F455886
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 316 | 1005 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300041452|Ga0451793_0261163|Ga0451793_0261163_159_722 |
| Length | 181 |
| Sequence | LQQRARPPGLPRRAFLFEATGHAMKQALLTLDRWTSSFSMAVACLMLTIASALGVFQIVTRFVLEQPAEWSEILIRMSLIWMVFMGIPTAFRQGAMVSVDVLYRWSPPEFRRVLDWVVCLAALVWWGWDYAQRGGVQSMAGLESVSMFWAYLAMPVGGLFCVIGILANLADPQRNELDTAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 133 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 137 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 138 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 139 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 140 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 141 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 142 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 158 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 159 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 160 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 161 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 162 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 163 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 166 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 167 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 168 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 169 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 170 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 171 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 172 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 173 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 174 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 175 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 176 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 177 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 178 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 179 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 180 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 181 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 184 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 187 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 190 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 231 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 232 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 243 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 246 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 247 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 251 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 253 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 256 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 259 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 262 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 267 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 269 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 270 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 272 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 273 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 278 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 280 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 281 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 282 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 283 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 284 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 287 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 288 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 289 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 290 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 291 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 292 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 293 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 294 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 295 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 296 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 297 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 298 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 299 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 300 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 301 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 302 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 303 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 304 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 305 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 306 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 307 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 308 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 309 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 310 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 311 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 312 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 313 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 314 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 315 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 316 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.82 |
| Metatranscriptomes | 0.2 |
| Isolates | 5.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.3 |
| Nodule | 0.8 |
| Rhizoplane | 4.18 |
| Rhizosphere | 59.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451793_0261163 | 3300041452 | Bacteria | 739 |
| 2 | SwRhRL2b_contig_1147302 | 2162886007 | Bacteria | 815 |
| 3 | JGI25156J39149_1000148 | 3300002705 | Bacteria | 51890 |
| 4 | JGI25154J39366_1000155 | 3300002738 | Bacteria | 52889 |
| 5 | JGI25157J39369_1000183 | 3300002741 | Bacteria | 52889 |
| 6 | JGI25152J39213_1003568 | 3300002773 | Bacteria | 5266 |
| 7 | JGI25159J45721_1007514 | 3300002987 | Bacteria | 3116 |
| 8 | JGI25151J46595_10016629 | 3300003187 | Bacteria | 3212 |
| 9 | JGI25153J46596_10014853 | 3300003215 | Bacteria | 3212 |
| 10 | rootH1_10052795 | 3300003316 | Bacteria | 1283 |
| 11 | rootH1_10052795 | 3300003323 | Bacteria | 11001 |
| 12 | JGI25160J50197_1031205 | 3300003354 | Bacteria | 1376 |
| 13 | Ga0006562J51391_1062293 | 3300003578 | Bacteria | 800 |
| 14 | Ga0055526_1003224 | 3300003771 | Bacteria | 10518 |
| 15 | Ga0055526_1007263 | 3300003771 | Bacteria | 5806 |
| 16 | Ga0055537_1000067 | 3300003773 | Bacteria | 75689 |
| 17 | Ga0055537_1000086 | 3300003773 | Bacteria | 67416 |
| 18 | Ga0055524_1000279 | 3300003775 | Bacteria | 50624 |
| 19 | Ga0055536_1001302 | 3300003781 | Bacteria | 15354 |
