F455909

General Info

Members Datasets Scaffolds Average Seq Length
502 228 1004 393

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0046732|Ga0495652_0046732_453_1706
Length 417
Sequence MLTTPVRKCCRSFVGHPEATIKMGRRLEQLEEFGIDVVLERRHGVRASVLRGILYGLSFVYDRVVQLRLYFYRKRVFRERTLGCLVISIGNLTVGGTGKTPIVEKFARALQAGGRRVAILSRGYKSVPRKRSWRSRFRGDSEPPRIVSDGKSLLLDSLTAGDEPYMLAHNLKDVIVLVDKDRVKSGRLAIDKWQVDTLLLDDGLQYLHLKHRLDMVLVDRQAPFGNEFLLPRGTLRERPGNLRRASYIFITKNTGEPNFELMRRIRRYNRTAEVIECAHKPLYLQNVFTDEQLPLETLRNAFIGSLCAIAAPGSFEGALAQLGAHVDLAKSYIDHHYYTEAELISFVNRCIRRDLAMIVTTEKDSVRMPRLPEADLKVPIYFLRVEIDILSGHESWEHCVARICKPKPALPPERFFA

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
178 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
179 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 6.77
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 19.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0046732 3300046529 Unclassified 3715
2 SwRhRL3b_contig_3893210 2162886006 Bacteria 1806
3 JGI24746J21847_1000652 3300001977 Bacteria 5306
4 JGI24744J21845_10001241 3300002077 Bacteria 5015
5 JGI24033J26618_1002161 3300002155 Unclassified 1986
6 JGI25406J46586_10000067 3300003203 Bacteria 47883
7 rootH1_10015672 3300003316 Bacteria 2347
8 rootH2_10095918 3300003320 Bacteria 12992
9 rootL2_10071120 3300003322 Bacteria 7551
10 rootH1_10128811 3300003323 Bacteria 2897
11 JGI25404J52841_10000824 3300003659 Bacteria 4954
12 Ga0065712_10000304 3300005290 Bacteria 16967
13 Ga0065712_10012542 3300005290 Unclassified 2020
14 Ga0065715_10000348 3300005293 Bacteria 13513
15 Ga0065715_10002584 3300005293 Bacteria 8292
16 Ga0065715_10010392 3300005293 Unclassified 2892
17 Ga0065707_10005531 3300005295 Bacteria 3151
18 Ga0065707_10113574 3300005295 Unclassified 2302
19 Ga0070658_10001562 3300005327 Bacteria 19415
20 Ga0070658_10025103 3300005327 Bacteria 4778
21 Ga0070658_10091873 3300005327 Unclassified 2502
22 Ga0070676_10001727 3300005328 Bacteria 11113
23 Ga0070676_10009338 3300005328 Bacteria 5303
24 Ga0070676_10050351 3300005328 Unclassified 2441
25 Ga0070683_100013179 3300005329 Bacteria 7200
26 Ga0070683_100017017 3300005329 Bacteria 6416
27 Ga0070683_100395065 3300005329 Bacteria 1318
28 Ga0070690_100001685 3300005330 Bacteria 11639
29 Ga0070690_100214896 3300005330 Bacteria 1344
30 Ga0070670_100003629 3300005331 Bacteria 12852
31 Ga0070670_100133944 3300005331 Bacteria 2141
32 Ga0070670_100205238 3300005331 Bacteria 1713
33 Ga0070677_10008437 3300005333 Bacteria 3467
34 Ga0070677_10023132 3300005333 Unclassified 2298
35 Ga0068869_100228962 3300005334 Bacteria 1476
36 Ga0070666_10011408 3300005335 Bacteria 5574
37 Ga0068868_100055107 3300005338 Unclassified 3136
38 Ga0068868_100064937 3300005338 Unclassified 2899
39 Ga0068868_100174934 3300005338 Unclassified 1779
40 Ga0068868_100225510 3300005338 Bacteria 1570
41 Ga0070660_100028388 3300005339 Bacteria 4186
42 Ga0070660_100090797 3300005339 Bacteria 2408
43 Ga0070660_100157688 3300005339 Bacteria 1828
44 Ga0070687_100015225 3300005343 Bacteria 3471
45 Ga0070687_100040511 3300005343 Bacteria 2348
46 Ga0070661_100002489 3300005344 Bacteria 12627
47 Ga0070668_100001884 3300005347 Bacteria 15324
48 Ga0070668_100002409 3300005347 Bacteria 13765
49 Ga0070668_100004232 3300005347 Bacteria 10647
50 Ga0070668_100034511 3300005347 Bacteria 3855
51 Ga0070669_100011410 3300005353 Bacteria 6309
52 Ga0070669_100027641 3300005353 Bacteria 4083
53 Ga0070669_100033986 3300005353 Bacteria 3690
54 Ga0070675_100002985 3300005354 Bacteria 12783
55 Ga0070675_100013840 3300005354 Bacteria 6351
56 Ga0070675_100025780 3300005354 Bacteria 4713
57 Ga0070675_100038443 3300005354 Unclassified 3900
58 Ga0070675_100085731 3300005354 Unclassified 2631
59 Ga0070671_100002062 3300005355 Bacteria 15501
60 Ga0070671_100014805 3300005355 Bacteria 6301
61 Ga0070671_100035097 3300005355 Bacteria 4154
62 Ga0070671_100045959 3300005355 Bacteria 3631
63 Ga0070671_100051119 3300005355 Bacteria 3437
64 Ga0070671_100208542 3300005355 Unclassified 1657
65 Ga0070674_100001869 3300005356 Bacteria 11424
66 Ga0070674_100003858 3300005356 Bacteria 8484
67 Ga0070673_100055528 3300005364 Bacteria 3120
68 Ga0070673_100095814 3300005364 Bacteria 2434
69 Ga0070688_100003765 3300005365 Bacteria 7858
70 Ga0070688_100020681 3300005365 Bacteria 3830
71 Ga0070688_100030267 3300005365 Bacteria 3247
72 Ga0070688_100137298 3300005365 Bacteria 1657
73 Ga0070659_100029206 3300005366 Bacteria 4261
74 Ga0070659_100097377 3300005366 Bacteria 2364
75 Ga0070667_100015887 3300005367 Bacteria 6228
76 Ga0070667_100016224 3300005367 Bacteria 6162
77 Ga0070667_100055815 3300005367 Bacteria 3335
78 Ga0070667_100063608 3300005367 Bacteria 3127
79 Ga0070667_100069509 3300005367 Unclassified 2997
80 Ga0070703_10011353 3300005406 Unclassified 2515
81 Ga0070709_10005780 3300005434 Bacteria 6706
