0395905_0471821
775 Ga0395901_0377624
776 Ga0439436_0006824
777 Ga0439439_0006453
778 Ga0439439_0059505
779 Ga0439447_039502
780 Ga0439447_061694
781 Ga0439461_0019374
782 Ga0439461_0084070
783 Ga0439461_0151518
784 Ga0439466_0005061
785 Ga0439466_0069519
786 Ga0439466_0086335
787 Ga0439465_0016273
788 Ga0451800_0179475
789 Ga0451804_1144560
790 Ga0439431_0007487
791 Ga0439431_0029454
792 Ga0439431_0055697
793 Ga0439433_0046054
794 Ga0439442_010382
795 Ga0439442_084137
796 Ga0439445_0139342
797 Ga0439432_010077
798 Ga0439432_017417
799 Ga0439449_0000754
800 Ga0439449_0005184
801 Ga0439449_0031419
802 Ga0439452_001220
803 Ga0439452_019313
804 Ga0439452_088832
805 Ga0439457_010767
806 Ga0439457_027632
807 Ga0439457_055070
808 Ga0439462_0024040
809 Ga0439463_069823
810 Ga0450911_013255
811 Ga0450920_018295
812 Ga0450923_022881
813 Ga0450923_036391
814 Ga0450894_009230
815 Ga0450894_020521
816 Ga0450896_019672
817 Ga0450896_021543
818 Ga0450898_008927
819 Ga0450898_053837
820 Ga0450906_017883
821 Ga0439446_0004216
822 Ga0439446_0029334
823 Ga0439446_0060591
824 Ga0439446_0137222
825 Ga0450908_021845
826 Ga0450909_013522
827 Ga0439434_0026284
828 Ga0439434_0045576
829 Ga0450918_000576
830 Ga0450893_0013954
831 Ga0451577_0513680
832 Ga0451577_0793830
833 Ga0451577_0826802
834 Ga0453683_0002555
835 Ga0466965_0268136
836 Ga0453684_0439615
837 Ga0466957_0372756
838 Ga0451576_0005954
839 Ga0451576_0106333
840 Ga0451576_0462944
841 Ga0495629_0176217
842 Ga0495639_0126317
843 Ga0495643_0260772
844 Ga0495654_0121872
845 Ga0495586_0348926
846 Ga0495598_0079599
847 Ga0495633_0016027
848 Ga0495656_0000146
849 Ga0495656_0244350
850 Ga0495625_0000311
851 Ga0495624_0285694
852 Ga0495670_0400172
853 Ga0495676_0043440
854 Ga0495687_193505
855 Ga0495593_0147258
856 Ga0495602_0457935
857 Ga0495614_0165206
858 Ga0495615_0096438
859 Ga0496101_0277432
860 Ga0496102_0002798
861 Ga0496102_0129322
862 Ga0496103_0472189
863 Ga0496104_0605881
864 Ga0496104_1002775
865 Ga0496105_0005741
866 Ga0496105_0685876
867 Ga0496107_0226725
868 Ga0496108_0096914
869 Ga0496108_0525103
870 Ga0496109_0034261
871 Ga0496109_0760717
872 Ga0496109_1750037
873 Ga0496110_0008724
874 Ga0496110_0614486
875 Ga0496111_0089744
876 Ga0496114_0121789
877 Ga0496116_0200411
878 Ga0496116_0222155
879 Ga0496117_0144309
880 Ga0496117_0241529
881 Ga0496117_0250293
882 Ga0496117_0292954
883 Ga0496118_0182517
884 Ga0496121_0006746
885 Ga0496122_0000584
886 Ga0496122_0201300
887 Ga0496122_0314711
888 Ga0496123_0000308
889 Ga0496123_0181687
890 Ga0496124_0106701
891 Ga0496124_0191943
892 Ga0496124_0355612
893 Ga0496124_0408737
894 Ga0496125_0082446
895 Ga0496125_0176709
896 Ga0496125_0274414
897 Ga0496125_0347498
898 Ga0496125_0428685
899 Ga0496126_0496864
900 Ga0501290_010270
901 Ga0501300_001662
902 Ga0501033_0303206
903 Ga0501033_0637174
904 Ga0501034_0060330
905 Ga0501034_0726737
906 Ga0501034_0771196
907 Ga0501034_1282971
908 Ga0501037_0708799
909 Ga0501038_0505211
910 Ga0501039_0289034
911 Ga0501043_0571055
912 Ga0501046_0045145
913 Ga0501047_0166235
914 Ga0501047_0332958
915 Ga0501068_0454608
916 Ga0501208_074831
917 Ga0501223_019950
918 Ga0501223_048760
919 Ga0501224_014937