| 20 | Ga0055536_1005425 | 3300003781 | Bacteria | 6237 |
| 21 | Ga0055534_1000079 | 3300003784 | Bacteria | 75689 |
| 22 | Ga0055534_1002371 | 3300003784 | Bacteria | 6573 |
| 23 | Ga0055534_1039205 | 3300003784 | Bacteria | 703 |
| 24 | Ga0055528_1001037 | 3300003790 | Bacteria | 18378 |
| 25 | Ga0055528_1005743 | 3300003790 | Bacteria | 5716 |
| 26 | Ga0055528_1013543 | 3300003790 | Bacteria | 3082 |
| 27 | Ga0055530_10000730 | 3300003791 | Bacteria | 27505 |
| 28 | Ga0055530_10001255 | 3300003791 | Bacteria | 19265 |
| 29 | Ga0055530_10002701 | 3300003791 | Bacteria | 11037 |
| 30 | Ga0055530_10006113 | 3300003791 | Bacteria | 5473 |
| 31 | Ga0055540_1000553 | 3300003792 | Bacteria | 27912 |
| 32 | Ga0055540_1008030 | 3300003792 | Bacteria | 3861 |
| 33 | Ga0055540_1015457 | 3300003792 | Bacteria | 2221 |
| 34 | Ga0055531_10000726 | 3300003794 | Bacteria | 27911 |
| 35 | Ga0055531_10000873 | 3300003794 | Bacteria | 24722 |
| 36 | Ga0055531_10021958 | 3300003794 | Bacteria | 2452 |
| 37 | Ga0065165_1007358 | 3300005262 | Bacteria | 5441 |
| 38 | Ga0065165_1031470 | 3300005262 | Bacteria | 1676 |
| 39 | Ga0065714_10208485 | 3300005288 | Bacteria | 872 |
| 40 | Ga0065714_10220428 | 3300005288 | Bacteria | 840 |
| 41 | Ga0065714_10244725 | 3300005288 | Bacteria | 787 |
| 42 | Ga0065704_10092299 | 3300005289 | Bacteria | 2663 |
| 43 | Ga0065704_10101719 | 3300005289 | Bacteria | 2228 |
| 44 | Ga0070676_10448286 | 3300005328 | Bacteria | 907 |
| 45 | Ga0070676_10763020 | 3300005328 | Bacteria | 711 |
| 46 | Ga0070670_100257843 | 3300005331 | Bacteria | 1520 |
| 47 | Ga0070677_10037328 | 3300005333 | Bacteria | 1895 |
| 48 | Ga0070666_10035821 | 3300005335 | Bacteria | 3291 |
| 49 | Ga0068868_100174139 | 3300005338 | Bacteria | 1783 |
| 50 | Ga0070675_100350489 | 3300005354 | Bacteria | 1309 |
| 51 | Ga0070675_100911185 | 3300005354 | Bacteria | 806 |
| 52 | Ga0070671_100020401 | 3300005355 | Bacteria | 5405 |
| 53 | Ga0070674_100286594 | 3300005356 | Bacteria | 1308 |
| 54 | Ga0070673_100058082 | 3300005364 | Bacteria | 3058 |
| 55 | Ga0070667_100157089 | 3300005367 | Bacteria | 2001 |
| 56 | Ga0070678_100138986 | 3300005456 | Bacteria | 1941 |
| 57 | Ga0070678_100182054 | 3300005456 | Bacteria | 1721 |
| 58 | Ga0070678_100880435 | 3300005456 | Bacteria | 817 |
| 59 | Ga0070662_100005845 | 3300005457 | Bacteria | 7895 |
| 60 | Ga0068867_100014481 | 3300005459 | Bacteria | 5589 |
| 61 | Ga0068867_101379558 | 3300005459 | Bacteria | 653 |
| 62 | Ga0068853_100008771 | 3300005539 | Bacteria | 8133 |
| 63 | Ga0068853_100353919 | 3300005539 | Bacteria | 1366 |
| 64 | Ga0068853_101351582 | 3300005539 | Bacteria | 689 |
| 65 | Ga0070672_100109451 | 3300005543 | Bacteria | 2250 |
| 66 | Ga0070665_100045803 | 3300005548 | Bacteria | 4393 |
| 67 | Ga0070664_100367553 | 3300005564 | Bacteria | 1311 |
| 68 | Ga0068857_100251748 | 3300005577 | Bacteria | 1619 |
| 69 | Ga0068852_100516348 | 3300005616 | Bacteria | 1191 |
| 70 | Ga0068859_100165698 | 3300005617 | Bacteria | 2290 |
| 71 | Ga0068859_100180589 | 3300005617 | Bacteria | 2193 |
| 72 | Ga0068859_102118244 | 3300005617 | Bacteria | 621 |
| 73 | Ga0068864_100282451 | 3300005618 | Bacteria | 1550 |
| 74 | Ga0068870_10733247 | 3300005840 | Bacteria | 685 |
| 75 | Ga0068863_100106076 | 3300005841 | Bacteria | 2673 |
| 76 | Ga0068863_100187941 | 3300005841 | Bacteria | 1985 |
| 77 | Ga0068860_100274847 | 3300005843 | Bacteria | 1645 |
| 78 | Ga0068860_100559990 | 3300005843 | Bacteria | 1146 |
| 79 | Ga0068860_100690603 | 3300005843 | Bacteria | 1030 |
| 80 | Ga0081455_10467828 | 3300005937 | Bacteria | 856 |
| 81 | Ga0075365_10694402 | 3300006038 | Bacteria | 719 |
| 82 | Ga0075363_100017606 | 3300006048 | Bacteria | 3546 |
| 83 | Ga0075364_10130605 | 3300006051 | Bacteria | 1686 |
| 84 | Ga0075364_10154607 | 3300006051 | Bacteria | 1547 |
| 85 | Ga0075362_10060604 | 3300006177 | Bacteria | 1711 |
| 86 | Ga0075367_10021333 | 3300006178 | Bacteria | 3618 |
| 87 | Ga0075369_10061085 | 3300006186 | Bacteria | 1644 |
| 88 | Ga0097621_100220761 | 3300006237 | Bacteria | 1652 |
| 89 | Ga0097621_100347164 | 3300006237 | Bacteria | 1319 |
| 90 | Ga0097621_100621599 | 3300006237 | Bacteria | 989 |
| 91 | Ga0075370_10000356 | 3300006353 | Bacteria | 16689 |
| 92 | Ga0075370_10000594 | 3300006353 | Bacteria | 13976 |
| 93 | Ga0075370_10006193 | 3300006353 | Bacteria | 6003 |
| 94 | Ga0075370_10140276 | 3300006353 | Bacteria | 1413 |
| 95 | Ga0075370_10235640 | 3300006353 | Bacteria | 1083 |
| 96 | Ga0068871_100020569 | 3300006358 | Bacteria | 5058 |
| 97 | Ga0075430_100071251 | 3300006846 | Bacteria | 2916 |
| 98 | Ga0068865_100319692 | 3300006881 | Bacteria | 1248 |
| 99 | Ga0097620_100165698 | 3300006931 | Bacteria | 2290 |
| 100 | Ga0097620_100180598 | 3300006931 | Bacteria | 2193 |
| 101 | Ga0097620_102117822 | 3300006931 | Bacteria | 621 |
| 102 | Ga0079104_1035134 | 3300006946 | Bacteria | 1212 |
| 103 | Ga0099826_10023668 | 3300006948 | Bacteria | 4572 |
| 104 | Ga0105244_10007302 | 3300009036 | Bacteria | 7030 |
| 105 | Ga0105240_10176561 | 3300009093 | Bacteria | 2525 |
| 106 | Ga0105243_10001470 | 3300009148 | Bacteria | 20672 |
| 107 | Ga0105243_10192604 | 3300009148 | Bacteria | 1782 |
| 108 | Ga0105242_10425674 | 3300009176 | Bacteria | 1245 |
| 109 | Ga0105248_10021049 | 3300009177 | Bacteria | 7226 |
| 110 | Ga0105237_10498930 | 3300009545 | Bacteria | 1224 |
| 111 | Ga0105249_10384831 | 3300009553 | Bacteria | 1430 |
| 112 | Ga0105246_10010775 | 3300011119 | Bacteria | 5667 |
| 113 | Ga0157373_10266450 | 3300013100 | Bacteria | 1213 |
| 114 | Ga0157371_10197097 | 3300013102 | Bacteria | 1443 |
| 115 | Ga0157370_10393191 | 3300013104 | Bacteria | 1276 |
| 116 | Ga0157370_10700836 | 3300013104 | Bacteria | 924 |
| 117 | Ga0163162_10764197 | 3300013306 | Bacteria | 1085 |
| 118 | Ga0163162_10790687 | 3300013306 | Bacteria | 1067 |
| 119 | Ga0163162_11416703 | 3300013306 | Bacteria | 791 |
| 120 | Ga0157375_10069884 | 3300013308 | Bacteria | 3519 |
| 121 | Ga0157375_10455269 | 3300013308 | Bacteria | 1445 |
| 122 | Ga0157375_10484430 | 3300013308 | Bacteria | 1402 |
| 123 | Ga0163163_10062944 | 3300014325 | Bacteria | 3678 |
| 124 | Ga0182008_10000330 | 3300014497 | Bacteria | 37364 |
| 125 | Ga0182008_10002376 | 3300014497 | Bacteria | 11835 |
| 126 | Ga0182008_10003615 | 3300014497 | Bacteria | 9255 |
| 127 | Ga0182008_10175802 | 3300014497 | Bacteria | 1082 |
| 128 | Ga0157379_10640779 | 3300014968 | Bacteria | 994 |
| 129 | Ga0157379_10979629 | 3300014968 | Bacteria | 805 |
| 130 | Ga0157376_11660253 | 3300014969 | Bacteria | 674 |