82 Ga0070714_100092961 3300005435 Unclassified 2644
83 Ga0070713_100044726 3300005436 Bacteria 3625
84 Ga0070713_100160376 3300005436 Bacteria 2007
85 Ga0070711_100001122 3300005439 Bacteria 14306
86 Ga0070711_100011987 3300005439 Bacteria 5401
87 Ga0070711_100021039 3300005439 Bacteria 4214
88 Ga0070711_100096833 3300005439 Unclassified 2138
89 Ga0070705_100177968 3300005440 Bacteria 1438
90 Ga0070708_100006184 3300005445 Bacteria 9519
91 Ga0070708_100007869 3300005445 Bacteria 8533
92 Ga0070708_100027791 3300005445 Bacteria 4859
93 Ga0070708_100037859 3300005445 Bacteria 4211
94 Ga0070708_100103094 3300005445 Unclassified 2615
95 Ga0070663_100127545 3300005455 Unclassified 1929
96 Ga0070678_100021993 3300005456 Unclassified 4216
97 Ga0070662_100001546 3300005457 Bacteria 14200
98 Ga0070662_100111252 3300005457 Bacteria 2086
99 Ga0068867_100014351 3300005459 Bacteria 5612
100 Ga0068867_100017032 3300005459 Bacteria 5164
101 Ga0070706_100000035 3300005467 Bacteria 152107
102 Ga0070706_100000486 3300005467 Bacteria 46746
103 Ga0070706_100004144 3300005467 Bacteria 14098
104 Ga0070706_100007350 3300005467 Bacteria 10334
105 Ga0070706_100012394 3300005467 Bacteria 7899
106 Ga0070706_100034492 3300005467 Bacteria 4675
107 Ga0070706_100043120 3300005467 Unclassified 4167
108 Ga0070706_100054686 3300005467 Unclassified 3685
109 Ga0070706_100062373 3300005467 Unclassified 3444
110 Ga0070706_100133824 3300005467 Bacteria 2314
111 Ga0070707_100002759 3300005468 Bacteria 16720
112 Ga0070707_100003628 3300005468 Bacteria 14556
113 Ga0070707_100006248 3300005468 Bacteria 11089
114 Ga0070707_100016787 3300005468 Bacteria 6874
115 Ga0070707_100019144 3300005468 Bacteria 6448
116 Ga0070707_100019676 3300005468 Bacteria 6363
117 Ga0070707_100024804 3300005468 Bacteria 5685
118 Ga0070707_100050550 3300005468 Unclassified 3984
119 Ga0070707_100124419 3300005468 Bacteria 2505
120 Ga0070707_100195549 3300005468 Bacteria 1972
121 Ga0070707_100198951 3300005468 Unclassified 1953
122 Ga0070707_100336828 3300005468 Bacteria 1466
123 Ga0070698_100001022 3300005471 Bacteria 30790
124 Ga0070698_100007308 3300005471 Bacteria 11959
125 Ga0070698_100030752 3300005471 Bacteria 5566
126 Ga0070698_100078171 3300005471 Bacteria 3307
127 Ga0070698_100137344 3300005471 Unclassified 2398
128 Ga0070698_100229979 3300005471 Unclassified 1787
129 Ga0070699_100026680 3300005518 Bacteria 4983
130 Ga0070699_100034536 3300005518 Unclassified 4372
131 Ga0070699_100036597 3300005518 Bacteria 4246
132 Ga0070699_100102649 3300005518 Bacteria 2507
133 Ga0070699_100147992 3300005518 Unclassified 2076
134 Ga0070679_100009498 3300005530 Bacteria 9200
135 Ga0070684_100002121 3300005535 Bacteria 14623
136 Ga0070684_100035138 3300005535 Bacteria 4288
137 Ga0070697_100002860 3300005536 Bacteria 13274
138 Ga0070697_100009360 3300005536 Bacteria 7654
139 Ga0070697_100009440 3300005536 Bacteria 7622
140 Ga0070697_100016323 3300005536 Bacteria 5840
141 Ga0070697_100016730 3300005536 Bacteria 5768
142 Ga0070697_100018400 3300005536 Bacteria 5507
143 Ga0070697_100025098 3300005536 Bacteria 4751
144 Ga0070697_100028468 3300005536 Unclassified 4474
145 Ga0070697_100038473 3300005536 Bacteria 3865
146 Ga0070697_100051429 3300005536 Bacteria 3347
147 Ga0070697_100080793 3300005536 Unclassified 2678
148 Ga0070697_100167491 3300005536 Bacteria 1858
149 Ga0070697_100183829 3300005536 Unclassified 1772
150 Ga0070672_100002395 3300005543 Bacteria 11865
151 Ga0070686_100098023 3300005544 Bacteria 1975
152 Ga0070695_100022544 3300005545 Bacteria 3864
153 Ga0070696_100023039 3300005546 Bacteria 4234
154 Ga0070696_100052857 3300005546 Bacteria 2827
155 Ga0070665_100020748 3300005548 Bacteria 6603
156 Ga0070665_100085850 3300005548 Bacteria 3153
157 Ga0070664_100001903 3300005564 Bacteria 16762
158 Ga0068856_100132863 3300005614 Bacteria 2494
159 Ga0070702_100132513 3300005615 Bacteria 1576
160 Ga0068866_10051553 3300005718 Unclassified 2095
161 Ga0068863_100097829 3300005841 Bacteria 2787
162 Ga0068858_100131824 3300005842 Bacteria 2344
163 Ga0068860_100000351 3300005843 Bacteria 61888
164 Ga0068860_100002246 3300005843 Bacteria 20333
165 Ga0068860_100084397 3300005843 Bacteria 3022
166 Ga0068860_100166157 3300005843 Bacteria 2130
167 Ga0068860_100237396 3300005843 Unclassified 1773
168 Ga0068862_100022899 3300005844 Bacteria 5230
169 Ga0081455_10000281 3300005937 Bacteria 67337
170 Ga0081455_10001450 3300005937 Bacteria 29329
171 Ga0081455_10003189 3300005937 Bacteria 19030
172 Ga0081455_10007917 3300005937 Bacteria 11122
173 Ga0081455_10008185 3300005937 Bacteria 10907
174 Ga0081455_10136783 3300005937 Bacteria 1908
175 Ga0081455_10159780 3300005937 Bacteria 1729
176 Ga0081538_10099683 3300005981 Unclassified 1467
177 Ga0081540_1000010 3300005983 Bacteria 193206
178 Ga0081539_10000287 3300005985 Bacteria 113988