920 Ga0501238_012280
921 Ga0501243_093686
922 Ga0501225_0001856
923 Ga0501080_0131877
924 Ga0501083_0664160
925 Ga0501241_045820
926 Ga0501262_013621
927 Ga0501262_019844
928 Ga0501263_005145
929 Ga0501266_019127
930 Ga0501269_033318
931 Ga0501282_000221
932 Ga0501035_0133202
933 Ga0501044_0073607
934 Ga0501044_0312943
935 Ga0501226_010089
936 nmdc:mga03683_166491_c1
937 nmdc:mga03683_182863_c1
938 nmdc:mga03n38_271103_c1
939 nmdc:mga00v17_760827_c1
940 nmdc:mga0yw44_449218_c1
941 nmdc:mga0k408_153545_c1
942 nmdc:mga0k408_436925_c1
943 nmdc:mga07m45_113368_c1
944 nmdc:mga07m45_369795_c1
945 nmdc:mga07m45_494936_c1
946 nmdc:mga07m45_60103_c1
947 nmdc:mga07m45_7933_c1
948 nmdc:mga09592_759124_c1
949 Ga0500643_054372
950 Ga0500644_0001052
951 Ga0500651_0000738
952 Ga0500651_0221541
953 Ga0500566_0259457
954 Ga0500571_141612
955 Ga0500593_000927
956 Ga0500594_0044317
957 Ga0500608_118018
958 Ga0500618_023355
959 Ga0500618_058990
960 Ga0500618_112447
961 Ga0500626_193117
962 Ga0500658_0002871
963 Ga0500559_0077820
964 Ga0500559_0244701
965 Ga0500564_202176
966 Ga0500573_0171645
967 Ga0500574_052531
968 Ga0500604_0192185
969 Ga0500619_203355
970 Ga0500634_0160001
971 Ga0500638_115227
972 Ga0500645_000320
973 Ga0500645_010338
974 Ga0500645_064068
975 Ga0500596_021813
976 2643866626
977 2643991394
978 2644062777
979 2644076728
980 2644162920
981 2644296319
982 2644329535
983 2644398303
984 2644465370
985 2644647720
986 2738722863
987 2739283434
988 2831270401
989 2842680121
990 2842748126
991 2857578485
992 2881101401
993 2885196293
994 2885199761
995 2885213412
996 2894025541
997 2904454711
998 2904460366
999 2919464173
1000 2928120323
1001 2929524563
1002 2945946989
1003 2945976666
1004 2954771733
1005 2990712186

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

50

175

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.783 16 162
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7472 1 152
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7066 1 152
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6818 16 162
6trc-assembly1.cif.gz_L cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6 0.5203 57 162
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.856 28 156 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8384 28 156 1.20.120.550
af_Q10085_240_394_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5404 13 153 1.20.1250.20
af_O70352_1_107_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.529 86 162 1.20.5.780
af_P27701_1_107_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.5248 86 162 1.20.5.780
ID Description Score Start End GO Terms
AF-A0A1H0CUT6-F1-model_v4 TRAP transporter small permease protein 0.9586 1 153 GO:0005886
GO:0015740
GO:0022857
AF-A0A4Y6RWK7-F1-model_v4 TRAP transporter small permease protein 0.9529 2 157 GO:0005886
GO:0015740
GO:0022857
AF-A0A0G2Z721-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.9528 3 154 GO:0005886
GO:0015740
GO:0022857
AF-A0A6I7PBV5-F1-model_v4 TRAP transporter small permease protein 0.949 2 152 GO:0005886
GO:0015740
GO:0022857
AF-A0A7W5LKC0-F1-model_v4 TRAP transporter small permease protein 0.9485 3 153 GO:0005886
GO:0015740
GO:0022857

Map