| 131 | Ga0182006_1001221 | 3300015261 | Bacteria | 16037 |
| 132 | Ga0182006_1029509 | 3300015261 | Bacteria | 2221 |
| 133 | Ga0182007_10003876 | 3300015262 | Bacteria | 6937 |
| 134 | Ga0182007_10014003 | 3300015262 | Bacteria | 3039 |
| 135 | Ga0182005_1022863 | 3300015265 | Bacteria | 1711 |
| 136 | Ga0163161_10080119 | 3300017792 | Bacteria | 2403 |
| 137 | Ga0163161_10375954 | 3300017792 | Bacteria | 1134 |
| 138 | Ga0209435_100014 | 3300025206 | Bacteria | 322129 |
| 139 | Ga0207425_1004043 | 3300025245 | Bacteria | 4498 |
| 140 | Ga0207425_1005751 | 3300025245 | Bacteria | 3490 |
| 141 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 142 | Ga0209026_1000137 | 3300025250 | Bacteria | 116282 |
| 143 | Ga0209759_1000013 | 3300025256 | Bacteria | 399300 |
| 144 | Ga0209129_1004105 | 3300025258 | Bacteria | 5923 |
| 145 | Ga0209565_1000028 | 3300025263 | Bacteria | 348536 |
| 146 | Ga0209565_1000040 | 3300025263 | Bacteria | 266543 |
| 147 | Ga0209565_1037363 | 3300025263 | Bacteria | 919 |
| 148 | Ga0209673_1000035 | 3300025273 | Bacteria | 328411 |
| 149 | Ga0209673_1000109 | 3300025273 | Bacteria | 183000 |
| 150 | Ga0209130_1000759 | 3300025284 | Bacteria | 27970 |
| 151 | Ga0209130_1008079 | 3300025284 | Bacteria | 3152 |
| 152 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 153 | Ga0209675_1000111 | 3300025291 | Bacteria | 114805 |
| 154 | Ga0209675_1002085 | 3300025291 | Bacteria | 10625 |
| 155 | Ga0209675_1041061 | 3300025291 | Bacteria | 1012 |
| 156 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 157 | Ga0209676_1000254 | 3300025292 | Bacteria | 113136 |
| 158 | Ga0209676_1000634 | 3300025292 | Bacteria | 50573 |
| 159 | Ga0209025_1001864 | 3300025294 | Bacteria | 24710 |
| 160 | Ga0209025_1006211 | 3300025294 | Bacteria | 9376 |
| 161 | Ga0209025_1007844 | 3300025294 | Bacteria | 7837 |
| 162 | Ga0209025_1023144 | 3300025294 | Bacteria | 3261 |
| 163 | Ga0209025_1030314 | 3300025294 | Bacteria | 2592 |
| 164 | Ga0209564_1000531 | 3300025295 | Bacteria | 62085 |
| 165 | Ga0209564_1000714 | 3300025295 | Bacteria | 48032 |
| 166 | Ga0209564_1006417 | 3300025295 | Bacteria | 6350 |
| 167 | Ga0209564_1042932 | 3300025295 | Bacteria | 1192 |
| 168 | Ga0209758_1019515 | 3300025297 | Bacteria | 3264 |
| 169 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 170 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 171 | Ga0209050_1000497 | 3300025298 | Bacteria | 66982 |
| 172 | Ga0209050_1021478 | 3300025298 | Bacteria | 2351 |
| 173 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 174 | Ga0207426_1007615 | 3300025302 | Bacteria | 4505 |
| 175 | Ga0207426_1011012 | 3300025302 | Bacteria | 3474 |
| 176 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 177 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 178 | Ga0209051_1000073 | 3300025303 | Bacteria | 208874 |
| 179 | Ga0209051_1000262 | 3300025303 | Bacteria | 87898 |
| 180 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 181 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 182 | Ga0209257_1000139 | 3300025304 | Bacteria | 202285 |
| 183 | Ga0207655_1005174 | 3300025728 | Bacteria | 8973 |
| 184 | Ga0207680_10069218 | 3300025903 | Bacteria | 2180 |
| 185 | Ga0207680_10145949 | 3300025903 | Bacteria | 1573 |
| 186 | Ga0207645_10071330 | 3300025907 | Bacteria | 2223 |
| 187 | Ga0207705_10314981 | 3300025909 | Bacteria | 1201 |
| 188 | Ga0207671_10080902 | 3300025914 | Bacteria | 2436 |
| 189 | Ga0207681_10084608 | 3300025923 | Bacteria | 2249 |
| 190 | Ga0207650_10250350 | 3300025925 | Bacteria | 1434 |
| 191 | Ga0207659_10020357 | 3300025926 | Bacteria | 4384 |
| 192 | Ga0207659_10095802 | 3300025926 | Bacteria | 2226 |
| 193 | Ga0207659_11242150 | 3300025926 | Bacteria | 640 |
| 194 | Ga0207690_11056496 | 3300025932 | Bacteria | 676 |
| 195 | Ga0207706_10021250 | 3300025933 | Bacteria | 5830 |
| 196 | Ga0207686_10860614 | 3300025934 | Bacteria | 730 |
| 197 | Ga0207709_10012378 | 3300025935 | Bacteria | 4701 |
| 198 | Ga0207669_10263647 | 3300025937 | Bacteria | 1290 |
| 199 | Ga0207669_10490385 | 3300025937 | Bacteria | 981 |
| 200 | Ga0207691_10003024 | 3300025940 | Bacteria | 16412 |
| 201 | Ga0207691_10842993 | 3300025940 | Bacteria | 769 |
| 202 | Ga0207711_10138409 | 3300025941 | Bacteria | 2188 |
| 203 | Ga0207689_10452042 | 3300025942 | Bacteria | 1074 |
| 204 | Ga0207679_10565213 | 3300025945 | Bacteria | 1022 |
| 205 | Ga0207651_10205333 | 3300025960 | Bacteria | 1582 |
| 206 | Ga0207712_10314886 | 3300025961 | Bacteria | 1289 |
| 207 | Ga0207658_10314216 | 3300025986 | Bacteria | 1354 |
| 208 | Ga0207658_10760107 | 3300025986 | Bacteria | 878 |
| 209 | Ga0207708_10223560 | 3300026075 | Bacteria | 1509 |
| 210 | Ga0207641_10196883 | 3300026088 | Bacteria | 1855 |
| 211 | Ga0207641_10325008 | 3300026088 | Bacteria | 1459 |
| 212 | Ga0207648_10096297 | 3300026089 | Bacteria | 2590 |
| 213 | Ga0207676_10266574 | 3300026095 | Bacteria | 1549 |
| 214 | Ga0207674_10099674 | 3300026116 | Bacteria | 2887 |
| 215 | Ga0207674_10526484 | 3300026116 | Bacteria | 1142 |
| 216 | Ga0207683_10120290 | 3300026121 | Bacteria | 2357 |
| 217 | Ga0207683_10164173 | 3300026121 | Bacteria | 2009 |
| 218 | Ga0207683_10166039 | 3300026121 | Bacteria | 1997 |
| 219 | Ga0207683_10217897 | 3300026121 | Bacteria | 1739 |
| 220 | Ga0207698_10637899 | 3300026142 | Bacteria | 1054 |
| 221 | Ga0209969_1009798 | 3300027360 | Bacteria | 1367 |
| 222 | Ga0209282_1021662 | 3300027666 | Bacteria | 4060 |
| 223 | Ga0209971_1003310 | 3300027682 | Bacteria | 3830 |
| 224 | Ga0268265_10344320 | 3300028380 | Bacteria | 1359 |
| 225 | Ga0268264_10165665 | 3300028381 | Bacteria | 1995 |
| 226 | Ga0307512_10176703 | 3300030522 | Bacteria | 1210 |
| 227 | Ga0316176_1137038 | 3300030732 | Bacteria | 1256 |
| 228 | Ga0314311_1236547 | 3300030733 | Bacteria | 2986 |
| 229 | Ga0316178_1079536 | 3300030735 | Bacteria | 1854 |
| 230 | Ga0316183_1023302 | 3300030742 | Bacteria | 3715 |
| 231 | Ga0316181_1018571 | 3300030744 | Bacteria | 1058 |
| 232 | Ga0316182_1304162 | 3300030745 | Bacteria | 2476 |
| 233 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 234 | Ga0307408_100000048 | 3300031548 | Bacteria | 165579 |
| 235 | Ga0307408_100015366 | 3300031548 | Bacteria | 5095 |
| 236 | Ga0307408_100123977 | 3300031548 | Bacteria | 2006 |
| 237 | Ga0307408_100138275 | 3300031548 | Bacteria | 1908 |
| 238 | Ga0307408_100195513 | 3300031548 | Bacteria | 1633 |
| 239 | Ga0307408_100245264 | 3300031548 | Bacteria | 1474 |
| 240 | Ga0307408_100340198 | 3300031548 | Bacteria | 1270 |
| 241 | Ga0307408_100393913 | 3300031548 | Bacteria | 1187 |