179 Ga0081539_10001887 3300005985 Bacteria 32585
180 Ga0081539_10024554 3300005985 Unclassified 3906
181 Ga0081539_10024977 3300005985 Unclassified 3861
182 Ga0070717_10000583 3300006028 Bacteria 23277
183 Ga0070717_10001122 3300006028 Bacteria 18094
184 Ga0070717_10020588 3300006028 Bacteria 5191
185 Ga0070717_10020606 3300006028 Bacteria 5189
186 Ga0070717_10057408 3300006028 Bacteria 3218
187 Ga0070717_10099947 3300006028 Unclassified 2462
188 Ga0070717_10106928 3300006028 Unclassified 2382
189 Ga0070717_10353644 3300006028 Unclassified 1314
190 Ga0070715_10015298 3300006163 Bacteria 2858
191 Ga0070716_100134654 3300006173 Unclassified 1567
192 Ga0070712_100032681 3300006175 Bacteria 3515
193 Ga0070712_100035468 3300006175 Bacteria 3386
194 Ga0070712_100049773 3300006175 Bacteria 2911
195 Ga0075362_10003207 3300006177 Bacteria 5669
196 Ga0097621_100060498 3300006237 Unclassified 3105
197 Ga0097621_100062387 3300006237 Bacteria 3060
198 Ga0075370_10106179 3300006353 Unclassified 1628
199 Ga0068871_100048797 3300006358 Bacteria 3419
200 Ga0075434_100125916 3300006871 Bacteria 2579
201 Ga0068865_100024311 3300006881 Bacteria 3974
202 Ga0068865_100030046 3300006881 Bacteria 3611
203 Ga0075435_100006002 3300007076 Bacteria 8551
204 Ga0099795_10003086 3300007788 Bacteria 4068
205 Ga0105251_10069892 3300009011 Unclassified 1636
206 Ga0105240_10292792 3300009093 Bacteria 1865
207 Ga0111539_10136849 3300009094 Bacteria 2868
208 Ga0105245_10333905 3300009098 Bacteria 1497
209 Ga0105245_10393433 3300009098 Unclassified 1383
210 Ga0114129_10003628 3300009147 Bacteria 21715
211 Ga0114129_10567775 3300009147 Unclassified 1473
212 Ga0105243_10000023 3300009148 Bacteria 202230
213 Ga0105243_10004884 3300009148 Bacteria 10520
214 Ga0105242_10010158 3300009176 Bacteria 7211
215 Ga0105242_10068736 3300009176 Bacteria 2931
216 Ga0105249_10000764 3300009553 Bacteria 28918
217 Ga0105239_10006314 3300010375 Bacteria 13788
218 Ga0105239_10210206 3300010375 Bacteria 2181
219 Ga0105239_10349952 3300010375 Bacteria 1668
220 Ga0157371_10042357 3300013102 Bacteria 3245
221 Ga0157371_10200687 3300013102 Unclassified 1430
222 Ga0157370_10000927 3300013104 Bacteria 37224
223 Ga0157374_10000043 3300013296 Bacteria 145109
224 Ga0157374_10004212 3300013296 Bacteria 12088
225 Ga0157374_10005749 3300013296 Bacteria 10464
226 Ga0157374_10009134 3300013296 Bacteria 8496
227 Ga0157374_10021742 3300013296 Bacteria 5713
228 Ga0157374_10123413 3300013296 Bacteria 2502
229 Ga0157378_10005114 3300013297 Bacteria 11516
230 Ga0157378_10118583 3300013297 Bacteria 2436
231 Ga0157378_10121031 3300013297 Bacteria 2413
232 Ga0157378_10195827 3300013297 Bacteria 1909
233 Ga0163162_10012489 3300013306 Bacteria 8298
234 Ga0163162_10041423 3300013306 Bacteria 4608
235 Ga0163162_10099157 3300013306 Unclassified 3004
236 Ga0163162_10196857 3300013306 Unclassified 2144
237 Ga0163162_10201524 3300013306 Unclassified 2119
238 Ga0157372_10009787 3300013307 Bacteria 10194
239 Ga0157372_10128170 3300013307 Unclassified 2918
240 Ga0157372_10202950 3300013307 Bacteria 2297
241 Ga0157372_10283239 3300013307 Bacteria 1927
242 Ga0157375_10001013 3300013308 Bacteria 24313
243 Ga0157375_10001269 3300013308 Bacteria 21823
244 Ga0157375_10041744 3300013308 Bacteria 4432
245 Ga0157375_10116912 3300013308 Unclassified 2772
246 Ga0163163_10056947 3300014325 Bacteria 3864
247 Ga0182008_10016825 3300014497 Unclassified 3795
248 Ga0157377_10243481 3300014745 Bacteria 1162
249 Ga0157376_10003156 3300014969 Bacteria 11322
250 Ga0157376_10004738 3300014969 Bacteria 9472
251 Ga0157376_10021348 3300014969 Bacteria 5028
252 Ga0157376_10068616 3300014969 Bacteria 3003
253 Ga0157376_10180530 3300014969 Bacteria 1929
254 Ga0157376_10213145 3300014969 Unclassified 1784
255 Ga0182005_1009845 3300015265 Unclassified 2764
256 Ga0213873_10007670 3300021358 Unclassified 2171
257 Ga0213872_10000801 3300021361 Bacteria 22875
258 Ga0213872_10003229 3300021361 Bacteria 9107
259 Ga0213872_10005476 3300021361 Bacteria 6525
260 Ga0213874_10007402 3300021377 Unclassified 2634
261 Ga0213874_10024455 3300021377 Unclassified 1694
262 Ga0213876_10002610 3300021384 Bacteria 10534
263 Ga0213876_10016127 3300021384 Bacteria 3950
264 Ga0213876_10036016 3300021384 Unclassified 2610
265 Ga0213871_10011892 3300021441 Bacteria 2007
266 Ga0207666_1001060 3300025271 Bacteria 3252
267 Ga0207673_1005074 3300025290 Bacteria 1597
268 Ga0207697_10000343 3300025315 Bacteria 25933
269 Ga0207697_10000521 3300025315 Bacteria 21689
270 Ga0207697_10001466 3300025315 Bacteria 12889
271 Ga0207697_10002713 3300025315 Bacteria 9041
272 Ga0207697_10005749 3300025315 Bacteria 5716
273 Ga0207697_10011829 3300025315 Unclassified 3681
274 Ga0207642_10038650 3300025899 Bacteria 2067
275 Ga0207688_10012739 3300025901 Bacteria 4573
276 Ga0207688_10026443 3300025901 Bacteria 3190
277 Ga0207680_10003052 3300025903 Bacteria 7856
278 Ga0207680_10009262 3300025903 Bacteria 4876
279 Ga0207680_10027308 3300025903 Bacteria 3177
280 Ga0207680_10034913 3300025903 Bacteria 2881
281 Ga0207680_10056971 3300025903 Bacteria 2363
282 Ga0207699_10024060 3300025906 Unclassified 3325
283 Ga0207699_10037495 3300025906 Unclassified 2771
284 Ga0207645_10000461 3300025907 Bacteria 33685
285 Ga0207645_10002354 3300025907 Bacteria 14910
286 Ga0207645_10003893 3300025907 Bacteria 11158
287 Ga0207645_10028801 3300025907 Unclassified 3583
288 Ga0207684_10000043 3300025910 Bacteria 259939
289 Ga0207684_10000705 3300025910 Bacteria 39440
290 Ga0207684_10003481 3300025910 Bacteria 15355
291 Ga0207684_10006883 3300025910 Bacteria 10288
292 Ga0207684_10035971 3300025910 Bacteria 4203
293 Ga0207684_10082941 3300025910 Unclassified 2730
294 Ga0207684_10084309 3300025910 Bacteria 2706
295 Ga0207684_10110382 3300025910 Bacteria 2354
296 Ga0207684_10193265 3300025910 Unclassified 1755
297 Ga0207693_10007547 3300025915 Bacteria 8936
298 Ga0207693_10012727 3300025915 Bacteria 6792
299 Ga0207693_10018504 3300025915 Bacteria 5547
300 Ga0207693_10023323 3300025915 Bacteria 4913
301 Ga0207693_10028526 3300025915 Bacteria 4410
302 Ga0207693_10076892 3300025915 Unclassified 2614
303 Ga0207663_10004361 3300025916 Bacteria 7025
304 Ga0207663_10008350 3300025916 Bacteria 5409
305 Ga0207663_10018672 3300025916 Bacteria 3892
306 Ga0207663_10020288 3300025916 Bacteria 3761
307 Ga0207663_10037108 3300025916 Bacteria 2936
308 Ga0207660_10073919 3300025917 Bacteria 2486
309 Ga0207662_10000373 3300025918 Bacteria 20188
310 Ga0207662_10011981 3300025918 Bacteria 4823
311 Ga0207649_10022095 3300025920 Bacteria 3673
312 Ga0207649_10031076 3300025920 Bacteria 3170
313 Ga0207646_10000925 3300025922 Bacteria 37781
314 Ga0207646_10004732 3300025922 Bacteria 14658
315 Ga0207646_10028635 3300025922 Bacteria 5068
316 Ga0207646_10038463 3300025922 Unclassified 4309
317 Ga0207646_10039112 3300025922 Unclassified 4268
318 Ga0207646_10044331 3300025922 Bacteria 3992
319 Ga0207646_10048459 3300025922 Bacteria 3809
320 Ga0207646_10050386 3300025922 Bacteria 3727
321 Ga0207646_10083637 3300025922 Bacteria 2855
322 Ga0207646_10134126 3300025922 Unclassified 2229
323 Ga0207681_10002301 3300025923 Bacteria 12150
324 Ga0207681_10015552 3300025923 Bacteria 4747
325 Ga0207681_10031856 3300025923 Bacteria 3447
326 Ga0207681_10151597 3300025923 Bacteria 1738
327 Ga0207650_10172596 3300025925 Unclassified 1719
328 Ga0207659_10054090 3300025926 Bacteria 2866
329 Ga0207659_10099876 3300025926 Bacteria 2186
330 Ga0207659_10118657 3300025926 Bacteria 2024
331 Ga0207687_10245664 3300025927 Unclassified 1420
332 Ga0207700_10004333 3300025928 Bacteria 8347
333 Ga0207700_10022286 3300025928 Bacteria 4344
334 Ga0207700_10091536 3300025928 Bacteria 2402
335 Ga0207700_10144073 3300025928 Bacteria 1961
336 Ga0207664_10201449 3300025929 Bacteria 1718
337 Ga0207644_10023960 3300025931 Bacteria 4186
338 Ga0207644_10036526 3300025931 Bacteria 3450
339 Ga0207690_10028890 3300025932 Bacteria 3519
340 Ga0207690_10033971 3300025932 Bacteria 3283
341 Ga0207706_10000900 3300025933 Bacteria 30537
342 Ga0207706_10018260 3300025933 Bacteria 6311
343 Ga0207706_10108232 3300025933 Unclassified 2446
344 Ga0207706_10128544 3300025933 Bacteria 2228
345 Ga0207686_10012596 3300025934 Unclassified 4653
346 Ga0207686_10038103 3300025934 Bacteria 2906
347 Ga0207709_10000197 3300025935 Bacteria 80360
348 Ga0207709_10011984 3300025935 Bacteria 4780
349 Ga0207670_10004077 3300025936 Bacteria 7824
350 Ga0207669_10067798 3300025937 Unclassified 2225
351 Ga0207665_10002968 3300025939 Bacteria 11370
352 Ga0207665_10013362 3300025939 Bacteria 5397
353 Ga0207665_10027910 3300025939 Unclassified 3728
354 Ga0207665_10216471 3300025939 Unclassified 1402
355 Ga0207691_10003325 3300025940 Bacteria 15650
356 Ga0207691_10003695 3300025940 Bacteria 14840
357 Ga0207691_10012927 3300025940 Bacteria 7994
358 Ga0207661_10022024 3300025944 Bacteria 4789
359 Ga0207661_10057087 3300025944 Bacteria 3137
360 Ga0207661_10299026 3300025944 Bacteria 1443
361 Ga0207679_10000844 3300025945 Bacteria 19691
362 Ga0207679_10089462 3300025945 Bacteria 2377
363 Ga0207651_10082775 3300025960 Bacteria 2318
364 Ga0207712_10024958 3300025961 Bacteria 3967
365 Ga0207668_10002460 3300025972 Bacteria 10815
366 Ga0207658_10003126 3300025986 Bacteria 11848
367 Ga0207677_10031741 3300026023 Unclassified 3386
368 Ga0207677_10042307 3300026023 Unclassified 3020
369 Ga0207677_10150035 3300026023 Unclassified 1797
370 Ga0207677_10181696 3300026023 Bacteria 1655
371 Ga0207677_10184405 3300026023 Bacteria 1644
372 Ga0207678_10005584 3300026067 Bacteria 11246
373 Ga0207702_10065986 3300026078 Unclassified 3101
374 Ga0207641_10031454 3300026088 Bacteria 4402
375 Ga0207648_10000325 3300026089 Bacteria 52254