| 242 | Ga0307514_10009341 | 3300031649 | Bacteria | 8255 |
| 243 | Ga0307514_10023261 | 3300031649 | Bacteria | 5027 |
| 244 | Ga0307516_10029170 | 3300031730 | Bacteria | 5579 |
| 245 | Ga0307516_10035762 | 3300031730 | Bacteria | 4979 |
| 246 | Ga0307405_10136890 | 3300031731 | Bacteria | 1701 |
| 247 | Ga0307405_10168019 | 3300031731 | Bacteria | 1561 |
| 248 | Ga0307405_10568583 | 3300031731 | Bacteria | 920 |
| 249 | Ga0307405_10769957 | 3300031731 | Bacteria | 803 |
| 250 | Ga0307413_11174528 | 3300031824 | Bacteria | 666 |
| 251 | Ga0307406_10000230 | 3300031901 | Bacteria | 34225 |
| 252 | Ga0307406_10002497 | 3300031901 | Bacteria | 10022 |
| 253 | Ga0307406_10007292 | 3300031901 | Bacteria | 6125 |
| 254 | Ga0307406_10445149 | 3300031901 | Bacteria | 1038 |
| 255 | Ga0307406_10556642 | 3300031901 | Bacteria | 939 |
| 256 | Ga0307406_11112723 | 3300031901 | Bacteria | 682 |
| 257 | Ga0307412_10055484 | 3300031911 | Bacteria | 2635 |
| 258 | Ga0307412_10110408 | 3300031911 | Bacteria | 1962 |
| 259 | Ga0307412_10571721 | 3300031911 | Bacteria | 952 |
| 260 | Ga0307412_10621723 | 3300031911 | Bacteria | 917 |
| 261 | Ga0307412_10729195 | 3300031911 | Bacteria | 853 |
| 262 | Ga0307412_10788973 | 3300031911 | Bacteria | 823 |
| 263 | Ga0307412_11091550 | 3300031911 | Bacteria | 710 |
| 264 | Ga0307409_100623054 | 3300031995 | Bacteria | 1069 |
| 265 | Ga0307416_101489273 | 3300032002 | Bacteria | 782 |
| 266 | Ga0307414_10033311 | 3300032004 | Bacteria | 3404 |
| 267 | Ga0307414_10112577 | 3300032004 | Bacteria | 2075 |
| 268 | Ga0307414_10231508 | 3300032004 | Bacteria | 1524 |
| 269 | Ga0307411_10482188 | 3300032005 | Bacteria | 1044 |
| 270 | Ga0307411_10738926 | 3300032005 | Bacteria | 861 |
| 271 | Ga0307411_10776498 | 3300032005 | Bacteria | 841 |
| 272 | Ga0395905_0471821 | 3300037471 | Bacteria | 1154 |
| 273 | Ga0395901_0377624 | 3300038443 | Bacteria | 1459 |
| 274 | Ga0439436_0006824 | 3300041404 | Bacteria | 3507 |
| 275 | Ga0439439_0006453 | 3300041406 | Bacteria | 2713 |
| 276 | Ga0439439_0059505 | 3300041406 | Bacteria | 1012 |
| 277 | Ga0439447_039502 | 3300041407 | Bacteria | 1155 |
| 278 | Ga0439447_061694 | 3300041407 | Bacteria | 881 |
| 279 | Ga0439461_0019374 | 3300041410 | Bacteria | 1339 |
| 280 | Ga0439461_0084070 | 3300041410 | Bacteria | 755 |
| 281 | Ga0439461_0151518 | 3300041410 | Bacteria | 599 |
| 282 | Ga0439466_0005061 | 3300041411 | Bacteria | 5054 |
| 283 | Ga0439466_0069519 | 3300041411 | Bacteria | 1123 |
| 284 | Ga0439466_0086335 | 3300041411 | Bacteria | 986 |
| 285 | Ga0439465_0016273 | 3300041413 | Bacteria | 2320 |
| 286 | Ga0451800_0179475 | 3300041459 | Bacteria | 665 |
| 287 | Ga0451804_1144560 | 3300041463 | Bacteria | 822 |
| 288 | Ga0439431_0007487 | 3300041997 | Bacteria | 2436 |
| 289 | Ga0439431_0029454 | 3300041997 | Bacteria | 1356 |
| 290 | Ga0439431_0055697 | 3300041997 | Bacteria | 1033 |
| 291 | Ga0439433_0046054 | 3300041999 | Bacteria | 1021 |
| 292 | Ga0439442_010382 | 3300042002 | Bacteria | 1888 |
| 293 | Ga0439442_084137 | 3300042002 | Bacteria | 682 |
| 294 | Ga0439445_0139342 | 3300042004 | Bacteria | 703 |
| 295 | Ga0439432_010077 | 3300042006 | Bacteria | 3284 |
| 296 | Ga0439432_017417 | 3300042006 | Bacteria | 2411 |
| 297 | Ga0439449_0000754 | 3300042007 | Bacteria | 12445 |
| 298 | Ga0439449_0005184 | 3300042007 | Bacteria | 5000 |
| 299 | Ga0439449_0031419 | 3300042007 | Bacteria | 1979 |
| 300 | Ga0439452_001220 | 3300042010 | Bacteria | 10956 |
| 301 | Ga0439452_019313 | 3300042010 | Bacteria | 1804 |
| 302 | Ga0439452_088832 | 3300042010 | Bacteria | 669 |
| 303 | Ga0439457_010767 | 3300042014 | Bacteria | 2094 |
| 304 | Ga0439457_027632 | 3300042014 | Bacteria | 1256 |
| 305 | Ga0439457_055070 | 3300042014 | Bacteria | 896 |
| 306 | Ga0439462_0024040 | 3300042015 | Bacteria | 1598 |
| 307 | Ga0439463_069823 | 3300042016 | Bacteria | 900 |
| 308 | Ga0450911_013255 | 3300042115 | Bacteria | 1104 |
| 309 | Ga0450920_018295 | 3300042122 | Bacteria | 1341 |
| 310 | Ga0450923_022881 | 3300042125 | Bacteria | 1228 |
| 311 | Ga0450923_036391 | 3300042125 | Bacteria | 1021 |
| 312 | Ga0450894_009230 | 3300042131 | Bacteria | 1278 |
| 313 | Ga0450894_020521 | 3300042131 | Bacteria | 891 |
| 314 | Ga0450896_019672 | 3300042133 | Bacteria | 984 |
| 315 | Ga0450896_021543 | 3300042133 | Bacteria | 947 |
| 316 | Ga0450898_008927 | 3300042134 | Bacteria | 1595 |
| 317 | Ga0450898_053837 | 3300042134 | Bacteria | 782 |
| 318 | Ga0450906_017883 | 3300042145 | Bacteria | 1275 |
| 319 | Ga0439446_0004216 | 3300042156 | Bacteria | 3631 |
| 320 | Ga0439446_0029334 | 3300042156 | Bacteria | 1588 |
| 321 | Ga0439446_0060591 | 3300042156 | Bacteria | 1143 |
| 322 | Ga0439446_0137222 | 3300042156 | Bacteria | 797 |
| 323 | Ga0450908_021845 | 3300042184 | Bacteria | 1122 |
| 324 | Ga0450909_013522 | 3300042185 | Bacteria | 1200 |
| 325 | Ga0439434_0026284 | 3300042435 | Bacteria | 1758 |
| 326 | Ga0439434_0045576 | 3300042435 | Bacteria | 1352 |
| 327 | Ga0450918_000576 | 3300042531 | Bacteria | 7808 |
| 328 | Ga0450893_0013954 | 3300042532 | Bacteria | 1343 |
| 329 | Ga0451577_0513680 | 3300042876 | Bacteria | 1088 |
| 330 | Ga0451577_0793830 | 3300042876 | Bacteria | 855 |
| 331 | Ga0451577_0826802 | 3300042876 | Bacteria | 836 |
| 332 | Ga0453683_0002555 | 3300044673 | Bacteria | 14028 |
| 333 | Ga0466965_0268136 | 3300044683 | Bacteria | 919 |
| 334 | Ga0453684_0439615 | 3300044712 | Bacteria | 1454 |
| 335 | Ga0466957_0372756 | 3300044842 | Bacteria | 972 |
| 336 | Ga0451576_0005954 | 3300045051 | Bacteria | 15100 |
| 337 | Ga0451576_0106333 | 3300045051 | Bacteria | 2920 |
| 338 | Ga0451576_0462944 | 3300045051 | Bacteria | 1331 |
| 339 | Ga0495629_0176217 | 3300046459 | Bacteria | 1483 |
| 340 | Ga0495639_0126317 | 3300046475 | Bacteria | 1222 |
| 341 | Ga0495643_0260772 | 3300046522 | Bacteria | 805 |
| 342 | Ga0495654_0121872 | 3300046530 | Bacteria | 1179 |
| 343 | Ga0495586_0348926 | 3300046535 | Bacteria | 850 |
| 344 | Ga0495598_0079599 | 3300046537 | Bacteria | 1049 |
| 345 | Ga0495633_0016027 | 3300046558 | Bacteria | 3876 |
| 346 | Ga0495656_0000146 | 3300046615 | Bacteria | 26151 |
| 347 | Ga0495656_0244350 | 3300046615 | Bacteria | 905 |
| 348 | Ga0495625_0000311 | 3300046660 | Bacteria | 74209 |
| 349 | Ga0495624_0285694 | 3300046690 | Bacteria | 996 |
| 350 | Ga0495670_0400172 | 3300046691 | Bacteria | 742 |
| 351 | Ga0495676_0043440 | 3300047321 | Bacteria | 3677 |
| 352 | Ga0495687_193505 | 3300047443 | Bacteria | 652 |
| 353 | Ga0495593_0147258 | 3300047673 | Bacteria | 1191 |