376 Ga0207648_10104273 3300026089 Bacteria 2487
377 Ga0207674_10152182 3300026116 Unclassified 2270
378 Ga0207683_10003212 3300026121 Bacteria 14262
379 Ga0207683_10005042 3300026121 Bacteria 11337
380 Ga0207683_10037689 3300026121 Bacteria 4211
381 Ga0207683_10128152 3300026121 Unclassified 2282
382 Ga0209974_10039094 3300027876 Bacteria 1578
383 Ga0268266_10038189 3300028379 Bacteria 4088
384 Ga0268266_10038232 3300028379 Bacteria 4086
385 Ga0268266_10040111 3300028379 Bacteria 3990
386 Ga0268266_10045614 3300028379 Bacteria 3750
387 Ga0268266_10135424 3300028379 Bacteria 2206
388 Ga0268264_10000749 3300028381 Bacteria 36626
389 Ga0268264_10005799 3300028381 Bacteria 10469
390 Ga0307408_100000780 3300031548 Bacteria 25626
391 Ga0307408_100027954 3300031548 Unclassified 3892
392 Ga0307406_10000010 3300031901 Bacteria 114357
393 Ga0307407_10000053 3300031903 Bacteria 50149
394 Ga0307412_10000025 3300031911 Bacteria 235413
395 Ga0307409_100004150 3300031995 Bacteria 8063
396 Ga0307416_100000455 3300032002 Bacteria 21016
397 Ga0307414_10000019 3300032004 Bacteria 235390
398 Ga0307414_10001810 3300032004 Bacteria 11053
399 Ga0307411_10053306 3300032005 Bacteria 2649
400 Ga0373934_0086066 3300035086 Unclassified 1265
401 Ga0373944_0027313 3300035089 Unclassified 1692
402 Ga0373943_0071991 3300035170 Unclassified 1752
403 Ga0373937_0158674 3300036401 Bacteria 2120
404 Ga0373925_0113811 3300037068 Unclassified 2093
405 Ga0373925_0410399 3300037068 Unclassified 1105
406 Ga0395900_0099983 3300037418 Unclassified 2979
407 Ga0395900_0402924 3300037418 Bacteria 1332
408 Ga0395898_0036474 3300037466 Bacteria 4882
409 Ga0395898_0230610 3300037466 Bacteria 1766
410 Ga0436364_0130713 3300037853 Bacteria 4737
411 Ga0436364_0946114 3300037853 Bacteria 5760
412 Ga0395901_0033272 3300038443 Bacteria 5321
413 Ga0395901_0165934 3300038443 Bacteria 2319
414 Ga0395901_0323730 3300038443 Bacteria 1594
415 Ga0436365_0709130 3300039437 Bacteria 46894
416 Ga0436365_1382701 3300039437 Bacteria 65037
417 Ga0436365_1574340 3300039437 Bacteria 3916
418 Ga0436360_1048387 3300039438 Bacteria 3212
419 Ga0436361_0145001 3300039447 Bacteria 5536
420 Ga0436361_0507036 3300039447 Bacteria 40349
421 Ga0436361_0944611 3300039447 Bacteria 7074
422 Ga0436361_1166033 3300039447 Bacteria 6200
423 Ga0436363_0183565 3300039450 Bacteria 15940
424 Ga0436363_0594532 3300039450 Bacteria 10991
425 Ga0436362_1205062 3300039453 Bacteria 1515
426 Ga0436362_1283982 3300039453 Bacteria 3879
427 Ga0450890_000060 3300042127 Bacteria 21287
428 Ga0450892_000128 3300042130 Bacteria 8714
429 Ga0450893_0000316 3300042532 Bacteria 6719
430 Ga0450893_0002828 3300042532 Bacteria 2722
431 Ga0453684_0000027 3300044712 Bacteria 778857
432 Ga0451576_0048117 3300045051 Bacteria 4481
433 Ga0451576_0069877 3300045051 Bacteria 3655
434 Ga0466967_0076355 3300045976 Bacteria 3014
435 Ga0495629_0168727 3300046459 Unclassified 1519
436 Ga0495628_0098009 3300046516 Bacteria 2264
437 Ga0495652_0112315 3300046529 Bacteria 2189
438 Ga0495645_0085994 3300046543 Unclassified 2250
439 Ga0495635_0061259 3300046663 Unclassified 2585
440 Ga0495659_0023299 3300046664 Unclassified 2103
441 Ga0495599_0007411 3300046678 Bacteria 6651
442 Ga0495669_0011205 3300046684 Bacteria 3803
443 Ga0495600_0113210 3300046809 Bacteria 1767
444 Ga0495581_0059033 3300047315 Bacteria 2216
445 Ga0495674_0119076 3300047319 Bacteria 2232
446 Ga0495675_0048916 3300047444 Bacteria 2689
447 Ga0495684_0013221 3300047471 Bacteria 6370
448 Ga0495602_0165808 3300048088 Unclassified 1719
449 Ga0496100_0004902 3300048903 Bacteria 7151
450 Ga0496100_0044947 3300048903 Bacteria 2832
451 Ga0496100_0097610 3300048903 Unclassified 2018
452 Ga0496101_0002416 3300048904 Bacteria 11474
453 Ga0496103_0004521 3300048906 Bacteria 8428
454 Ga0496104_0020475 3300048907 Bacteria 6064
455 Ga0496104_0109448 3300048907 Bacteria 2648
456 Ga0496105_0023648 3300048908 Bacteria 4986
457 Ga0496105_0037947 3300048908 Bacteria 3968
458 Ga0496106_0000636 3300048909 Bacteria 25176
459 Ga0496107_0005411 3300048910 Bacteria 8738
460 Ga0496107_0167341 3300048910 Bacteria 1630
461 Ga0496108_0104714 3300048911 Bacteria 2415
462 Ga0496109_0060794 3300048912 Bacteria 3453
463 Ga0496109_0173634 3300048912 Bacteria 2023
464 Ga0496109_0437410 3300048912 Bacteria 1236
465 Ga0496110_0109434 3300048913 Bacteria 2482
466 Ga0496110_0238650 3300048913 Bacteria 1654
467 Ga0496111_0085098 3300048914 Unclassified 2312
468 Ga0496112_0008265 3300048915 Bacteria 9313
469 Ga0496112_0021952 3300048915 Bacteria 6075
470 Ga0496112_0093164 3300048915 Unclassified 2983
471 Ga0496112_0119946 3300048915 Bacteria 2600
472 Ga0496112_0164046 3300048915 Bacteria 2188
473 Ga0496113_0082471 3300048916 Bacteria 2466
474 Ga0496113_0284783 3300048916 Bacteria 1322
475 Ga0496114_0049250 3300048917 Unclassified 3505