| 354 | Ga0495602_0457935 | 3300048088 | Bacteria | 899 |
| 355 | Ga0495614_0165206 | 3300048089 | Bacteria | 991 |
| 356 | Ga0495615_0096438 | 3300048090 | Bacteria | 830 |
| 357 | Ga0496101_0277432 | 3300048904 | Bacteria | 1309 |
| 358 | Ga0496102_0002798 | 3300048905 | Bacteria | 14877 |
| 359 | Ga0496102_0129322 | 3300048905 | Bacteria | 2362 |
| 360 | Ga0496103_0472189 | 3300048906 | Bacteria | 804 |
| 361 | Ga0496104_0605881 | 3300048907 | Bacteria | 1005 |
| 362 | Ga0496104_1002775 | 3300048907 | Bacteria | 739 |
| 363 | Ga0496105_0005741 | 3300048908 | Bacteria | 9450 |
| 364 | Ga0496105_0685876 | 3300048908 | Bacteria | 788 |
| 365 | Ga0496107_0226725 | 3300048910 | Bacteria | 1390 |
| 366 | Ga0496108_0096914 | 3300048911 | Bacteria | 2513 |
| 367 | Ga0496108_0525103 | 3300048911 | Bacteria | 1033 |
| 368 | Ga0496109_0034261 | 3300048912 | Bacteria | 4572 |
| 369 | Ga0496109_0760717 | 3300048912 | Bacteria | 907 |
| 370 | Ga0496109_1750037 | 3300048912 | Bacteria | 555 |
| 371 | Ga0496110_0008724 | 3300048913 | Bacteria | 8164 |
| 372 | Ga0496110_0614486 | 3300048913 | Bacteria | 985 |
| 373 | Ga0496111_0089744 | 3300048914 | Bacteria | 2251 |
| 374 | Ga0496114_0121789 | 3300048917 | Bacteria | 2244 |
| 375 | Ga0496116_0200411 | 3300048919 | Bacteria | 1045 |
| 376 | Ga0496116_0222155 | 3300048919 | Bacteria | 967 |
| 377 | Ga0496117_0144309 | 3300048920 | Bacteria | 1420 |
| 378 | Ga0496117_0241529 | 3300048920 | Bacteria | 991 |
| 379 | Ga0496117_0250293 | 3300048920 | Bacteria | 967 |
| 380 | Ga0496117_0292954 | 3300048920 | Bacteria | 865 |
| 381 | Ga0496118_0182517 | 3300048921 | Bacteria | 1266 |
| 382 | Ga0496121_0006746 | 3300048924 | Bacteria | 14087 |
| 383 | Ga0496122_0000584 | 3300048925 | Bacteria | 74681 |
| 384 | Ga0496122_0201300 | 3300048925 | Bacteria | 1164 |
| 385 | Ga0496122_0314711 | 3300048925 | Bacteria | 836 |
| 386 | Ga0496123_0000308 | 3300048926 | Bacteria | 94712 |
| 387 | Ga0496123_0181687 | 3300048926 | Bacteria | 1098 |
| 388 | Ga0496124_0106701 | 3300048927 | Bacteria | 2261 |
| 389 | Ga0496124_0191943 | 3300048927 | Bacteria | 1562 |
| 390 | Ga0496124_0355612 | 3300048927 | Bacteria | 1034 |
| 391 | Ga0496124_0408737 | 3300048927 | Bacteria | 939 |
| 392 | Ga0496125_0082446 | 3300048928 | Bacteria | 2451 |
| 393 | Ga0496125_0176709 | 3300048928 | Bacteria | 1427 |
| 394 | Ga0496125_0274414 | 3300048928 | Bacteria | 1048 |
| 395 | Ga0496125_0347498 | 3300048928 | Bacteria | 887 |
| 396 | Ga0496125_0428685 | 3300048928 | Bacteria | 764 |
| 397 | Ga0496126_0496864 | 3300048929 | Bacteria | 975 |
| 398 | Ga0501290_010270 | 3300049513 | Bacteria | 1195 |
| 399 | Ga0501300_001662 | 3300049523 | Bacteria | 3333 |
| 400 | Ga0501033_0303206 | 3300049570 | Bacteria | 1124 |
| 401 | Ga0501033_0637174 | 3300049570 | Bacteria | 729 |
| 402 | Ga0501034_0060330 | 3300049571 | Bacteria | 3810 |
| 403 | Ga0501034_0726737 | 3300049571 | Bacteria | 890 |
| 404 | Ga0501034_0771196 | 3300049571 | Bacteria | 856 |
| 405 | Ga0501034_1282971 | 3300049571 | Bacteria | 609 |
| 406 | Ga0501037_0708799 | 3300049573 | Bacteria | 669 |
| 407 | Ga0501038_0505211 | 3300049574 | Bacteria | 924 |
| 408 | Ga0501039_0289034 | 3300049575 | Bacteria | 1289 |
| 409 | Ga0501043_0571055 | 3300049579 | Bacteria | 838 |
| 410 | Ga0501046_0045145 | 3300049580 | Bacteria | 3502 |
| 411 | Ga0501047_0166235 | 3300049581 | Bacteria | 2076 |
| 412 | Ga0501047_0332958 | 3300049581 | Bacteria | 1357 |
| 413 | Ga0501068_0454608 | 3300049584 | Bacteria | 829 |
| 414 | Ga0501208_074831 | 3300049655 | Bacteria | 687 |
| 415 | Ga0501223_019950 | 3300049663 | Bacteria | 1315 |
| 416 | Ga0501223_048760 | 3300049663 | Bacteria | 822 |
| 417 | Ga0501224_014937 | 3300049664 | Bacteria | 1150 |
| 418 | Ga0501238_012280 | 3300049671 | Bacteria | 1158 |
| 419 | Ga0501243_093686 | 3300049675 | Bacteria | 599 |
| 420 | Ga0501225_0001856 | 3300049705 | Bacteria | 6635 |
| 421 | Ga0501080_0131877 | 3300049742 | Bacteria | 2314 |
| 422 | Ga0501083_0664160 | 3300049744 | Bacteria | 678 |
| 423 | Ga0501241_045820 | 3300049758 | Bacteria | 856 |
| 424 | Ga0501262_013621 | 3300049759 | Bacteria | 1050 |
| 425 | Ga0501262_019844 | 3300049759 | Bacteria | 913 |
| 426 | Ga0501263_005145 | 3300049760 | Bacteria | 1467 |
| 427 | Ga0501266_019127 | 3300049763 | Bacteria | 925 |
| 428 | Ga0501269_033318 | 3300049766 | Bacteria | 667 |
| 429 | Ga0501282_000221 | 3300049778 | Bacteria | 6989 |
| 430 | Ga0501035_0133202 | 3300049822 | Bacteria | 2165 |
| 431 | Ga0501044_0073607 | 3300049823 | Bacteria | 3472 |
| 432 | Ga0501044_0312943 | 3300049823 | Bacteria | 1496 |
| 433 | Ga0501226_010089 | 3300049853 | Bacteria | 1048 |
| 434 | nmdc:mga03683_166491_c1 | 3300050489 | Bacteria | 1000 |
| 435 | nmdc:mga03683_182863_c1 | 3300050489 | Bacteria | 957 |
| 436 | nmdc:mga03n38_271103_c1 | 3300050490 | Bacteria | 903 |
| 437 | nmdc:mga00v17_760827_c1 | 3300050491 | Bacteria | 619 |
| 438 | nmdc:mga0yw44_449218_c1 | 3300050492 | Bacteria | 873 |
| 439 | nmdc:mga0k408_153545_c1 | 3300050493 | Bacteria | 1371 |
| 440 | nmdc:mga0k408_436925_c1 | 3300050493 | Bacteria | 778 |
| 441 | nmdc:mga07m45_113368_c1 | 3300050496 | Bacteria | 1563 |
| 442 | nmdc:mga07m45_369795_c1 | 3300050496 | Bacteria | 833 |
| 443 | nmdc:mga07m45_494936_c1 | 3300050496 | Bacteria | 708 |
| 444 | nmdc:mga07m45_60103_c1 | 3300050496 | Bacteria | 2151 |
| 445 | nmdc:mga07m45_7933_c1 | 3300050496 | Bacteria | 5437 |
| 446 | nmdc:mga09592_759124_c1 | 3300050508 | Bacteria | 822 |
| 447 | Ga0500643_054372 | 3300053087 | Bacteria | 1136 |
| 448 | Ga0500644_0001052 | 3300053088 | Bacteria | 8211 |
| 449 | Ga0500651_0000738 | 3300053093 | Bacteria | 15959 |
| 450 | Ga0500651_0221541 | 3300053093 | Bacteria | 1109 |
| 451 | Ga0500566_0259457 | 3300053094 | Bacteria | 840 |
| 452 | Ga0500571_141612 | 3300053110 | Bacteria | 1070 |
| 453 | Ga0500593_000927 | 3300053117 | Bacteria | 10879 |
| 454 | Ga0500594_0044317 | 3300053118 | Bacteria | 1230 |
| 455 | Ga0500608_118018 | 3300053122 | Bacteria | 1207 |
| 456 | Ga0500618_023355 | 3300053125 | Bacteria | 1498 |
| 457 | Ga0500618_058990 | 3300053125 | Bacteria | 864 |
| 458 | Ga0500618_112447 | 3300053125 | Bacteria | 615 |
| 459 | Ga0500626_193117 | 3300053128 | Bacteria | 809 |
| 460 | Ga0500658_0002871 | 3300053134 | Bacteria | 6610 |
| 461 | Ga0500559_0077820 | 3300053136 | Bacteria | 1503 |
| 462 | Ga0500559_0244701 | 3300053136 | Bacteria | 845 |
| 463 | Ga0500564_202176 | 3300053138 | Bacteria | 815 |
| 464 | Ga0500573_0171645 | 3300053140 | Bacteria | 1172 |
| 465 | Ga0500574_052531 | 3300053141 | Bacteria | 1167 |