476 Ga0496114_0089863 3300048917 Bacteria 2607
477 Ga0496115_0001050 3300048918 Bacteria 20035
478 Ga0496115_0003638 3300048918 Bacteria 11094
479 Ga0496115_0004816 3300048918 Bacteria 9792
480 Ga0496115_0006255 3300048918 Bacteria 8711
481 Ga0496115_0015887 3300048918 Bacteria 5720
482 Ga0496115_0039393 3300048918 Bacteria 3753
483 Ga0501032_0010284 3300049569 Bacteria 6752
484 Ga0501039_0140096 3300049575 Bacteria 1900
485 Ga0501198_003552 3300049649 Bacteria 2134
486 Ga0501227_000116 3300049665 Bacteria 13831
487 Ga0501080_0025595 3300049742 Bacteria 5478
488 nmdc:mga03683_272_c1 3300050489 Bacteria 15745
489 nmdc:mga0k408_862_c1 3300050493 Bacteria 16710
490 nmdc:mga07m45_17509_c1 3300050496 Bacteria 3849
491 nmdc:mga05p37_85068_c1 3300050507 Bacteria 3897
492 nmdc:mga08y16_148736_c1 3300050511 Bacteria 2434
493 nmdc:mga0n895_126523_c1 3300050512 Bacteria 2579
494 nmdc:mga0n895_71183_c1 3300050512 Unclassified 3447
495 nmdc:mga0rr50_7125_c1 3300050513 Bacteria 6867
496 Ga0495601_0051621 3300053077 Bacteria 2595
497 Ga0495612_0057163 3300053078 Bacteria 1611
498 Ga0500555_000003 3300053103 Bacteria 392994
499 Ga0500555_000271 3300053103 Bacteria 22309
500 Ga0500556_0000010 3300053104 Bacteria 258288
501 Ga0500559_0001748 3300053136 Bacteria 11908
502 2718716489 2718217752 Bacteria 915884
503 Ga0495652_0046732
504 SwRhRL3b_contig_3893210
505 JGI24746J21847_1000652
506 JGI24744J21845_10001241
507 JGI24033J26618_1002161
508 JGI25406J46586_10000067
509 rootH1_10015672
510 rootH2_10095918
511 rootL2_10071120
512 rootH1_10128811
513 JGI25404J52841_10000824
514 Ga0065712_10000304
515 Ga0065712_10012542
516 Ga0065715_10000348
517 Ga0065715_10002584
518 Ga0065715_10010392
519 Ga0065707_10005531
520 Ga0065707_10113574
521 Ga0070658_10001562
522 Ga0070658_10025103
523 Ga0070658_10091873
524 Ga0070676_10001727
525 Ga0070676_10009338
526 Ga0070676_10050351
527 Ga0070683_100013179
528 Ga0070683_100017017
529 Ga0070683_100395065
530 Ga0070690_100001685
531 Ga0070690_100214896
532 Ga0070670_100003629
533 Ga0070670_100133944
534 Ga0070670_100205238
535 Ga0070677_10008437
536 Ga0070677_10023132
537 Ga0068869_100228962
538 Ga0070666_10011408
539 Ga0068868_100055107
540 Ga0068868_100064937
541 Ga0068868_100174934
542 Ga0068868_100225510
543 Ga0070660_100028388
544 Ga0070660_100090797
545 Ga0070660_100157688
546 Ga0070687_100015225
547 Ga0070687_100040511
548 Ga0070661_100002489
549 Ga0070668_100001884
550 Ga0070668_100002409
551 Ga0070668_100004232
552 Ga0070668_100034511
553 Ga0070669_100011410
554 Ga0070669_100027641
555 Ga0070669_100033986
556 Ga0070675_100002985
557 Ga0070675_100013840
558 Ga0070675_100025780
559 Ga0070675_100038443
560 Ga0070675_100085731
561 Ga0070671_100002062
562 Ga0070671_100014805
563 Ga0070671_100035097
564 Ga0070671_100045959
565 Ga0070671_100051119
566 Ga0070671_100208542
567 Ga0070674_100001869
568 Ga0070674_100003858
569 Ga0070673_100055528
570 Ga0070673_100095814
571 Ga0070688_100003765
572 Ga0070688_100020681
573 Ga0070688_100030267
574 Ga0070688_100137298
575 Ga0070659_100029206
576 Ga0070659_100097377
577 Ga0070667_100015887
578 Ga0070667_100016224
579 Ga0070667_100055815
580 Ga0070667_100063608
581 Ga0070667_100069509
582 Ga0070703_10011353
583 Ga0070709_10005780
584 Ga0070714_100092961
585 Ga0070713_100044726
586 Ga0070713_100160376
587 Ga0070711_100001122
588 Ga0070711_100011987
589 Ga0070711_100021039
590 Ga0070711_100096833
591 Ga0070705_100177968
592 Ga0070708_100006184
593 Ga0070708_100007869
594 Ga0070708_100027791
595 Ga0070708_100037859
596 Ga0070708_100103094
597 Ga0070663_100127545
598 Ga0070678_100021993
599 Ga0070662_100001546
600 Ga0070662_100111252
601 Ga0068867_100014351
602 Ga0068867_100017032
603 Ga0070706_100000035
604 Ga0070706_100000486
605 Ga0070706_100004144
606 Ga0070706_100007350
607 Ga0070706_100012394
608 Ga0070706_100034492
609 Ga0070706_100043120
610 Ga0070706_100054686
611 Ga0070706_100062373
612 Ga0070706_100133824
613 Ga0070707_100002759
614 Ga0070707_100003628
615 Ga0070707_100006248
616 Ga0070707_100016787
617 Ga0070707_100019144
618 Ga0070707_100019676
619 Ga0070707_100024804
620 Ga0070707_100050550
621 Ga0070707_100124419
622 Ga0070707_100195549
623 Ga0070707_100198951
624 Ga0070707_100336828
625 Ga0070698_100001022
626 Ga0070698_100007308
627 Ga0070698_100030752
628 Ga0070698_100078171
629 Ga0070698_100137344
630 Ga0070698_100229979
631 Ga0070699_100026680
632 Ga0070699_100034536
633 Ga0070699_100036597
634 Ga0070699_100102649
635 Ga0070699_100147992
636 Ga0070679_100009498
637 Ga0070684_100002121
638 Ga0070684_100035138
639 Ga0070697_100002860
640 Ga0070697_100009360
641 Ga0070697_100009440
642 Ga0070697_100016323
643 Ga0070697_100016730
644 Ga0070697_100018400
645 Ga0070697_100025098
646 Ga0070697_100028468
647 Ga0070697_100038473
648 Ga0070697_100051429
649 Ga0070697_100080793