| 466 | Ga0500604_0192185 | 3300053151 | Bacteria | 701 |
| 467 | Ga0500619_203355 | 3300053154 | Bacteria | 664 |
| 468 | Ga0500634_0160001 | 3300053161 | Bacteria | 1040 |
| 469 | Ga0500638_115227 | 3300053162 | Bacteria | 1236 |
| 470 | Ga0500645_000320 | 3300053730 | Bacteria | 34158 |
| 471 | Ga0500645_010338 | 3300053730 | Bacteria | 3091 |
| 472 | Ga0500645_064068 | 3300053730 | Bacteria | 1060 |
| 473 | Ga0500596_021813 | 3300053735 | Bacteria | 966 |
| 474 | 2643866626 | 2643221570 | Bacteria | 5103772 |
| 475 | 2643991394 | 2643221596 | Bacteria | 5006805 |
| 476 | 2644062777 | 2643221609 | Bacteria | 6756331 |
| 477 | 2644076728 | 2643221611 | Bacteria | 6820941 |
| 478 | 2644162920 | 2643221628 | Bacteria | 5745828 |
| 479 | 2644296319 | 2643221652 | Bacteria | 5140275 |
| 480 | 2644329535 | 2643221658 | Bacteria | 6064537 |
| 481 | 2644398303 | 2643221672 | Bacteria | 6322190 |
| 482 | 2644465370 | 2643221683 | Bacteria | 5749203 |
| 483 | 2644647720 | 2643221717 | Bacteria | 5676132 |
| 484 | 2738722863 | 2738541277 | Bacteria | 7458140 |
| 485 | 2739283434 | 2738543019 | Bacteria | 7459457 |
| 486 | 2831270401 | 2831265667 | Bacteria | 7184833 |
| 487 | 2842680121 | 2842677519 | Bacteria | 5615038 |
| 488 | 2842748126 | 2842747753 | Bacteria | 5578255 |
| 489 | 2857578485 | 2857576091 | Bacteria | 5465855 |
| 490 | 2881101401 | 2881101125 | Bacteria | 4590519 |
| 491 | 2885196293 | 2885192300 | Bacteria | 5882526 |
| 492 | 2885199761 | 2885198086 | Bacteria | 7212419 |
| 493 | 2885213412 | 2885211737 | Bacteria | 7212420 |
| 494 | 2894025541 | 2894023352 | Bacteria | 5167372 |
| 495 | 2904454711 | 2904449895 | Bacteria | 6927402 |
| 496 | 2904460366 | 2904456579 | Bacteria | 6819253 |
| 497 | 2919464173 | 2919462493 | Bacteria | 5817112 |
| 498 | 2928120323 | 2928115317 | Bacteria | 6477646 |
| 499 | 2929524563 | 2929520902 | Bacteria | 6765052 |
| 500 | 2945946989 | 2945945610 | Bacteria | 5951079 |
| 501 | 2945976666 | 2945972063 | Bacteria | 6086495 |
| 502 | 2954771733 | 2954767861 | Bacteria | 5535784 |
| 503 | 2990712186 | 2990710928 | Bacteria | 5002431 |
| 504 | Ga0451793_0261163 | |||
| 505 | SwRhRL2b_contig_1147302 | |||
| 506 | JGI25156J39149_1000148 | |||
| 507 | JGI25154J39366_1000155 | |||
| 508 | JGI25157J39369_1000183 | |||
| 509 | JGI25152J39213_1003568 | |||
| 510 | JGI25159J45721_1007514 | |||
| 511 | JGI25151J46595_10016629 | |||
| 512 | JGI25153J46596_10014853 | |||
| 513 | rootH1_10052795 | |||
| 514 | JGI25160J50197_1031205 | |||
| 515 | Ga0006562J51391_1062293 | |||
| 516 | Ga0055526_1003224 | |||
| 517 | Ga0055526_1007263 | |||
| 518 | Ga0055537_1000067 | |||
| 519 | Ga0055537_1000086 | |||
| 520 | Ga0055524_1000279 | |||
| 521 | Ga0055536_1001302 | |||
| 522 | Ga0055536_1005425 | |||
| 523 | Ga0055534_1000079 | |||
| 524 | Ga0055534_1002371 | |||
| 525 | Ga0055534_1039205 | |||
| 526 | Ga0055528_1001037 | |||
| 527 | Ga0055528_1005743 | |||
| 528 | Ga0055528_1013543 | |||
| 529 | Ga0055530_10000730 | |||
| 530 | Ga0055530_10001255 | |||
| 531 | Ga0055530_10002701 | |||
| 532 | Ga0055530_10006113 | |||
| 533 | Ga0055540_1000553 | |||
| 534 | Ga0055540_1008030 | |||
| 535 | Ga0055540_1015457 | |||
| 536 | Ga0055531_10000726 | |||
| 537 | Ga0055531_10000873 | |||
| 538 | Ga0055531_10021958 | |||
| 539 | Ga0065165_1007358 | |||
| 540 | Ga0065165_1031470 | |||
| 541 | Ga0065714_10208485 | |||
| 542 | Ga0065714_10220428 | |||
| 543 | Ga0065714_10244725 | |||
| 544 | Ga0065704_10092299 | |||
| 545 | Ga0065704_10101719 | |||
| 546 | Ga0070676_10448286 | |||
| 547 | Ga0070676_10763020 | |||
| 548 | Ga0070670_100257843 | |||
| 549 | Ga0070677_10037328 | |||
| 550 | Ga0070666_10035821 | |||
| 551 | Ga0068868_100174139 | |||
| 552 | Ga0070675_100350489 | |||
| 553 | Ga0070675_100911185 | |||
| 554 | Ga0070671_100020401 | |||
| 555 | Ga0070674_100286594 | |||
| 556 | Ga0070673_100058082 | |||
| 557 | Ga0070667_100157089 | |||
| 558 | Ga0070678_100138986 | |||
| 559 | Ga0070678_100182054 | |||
| 560 | Ga0070678_100880435 | |||
| 561 | Ga0070662_100005845 | |||
| 562 | Ga0068867_100014481 | |||
| 563 | Ga0068867_101379558 | |||
| 564 | Ga0068853_100008771 | |||
| 565 | Ga0068853_100353919 | |||
| 566 | Ga0068853_101351582 | |||
| 567 | Ga0070672_100109451 | |||
| 568 | Ga0070665_100045803 | |||
| 569 | Ga0070664_100367553 | |||
| 570 | Ga0068857_100251748 | |||
| 571 | Ga0068852_100516348 | |||
| 572 | Ga0068859_100165698 | |||
| 573 | Ga0068859_100180589 | |||
| 574 | Ga0068859_102118244 | |||
| 575 | Ga0068864_100282451 | |||
| 576 | Ga0068870_10733247 | |||
| 577 | Ga0068863_100106076 | |||
| 578 | Ga0068863_100187941 | |||
| 579 | Ga0068860_100274847 | |||
| 580 | Ga0068860_100559990 | |||
| 581 | Ga0068860_100690603 | |||
| 582 | Ga0081455_10467828 | |||
| 583 | Ga0075365_10694402 | |||
| 584 | Ga0075363_100017606 | |||
| 585 | Ga0075364_10130605 | |||
| 586 | Ga0075364_10154607 | |||
| 587 | Ga0075362_10060604 | |||
| 588 | Ga0075367_10021333 | |||
| 589 | Ga0075369_10061085 | |||
| 590 | Ga0097621_100220761 | |||
| 591 | Ga0097621_100347164 | |||
| 592 | Ga0097621_100621599 | |||
| 593 | Ga0075370_10000356 | |||
| 594 | Ga0075370_10000594 | |||
| 595 | Ga0075370_10006193 | |||
| 596 | Ga0075370_10140276 | |||
| 597 | Ga0075370_10235640 | |||
| 598 | Ga0068871_100020569 | |||
| 599 | Ga0075430_100071251 | |||
| 600 | Ga0068865_100319692 | |||
| 601 | Ga0097620_100165698 | |||
| 602 | Ga0097620_100180598 | |||
| 603 | Ga0097620_102117822 | |||
| 604 | Ga0079104_1035134 | |||
| 605 | Ga0099826_10023668 | |||
| 606 | Ga0105244_10007302 | |||
| 607 | Ga0105240_10176561 | |||
| 608 | Ga0105243_10001470 | |||
| 609 | Ga0105243_10192604 | |||
| 610 | Ga0105242_10425674 | |||
| 611 | Ga0105248_10021049 | |||
| 612 | Ga0105237_10498930 | |||
| 613 | Ga0105249_10384831 | |||
| 614 | Ga0105246_10010775 | |||
| 615 | Ga0157373_10266450 | |||
| 616 | Ga0157371_10197097 | |||
| 617 | Ga0157370_10393191 | |||
| 618 | Ga0157370_10700836 | |||
| 619 | Ga0163162_10764197 | |||
| 620 | Ga0163162_10790687 | |||
| 621 | Ga0163162_11416703 | |||
| 622 | Ga0157375_10069884 | |||
| 623 | Ga0157375_10455269 | |||
| 624 | Ga0157375_10484430 | |||
| 625 | Ga0163163_10062944 | |||
| 626 | Ga0182008_10000330 | |||
| 627 | Ga0182008_10002376 | |||
| 628 | Ga0182008_10003615 | |||
| 629 | Ga0182008_10175802 | |||
| 630 | Ga0157379_10640779 | |||
| 631 | Ga0157379_10979629 | |||
| 632 | Ga0157376_11660253 | |||
| 633 | Ga0182006_1001221 | |||
| 634 | Ga0182006_1029509 | |||
| 635 | Ga0182007_10003876 | |||
| 636 | Ga0182007_10014003 | |||
| 637 | Ga0182005_1022863 | |||