650 Ga0070697_100167491
651 Ga0070697_100183829
652 Ga0070672_100002395
653 Ga0070686_100098023
654 Ga0070695_100022544
655 Ga0070696_100023039
656 Ga0070696_100052857
657 Ga0070665_100020748
658 Ga0070665_100085850
659 Ga0070664_100001903
660 Ga0068856_100132863
661 Ga0070702_100132513
662 Ga0068866_10051553
663 Ga0068863_100097829
664 Ga0068858_100131824
665 Ga0068860_100000351
666 Ga0068860_100002246
667 Ga0068860_100084397
668 Ga0068860_100166157
669 Ga0068860_100237396
670 Ga0068862_100022899
671 Ga0081455_10000281
672 Ga0081455_10001450
673 Ga0081455_10003189
674 Ga0081455_10007917
675 Ga0081455_10008185
676 Ga0081455_10136783
677 Ga0081455_10159780
678 Ga0081538_10099683
679 Ga0081540_1000010
680 Ga0081539_10000287
681 Ga0081539_10001887
682 Ga0081539_10024554
683 Ga0081539_10024977
684 Ga0070717_10000583
685 Ga0070717_10001122
686 Ga0070717_10020588
687 Ga0070717_10020606
688 Ga0070717_10057408
689 Ga0070717_10099947
690 Ga0070717_10106928
691 Ga0070717_10353644
692 Ga0070715_10015298
693 Ga0070716_100134654
694 Ga0070712_100032681
695 Ga0070712_100035468
696 Ga0070712_100049773
697 Ga0075362_10003207
698 Ga0097621_100060498
699 Ga0097621_100062387
700 Ga0075370_10106179
701 Ga0068871_100048797
702 Ga0075434_100125916
703 Ga0068865_100024311
704 Ga0068865_100030046
705 Ga0075435_100006002
706 Ga0099795_10003086
707 Ga0105251_10069892
708 Ga0105240_10292792
709 Ga0111539_10136849
710 Ga0105245_10333905
711 Ga0105245_10393433
712 Ga0114129_10003628
713 Ga0114129_10567775
714 Ga0105243_10000023
715 Ga0105243_10004884
716 Ga0105242_10010158
717 Ga0105242_10068736
718 Ga0105249_10000764
719 Ga0105239_10006314
720 Ga0105239_10210206
721 Ga0105239_10349952
722 Ga0157371_10042357
723 Ga0157371_10200687
724 Ga0157370_10000927
725 Ga0157374_10000043
726 Ga0157374_10004212
727 Ga0157374_10005749
728 Ga0157374_10009134
729 Ga0157374_10021742
730 Ga0157374_10123413
731 Ga0157378_10005114
732 Ga0157378_10118583
733 Ga0157378_10121031
734 Ga0157378_10195827
735 Ga0163162_10012489
736 Ga0163162_10041423
737 Ga0163162_10099157
738 Ga0163162_10196857
739 Ga0163162_10201524
740 Ga0157372_10009787
741 Ga0157372_10128170
742 Ga0157372_10202950
743 Ga0157372_10283239
744 Ga0157375_10001013
745 Ga0157375_10001269
746 Ga0157375_10041744
747 Ga0157375_10116912
748 Ga0163163_10056947
749 Ga0182008_10016825
750 Ga0157377_10243481
751 Ga0157376_10003156
752 Ga0157376_10004738
753 Ga0157376_10021348
754 Ga0157376_10068616
755 Ga0157376_10180530
756 Ga0157376_10213145
757 Ga0182005_1009845
758 Ga0213873_10007670
759 Ga0213872_10000801
760 Ga0213872_10003229
761 Ga0213872_10005476
762 Ga0213874_10007402
763 Ga0213874_10024455
764 Ga0213876_10002610
765 Ga0213876_10016127
766 Ga0213876_10036016
767 Ga0213871_10011892
768 Ga0207666_1001060
769 Ga0207673_1005074
770 Ga0207697_10000343
771 Ga0207697_10000521
772 Ga0207697_10001466
773 Ga0207697_10002713
774 Ga0207697_10005749
775 Ga0207697_10011829
776 Ga0207642_10038650
777 Ga0207688_10012739
778 Ga0207688_10026443
779 Ga0207680_10003052
780 Ga0207680_10009262
781 Ga0207680_10027308
782 Ga0207680_10034913
783 Ga0207680_10056971
784 Ga0207699_10024060
785 Ga0207699_10037495
786 Ga0207645_10000461
787 Ga0207645_10002354
788 Ga0207645_10003893
789 Ga0207645_10028801
790 Ga0207684_10000043
791 Ga0207684_10000705
792 Ga0207684_10003481
793 Ga0207684_10006883
794 Ga0207684_10035971
795 Ga0207684_10082941
796 Ga0207684_10084309
797 Ga0207684_10110382
798 Ga0207684_10193265
799 Ga0207693_10007547
800 Ga0207693_10012727
801 Ga0207693_10018504
802 Ga0207693_10023323
803 Ga0207693_10028526
804 Ga0207693_10076892
805 Ga0207663_10004361
806 Ga0207663_10008350
807 Ga0207663_10018672
808 Ga0207663_10020288
809 Ga0207663_10037108
810 Ga0207660_10073919
811 Ga0207662_10000373
812 Ga0207662_10011981
813 Ga0207649_10022095
814 Ga0207649_10031076
815 Ga0207646_10000925
816 Ga0207646_10004732
817 Ga0207646_10028635
818 Ga0207646_10038463
819 Ga0207646_10039112
820 Ga0207646_10044331
821 Ga0207646_10048459
822 Ga0207646_10050386
823 Ga0207646_10083637
824 Ga0207646_10134126
825 Ga0207681_10002301
826 Ga0207681_10015552
827 Ga0207681_10031856
828 Ga0207681_10151597
829 Ga0207650_10172596
830 Ga0207659_10054090
831 Ga0207659_10099876
832 Ga0207659_10118657
833 Ga0207687_10245664
834 Ga0207700_10004333
835 Ga0207700_10022286
836 Ga0207700_10091536
837 Ga0207700_10144073
838 Ga0207664_10201449
839 Ga0207644_10023960
840 Ga0207644_10036526
841 Ga0207690_10028890
842 Ga0207690_10033971
843 Ga0207706_10000900
844 Ga0207706_10018260
845 Ga0207706_10108232
846 Ga0207706_10128544
847 Ga0207686_10012596
848 Ga0207686_10038103
849 Ga0207709_10000197
850 Ga0207709_10011984
851 Ga0207670_10004077
852 Ga0207669_10067798
853 Ga0207665_10002968
854 Ga0207665_10013362
855 Ga0207665_10027910
856 Ga0207665_10216471
857 Ga0207691_10003325
858 Ga0207691_10003695