| 638 | Ga0163161_10080119 | |||
| 639 | Ga0163161_10375954 | |||
| 640 | Ga0209435_100014 | |||
| 641 | Ga0207425_1004043 | |||
| 642 | Ga0207425_1005751 | |||
| 643 | Ga0209646_1000001 | |||
| 644 | Ga0209026_1000137 | |||
| 645 | Ga0209759_1000013 | |||
| 646 | Ga0209129_1004105 | |||
| 647 | Ga0209565_1000028 | |||
| 648 | Ga0209565_1000040 | |||
| 649 | Ga0209565_1037363 | |||
| 650 | Ga0209673_1000035 | |||
| 651 | Ga0209673_1000109 | |||
| 652 | Ga0209130_1000759 | |||
| 653 | Ga0209130_1008079 | |||
| 654 | Ga0209675_1000024 | |||
| 655 | Ga0209675_1000111 | |||
| 656 | Ga0209675_1002085 | |||
| 657 | Ga0209675_1041061 | |||
| 658 | Ga0209676_1000005 | |||
| 659 | Ga0209676_1000254 | |||
| 660 | Ga0209676_1000634 | |||
| 661 | Ga0209025_1001864 | |||
| 662 | Ga0209025_1006211 | |||
| 663 | Ga0209025_1007844 | |||
| 664 | Ga0209025_1023144 | |||
| 665 | Ga0209025_1030314 | |||
| 666 | Ga0209564_1000531 | |||
| 667 | Ga0209564_1000714 | |||
| 668 | Ga0209564_1006417 | |||
| 669 | Ga0209564_1042932 | |||
| 670 | Ga0209758_1019515 | |||
| 671 | Ga0209050_1000007 | |||
| 672 | Ga0209050_1000023 | |||
| 673 | Ga0209050_1000497 | |||
| 674 | Ga0209050_1021478 | |||
| 675 | Ga0209256_1000003 | |||
| 676 | Ga0207426_1007615 | |||
| 677 | Ga0207426_1011012 | |||
| 678 | Ga0209051_1000009 | |||
| 679 | Ga0209051_1000017 | |||
| 680 | Ga0209051_1000073 | |||
| 681 | Ga0209051_1000262 | |||
| 682 | Ga0209257_1000011 | |||
| 683 | Ga0209257_1000041 | |||
| 684 | Ga0209257_1000139 | |||
| 685 | Ga0207655_1005174 | |||
| 686 | Ga0207680_10069218 | |||
| 687 | Ga0207680_10145949 | |||
| 688 | Ga0207645_10071330 | |||
| 689 | Ga0207705_10314981 | |||
| 690 | Ga0207671_10080902 | |||
| 691 | Ga0207681_10084608 | |||
| 692 | Ga0207650_10250350 | |||
| 693 | Ga0207659_10020357 | |||
| 694 | Ga0207659_10095802 | |||
| 695 | Ga0207659_11242150 | |||
| 696 | Ga0207690_11056496 | |||
| 697 | Ga0207706_10021250 | |||
| 698 | Ga0207686_10860614 | |||
| 699 | Ga0207709_10012378 | |||
| 700 | Ga0207669_10263647 | |||
| 701 | Ga0207669_10490385 | |||
| 702 | Ga0207691_10003024 | |||
| 703 | Ga0207691_10842993 | |||
| 704 | Ga0207711_10138409 | |||
| 705 | Ga0207689_10452042 | |||
| 706 | Ga0207679_10565213 | |||
| 707 | Ga0207651_10205333 | |||
| 708 | Ga0207712_10314886 | |||
| 709 | Ga0207658_10314216 | |||
| 710 | Ga0207658_10760107 | |||
| 711 | Ga0207708_10223560 | |||
| 712 | Ga0207641_10196883 | |||
| 713 | Ga0207641_10325008 | |||
| 714 | Ga0207648_10096297 | |||
| 715 | Ga0207676_10266574 | |||
| 716 | Ga0207674_10099674 | |||
| 717 | Ga0207674_10526484 | |||
| 718 | Ga0207683_10120290 | |||
| 719 | Ga0207683_10164173 | |||
| 720 | Ga0207683_10166039 | |||
| 721 | Ga0207683_10217897 | |||
| 722 | Ga0207698_10637899 | |||
| 723 | Ga0209969_1009798 | |||
| 724 | Ga0209282_1021662 | |||
| 725 | Ga0209971_1003310 | |||
| 726 | Ga0268265_10344320 | |||
| 727 | Ga0268264_10165665 | |||
| 728 | Ga0307512_10176703 | |||
| 729 | Ga0316176_1137038 | |||
| 730 | Ga0314311_1236547 | |||
| 731 | Ga0316178_1079536 | |||
| 732 | Ga0316183_1023302 | |||
| 733 | Ga0316181_1018571 | |||
| 734 | Ga0316182_1304162 | |||
| 735 | Ga0307513_10000011 | |||
| 736 | Ga0307408_100000048 | |||
| 737 | Ga0307408_100015366 | |||
| 738 | Ga0307408_100123977 | |||
| 739 | Ga0307408_100138275 | |||
| 740 | Ga0307408_100195513 | |||
| 741 | Ga0307408_100245264 | |||
| 742 | Ga0307408_100340198 | |||
| 743 | Ga0307408_100393913 | |||
| 744 | Ga0307514_10009341 | |||
| 745 | Ga0307514_10023261 | |||
| 746 | Ga0307516_10029170 | |||
| 747 | Ga0307516_10035762 | |||
| 748 | Ga0307405_10136890 | |||
| 749 | Ga0307405_10168019 | |||
| 750 | Ga0307405_10568583 | |||
| 751 | Ga0307405_10769957 | |||
| 752 | Ga0307413_11174528 | |||
| 753 | Ga0307406_10000230 | |||
| 754 | Ga0307406_10002497 | |||
| 755 | Ga0307406_10007292 | |||
| 756 | Ga0307406_10445149 | |||
| 757 | Ga0307406_10556642 | |||
| 758 | Ga0307406_11112723 | |||
| 759 | Ga0307412_10055484 | |||
| 760 | Ga0307412_10110408 | |||
| 761 | Ga0307412_10571721 | |||
| 762 | Ga0307412_10621723 | |||
| 763 | Ga0307412_10729195 | |||
| 764 | Ga0307412_10788973 | |||
| 765 | Ga0307412_11091550 | |||
| 766 | Ga0307409_100623054 | |||
| 767 | Ga0307416_101489273 | |||
| 768 | Ga0307414_10033311 | |||
| 769 | Ga0307414_10112577 | |||
| 770 | Ga0307414_10231508 | |||
| 771 | Ga0307411_10482188 | |||
| 772 | Ga0307411_10738926 | |||
| 773 | Ga0307411_10776498 | |||
| 774 | Ga0395905_0471821 | |||
| 775 | Ga0395901_0377624 | |||
| 776 | Ga0439436_0006824 | |||
| 777 | Ga0439439_0006453 | |||
| 778 | Ga0439439_0059505 | |||
| 779 | Ga0439447_039502 | |||
| 780 | Ga0439447_061694 | |||
| 781 | Ga0439461_0019374 | |||
| 782 | Ga0439461_0084070 | |||
| 783 | Ga0439461_0151518 | |||
| 784 | Ga0439466_0005061 | |||
| 785 | Ga0439466_0069519 | |||
| 786 | Ga0439466_0086335 | |||
| 787 | Ga0439465_0016273 | |||
| 788 | Ga0451800_0179475 | |||
| 789 | Ga0451804_1144560 | |||
| 790 | Ga0439431_0007487 | |||
| 791 | Ga0439431_0029454 | |||
| 792 | Ga0439431_0055697 | |||
| 793 | Ga0439433_0046054 | |||
| 794 | Ga0439442_010382 | |||
| 795 | Ga0439442_084137 | |||
| 796 | Ga0439445_0139342 | |||
| 797 | Ga0439432_010077 | |||
| 798 | Ga0439432_017417 | |||
| 799 | Ga0439449_0000754 | |||
| 800 | Ga0439449_0005184 | |||
| 801 | Ga0439449_0031419 | |||
| 802 | Ga0439452_001220 | |||
| 803 | Ga0439452_019313 | |||
| 804 | Ga0439452_088832 | |||
| 805 | Ga0439457_010767 | |||
| 806 | Ga0439457_027632 | |||
| 807 | Ga0439457_055070 | |||
| 808 | Ga0439462_0024040 | |||
| 809 | Ga0439463_069823 | |||
| 810 | Ga0450911_013255 | |||
| 811 | Ga0450920_018295 | |||
| 812 | Ga0450923_022881 | |||
| 813 | Ga0450923_036391 | |||
| 814 | Ga0450894_009230 | |||
| 815 | Ga0450894_020521 | |||
| 816 | Ga0450896_019672 | |||
| 817 | Ga0450896_021543 | |||
| 818 | Ga0450898_008927 | |||
| 819 | Ga0450898_053837 | |||
| 820 | Ga0450906_017883 | |||
| 821 | Ga0439446_0004216 | |||
| 822 | Ga0439446_0029334 | |||
| 823 | Ga0439446_0060591 | |||
| 824 | Ga0439446_0137222 | |||
| 825 | Ga0450908_021845 | |||
| 826 | Ga0450909_013522 | |||
| 827 | Ga0439434_0026284 | |||
| 828 | Ga0439434_0045576 | |||
| 829 | Ga0450918_000576 | |||
| 830 | Ga0450893_0013954 | |||
| 831 | Ga0451577_0513680 | |||
| 832 | Ga0451577_0793830 | |||
| 833 | Ga0451577_0826802 | |||
| 834 | Ga0453683_0002555 | |||
| 835 | Ga0466965_0268136 | |||
| 836 | Ga0453684_0439615 | |||
| 837 | Ga0466957_0372756 | |||
| 838 | Ga0451576_0005954 | |||
| 839 | Ga0451576_0106333 | |||
| 840 | Ga0451576_0462944 | |||
| 841 | Ga0495629_0176217 | |||
| 842 | Ga0495639_0126317 | |||