859 Ga0207691_10012927
860 Ga0207661_10022024
861 Ga0207661_10057087
862 Ga0207661_10299026
863 Ga0207679_10000844
864 Ga0207679_10089462
865 Ga0207651_10082775
866 Ga0207712_10024958
867 Ga0207668_10002460
868 Ga0207658_10003126
869 Ga0207677_10031741
870 Ga0207677_10042307
871 Ga0207677_10150035
872 Ga0207677_10181696
873 Ga0207677_10184405
874 Ga0207678_10005584
875 Ga0207702_10065986
876 Ga0207641_10031454
877 Ga0207648_10000325
878 Ga0207648_10104273
879 Ga0207674_10152182
880 Ga0207683_10003212
881 Ga0207683_10005042
882 Ga0207683_10037689
883 Ga0207683_10128152
884 Ga0209974_10039094
885 Ga0268266_10038189
886 Ga0268266_10038232
887 Ga0268266_10040111
888 Ga0268266_10045614
889 Ga0268266_10135424
890 Ga0268264_10000749
891 Ga0268264_10005799
892 Ga0307408_100000780
893 Ga0307408_100027954
894 Ga0307406_10000010
895 Ga0307407_10000053
896 Ga0307412_10000025
897 Ga0307409_100004150
898 Ga0307416_100000455
899 Ga0307414_10000019
900 Ga0307414_10001810
901 Ga0307411_10053306
902 Ga0373934_0086066
903 Ga0373944_0027313
904 Ga0373943_0071991
905 Ga0373937_0158674
906 Ga0373925_0113811
907 Ga0373925_0410399
908 Ga0395900_0099983
909 Ga0395900_0402924
910 Ga0395898_0036474
911 Ga0395898_0230610
912 Ga0436364_0130713
913 Ga0436364_0946114
914 Ga0395901_0033272
915 Ga0395901_0165934
916 Ga0395901_0323730
917 Ga0436365_0709130
918 Ga0436365_1382701
919 Ga0436365_1574340
920 Ga0436360_1048387
921 Ga0436361_0145001
922 Ga0436361_0507036
923 Ga0436361_0944611
924 Ga0436361_1166033
925 Ga0436363_0183565
926 Ga0436363_0594532
927 Ga0436362_1205062
928 Ga0436362_1283982
929 Ga0450890_000060
930 Ga0450892_000128
931 Ga0450893_0000316
932 Ga0450893_0002828
933 Ga0453684_0000027
934 Ga0451576_0048117
935 Ga0451576_0069877
936 Ga0466967_0076355
937 Ga0495629_0168727
938 Ga0495628_0098009
939 Ga0495652_0112315
940 Ga0495645_0085994
941 Ga0495635_0061259
942 Ga0495659_0023299
943 Ga0495599_0007411
944 Ga0495669_0011205
945 Ga0495600_0113210
946 Ga0495581_0059033
947 Ga0495674_0119076
948 Ga0495675_0048916
949 Ga0495684_0013221
950 Ga0495602_0165808
951 Ga0496100_0004902
952 Ga0496100_0044947
953 Ga0496100_0097610
954 Ga0496101_0002416
955 Ga0496103_0004521
956 Ga0496104_0020475
957 Ga0496104_0109448
958 Ga0496105_0023648
959 Ga0496105_0037947
960 Ga0496106_0000636
961 Ga0496107_0005411
962 Ga0496107_0167341
963 Ga0496108_0104714
964 Ga0496109_0060794
965 Ga0496109_0173634
966 Ga0496109_0437410
967 Ga0496110_0109434
968 Ga0496110_0238650
969 Ga0496111_0085098
970 Ga0496112_0008265
971 Ga0496112_0021952
972 Ga0496112_0093164
973 Ga0496112_0119946
974 Ga0496112_0164046
975 Ga0496113_0082471
976 Ga0496113_0284783
977 Ga0496114_0049250
978 Ga0496114_0089863
979 Ga0496115_0001050
980 Ga0496115_0003638
981 Ga0496115_0004816
982 Ga0496115_0006255
983 Ga0496115_0015887
984 Ga0496115_0039393
985 Ga0501032_0010284
986 Ga0501039_0140096
987 Ga0501198_003552
988 Ga0501227_000116
989 Ga0501080_0025595
990 nmdc:mga03683_272_c1
991 nmdc:mga0k408_862_c1
992 nmdc:mga07m45_17509_c1
993 nmdc:mga05p37_85068_c1
994 nmdc:mga08y16_148736_c1
995 nmdc:mga0n895_126523_c1
996 nmdc:mga0n895_71183_c1
997 nmdc:mga0rr50_7125_c1
998 Ga0495601_0051621
999 Ga0495612_0057163
1000 Ga0500555_000003
1001 Ga0500555_000271
1002 Ga0500556_0000010
1003 Ga0500559_0001748
1004 2718716489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

50

405

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8298 28 384
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.825 28 384
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.6843 282 342
2ch2-assembly2.cif.gz_C structure of the anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor 0.6811 276 342
8or9-assembly1.cif.gz_A-2 human holo aromatic l-amino acid decarboxylase (aadc) native structure at physiological ph 0.6688 284 342
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8885 30 382 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8778 30 382 3.40.50.300
af_A0A0P0X1P5_1_135_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8608 142 257 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7895 30 384 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7691 30 384 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V2RSI4-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.955 1 390 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A496SS50-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9485 9 381 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2V2RSI4-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9479 1 390 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A7X8XCN9-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9453 1 383 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A1Q6ULC9-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9452 12 393 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245

Map