| 843 | Ga0495643_0260772 | |||
| 844 | Ga0495654_0121872 | |||
| 845 | Ga0495586_0348926 | |||
| 846 | Ga0495598_0079599 | |||
| 847 | Ga0495633_0016027 | |||
| 848 | Ga0495656_0000146 | |||
| 849 | Ga0495656_0244350 | |||
| 850 | Ga0495625_0000311 | |||
| 851 | Ga0495624_0285694 | |||
| 852 | Ga0495670_0400172 | |||
| 853 | Ga0495676_0043440 | |||
| 854 | Ga0495687_193505 | |||
| 855 | Ga0495593_0147258 | |||
| 856 | Ga0495602_0457935 | |||
| 857 | Ga0495614_0165206 | |||
| 858 | Ga0495615_0096438 | |||
| 859 | Ga0496101_0277432 | |||
| 860 | Ga0496102_0002798 | |||
| 861 | Ga0496102_0129322 | |||
| 862 | Ga0496103_0472189 | |||
| 863 | Ga0496104_0605881 | |||
| 864 | Ga0496104_1002775 | |||
| 865 | Ga0496105_0005741 | |||
| 866 | Ga0496105_0685876 | |||
| 867 | Ga0496107_0226725 | |||
| 868 | Ga0496108_0096914 | |||
| 869 | Ga0496108_0525103 | |||
| 870 | Ga0496109_0034261 | |||
| 871 | Ga0496109_0760717 | |||
| 872 | Ga0496109_1750037 | |||
| 873 | Ga0496110_0008724 | |||
| 874 | Ga0496110_0614486 | |||
| 875 | Ga0496111_0089744 | |||
| 876 | Ga0496114_0121789 | |||
| 877 | Ga0496116_0200411 | |||
| 878 | Ga0496116_0222155 | |||
| 879 | Ga0496117_0144309 | |||
| 880 | Ga0496117_0241529 | |||
| 881 | Ga0496117_0250293 | |||
| 882 | Ga0496117_0292954 | |||
| 883 | Ga0496118_0182517 | |||
| 884 | Ga0496121_0006746 | |||
| 885 | Ga0496122_0000584 | |||
| 886 | Ga0496122_0201300 | |||
| 887 | Ga0496122_0314711 | |||
| 888 | Ga0496123_0000308 | |||
| 889 | Ga0496123_0181687 | |||
| 890 | Ga0496124_0106701 | |||
| 891 | Ga0496124_0191943 | |||
| 892 | Ga0496124_0355612 | |||
| 893 | Ga0496124_0408737 | |||
| 894 | Ga0496125_0082446 | |||
| 895 | Ga0496125_0176709 | |||
| 896 | Ga0496125_0274414 | |||
| 897 | Ga0496125_0347498 | |||
| 898 | Ga0496125_0428685 | |||
| 899 | Ga0496126_0496864 | |||
| 900 | Ga0501290_010270 | |||
| 901 | Ga0501300_001662 | |||
| 902 | Ga0501033_0303206 | |||
| 903 | Ga0501033_0637174 | |||
| 904 | Ga0501034_0060330 | |||
| 905 | Ga0501034_0726737 | |||
| 906 | Ga0501034_0771196 | |||
| 907 | Ga0501034_1282971 | |||
| 908 | Ga0501037_0708799 | |||
| 909 | Ga0501038_0505211 | |||
| 910 | Ga0501039_0289034 | |||
| 911 | Ga0501043_0571055 | |||
| 912 | Ga0501046_0045145 | |||
| 913 | Ga0501047_0166235 | |||
| 914 | Ga0501047_0332958 | |||
| 915 | Ga0501068_0454608 | |||
| 916 | Ga0501208_074831 | |||
| 917 | Ga0501223_019950 | |||
| 918 | Ga0501223_048760 | |||
| 919 | Ga0501224_014937 | |||
| 920 | Ga0501238_012280 | |||
| 921 | Ga0501243_093686 | |||
| 922 | Ga0501225_0001856 | |||
| 923 | Ga0501080_0131877 | |||
| 924 | Ga0501083_0664160 | |||
| 925 | Ga0501241_045820 | |||
| 926 | Ga0501262_013621 | |||
| 927 | Ga0501262_019844 | |||
| 928 | Ga0501263_005145 | |||
| 929 | Ga0501266_019127 | |||
| 930 | Ga0501269_033318 | |||
| 931 | Ga0501282_000221 | |||
| 932 | Ga0501035_0133202 | |||
| 933 | Ga0501044_0073607 | |||
| 934 | Ga0501044_0312943 | |||
| 935 | Ga0501226_010089 | |||
| 936 | nmdc:mga03683_166491_c1 | |||
| 937 | nmdc:mga03683_182863_c1 | |||
| 938 | nmdc:mga03n38_271103_c1 | |||
| 939 | nmdc:mga00v17_760827_c1 | |||
| 940 | nmdc:mga0yw44_449218_c1 | |||
| 941 | nmdc:mga0k408_153545_c1 | |||
| 942 | nmdc:mga0k408_436925_c1 | |||
| 943 | nmdc:mga07m45_113368_c1 | |||
| 944 | nmdc:mga07m45_369795_c1 | |||
| 945 | nmdc:mga07m45_494936_c1 | |||
| 946 | nmdc:mga07m45_60103_c1 | |||
| 947 | nmdc:mga07m45_7933_c1 | |||
| 948 | nmdc:mga09592_759124_c1 | |||
| 949 | Ga0500643_054372 | |||
| 950 | Ga0500644_0001052 | |||
| 951 | Ga0500651_0000738 | |||
| 952 | Ga0500651_0221541 | |||
| 953 | Ga0500566_0259457 | |||
| 954 | Ga0500571_141612 | |||
| 955 | Ga0500593_000927 | |||
| 956 | Ga0500594_0044317 | |||
| 957 | Ga0500608_118018 | |||
| 958 | Ga0500618_023355 | |||
| 959 | Ga0500618_058990 | |||
| 960 | Ga0500618_112447 | |||
| 961 | Ga0500626_193117 | |||
| 962 | Ga0500658_0002871 | |||
| 963 | Ga0500559_0077820 | |||
| 964 | Ga0500559_0244701 | |||
| 965 | Ga0500564_202176 | |||
| 966 | Ga0500573_0171645 | |||
| 967 | Ga0500574_052531 | |||
| 968 | Ga0500604_0192185 | |||
| 969 | Ga0500619_203355 | |||
| 970 | Ga0500634_0160001 | |||
| 971 | Ga0500638_115227 | |||
| 972 | Ga0500645_000320 | |||
| 973 | Ga0500645_010338 | |||
| 974 | Ga0500645_064068 | |||
| 975 | Ga0500596_021813 | |||
| 976 | 2643866626 | |||
| 977 | 2643991394 | |||
| 978 | 2644062777 | |||
| 979 | 2644076728 | |||
| 980 | 2644162920 | |||
| 981 | 2644296319 | |||
| 982 | 2644329535 | |||
| 983 | 2644398303 | |||
| 984 | 2644465370 | |||
| 985 | 2644647720 | |||
| 986 | 2738722863 | |||
| 987 | 2739283434 | |||
| 988 | 2831270401 | |||
| 989 | 2842680121 | |||
| 990 | 2842748126 | |||
| 991 | 2857578485 | |||
| 992 | 2881101401 | |||
| 993 | 2885196293 | |||
| 994 | 2885199761 | |||
| 995 | 2885213412 | |||
| 996 | 2894025541 | |||
| 997 | 2904454711 | |||
| 998 | 2904460366 | |||
| 999 | 2919464173 | |||
| 1000 | 2928120323 | |||
| 1001 | 2929524563 | |||
| 1002 | 2945946989 | |||
| 1003 | 2945976666 | |||
| 1004 | 2954771733 | |||
| 1005 | 2990712186 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.783 | 16 | 162 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7472 | 1 | 152 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7066 | 1 | 152 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.6818 | 16 | 162 |
| 6trc-assembly1.cif.gz_L | cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6 | 0.5203 | 57 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.856 | 28 | 156 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8384 | 28 | 156 | 1.20.120.550 |
| af_Q10085_240_394_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5404 | 13 | 153 | 1.20.1250.20 |
| af_O70352_1_107_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.529 | 86 | 162 | 1.20.5.780 |
| af_P27701_1_107_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.5248 | 86 | 162 | 1.20.5.780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H0CUT6-F1-model_v4 | TRAP transporter small permease protein | 0.9586 | 1 | 153 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A4Y6RWK7-F1-model_v4 | TRAP transporter small permease protein | 0.9529 | 2 | 157 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A0G2Z721-F1-model_v4 | C4-dicarboxylate ABC transporter permease | 0.9528 | 3 | 154 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A6I7PBV5-F1-model_v4 | TRAP transporter small permease protein | 0.949 | 2 | 152 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A7W5LKC0-F1-model_v4 | TRAP transporter small permease protein | 0.9485 | 3 | 153 |
GO:0005886
GO:0015740 GO:0022857 |