F455935

General Info

Members Datasets Scaffolds Average Seq Length
502 331 1004 295

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_108143|Ga0500652_108143_80_1114
Length 344
Sequence VWLPKGKVRSNVLKKLCQISLLKGGLRPNFVAYLNLPQIVIKTEQIMRVFVTGATGFIGSAIVQELLGAGHQVLGLARSDEGAKALAARGAAVHRGDLTDLESLRRGAAMSDGVIHTAFNHDFSKFKESCEADRHVIEALGGALAGSDRPLIITSGIGVLAPGGLAVEENEPNAGSNAIPRVATEEAAAAVAASGVHVSVVRLPPSVHGDGDHGFVPMVIGISREKGVSAYVGEGLNRWPAVHRLDAANLYRLVLEKGAAGARYHGVAEEGVPFRDIATVIGRRLNVPVVAKAPEEAAGHFGWLAHFAGRDVPASSQRTREQLGWQPKQSGLIADIDHECYFQS

Samples

Sample ID Description Type Environment
1 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
86 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
104 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
105 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
284 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
288 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
291 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
292 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
296 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
297 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
298 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
299 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
300 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
301 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
302 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
303 2738541293 Rhizobium sp. GV031 Isolate Unclassified
304 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
305 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
306 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
307 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
308 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
309 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
310 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
311 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
312 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
313 2891562705 Microbispora tritici MT50 Isolate Unclassified
314 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
315 2904424332 Duganella sp. 1411 Isolate Rhizosphere
316 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
317 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
318 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
319 2928070936 Variovorax gossypii 1167 Isolate Unclassified
320 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
321 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
322 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
323 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
324 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
325 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
326 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
327 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
328 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
329 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
330 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
331 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 0.6
Isolates 7.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 13.55
Nodule 1.99
Rhizoplane 2.79
Rhizosphere 63.55
Stem 0
Stem Tuber 0
Unclassified 4.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500652_108143 3300053131 Unclassified 1162
2 JGI24740J21852_10000667 3300001979 Bacteria 14865
3 JGI24735J21928_10001891 3300002067 Bacteria 7350
4 JGI25155J39150_1000175 3300002704 Bacteria 28065
5 JGI25156J39149_1000379 3300002705 Bacteria 28192
6 JGI25154J39366_1000014 3300002738 Bacteria 265287
7 JGI25154J39366_1000312 3300002738 Bacteria 28149
8 JGI25157J39369_1000421 3300002741 Bacteria 28192
9 JGI25150J39212_1000504 3300002774 Bacteria 16160
10 JGI25151J46595_10000081 3300003187 Bacteria 131317
11 JGI25153J46596_10000117 3300003215 Bacteria 89953
12 JGI25153J46596_10010217 3300003215 Bacteria 4267
13 rootH1_10039163 3300003316 Bacteria 15334
14 rootH1_10118901 3300003316 Unclassified 2309
15 rootH1_10169498 3300003316 Unclassified 3886
16 rootH2_10183889 3300003320 Bacteria 3065
17 rootH2_10250409 3300003320 Bacteria 1222
18 rootL2_10061303 3300003322 Bacteria 4211
19 rootL2_10156153 3300003322 Bacteria 3318
20 rootL2_10181767 3300003322 Bacteria 1664
21 rootH1_10176393 3300003323 Unclassified 1607
22 rootH1_10193019 3300003323 Bacteria 1597
23 rootH1_10385647 3300003323 Unclassified 1349
24 Ga0055533_1000925 3300003756 Bacteria 8762
25 Ga0055542_1000674 3300003762 Bacteria 27585
26 Ga0055536_1002997 3300003781 Bacteria 9246
27 Ga0055540_1004264 3300003792 Bacteria 6544
28 Ga0055531_10000030 3300003794 Bacteria 157459
29 Ga0055531_10038177 3300003794 Bacteria 1446
30 Ga0055541_1002029 3300003841 Bacteria 4140
31 Ga0065165_1000636 3300005262 Bacteria 50815
32 Ga0065165_1000907 3300005262 Bacteria 38180
33 Ga0065165_1050049 3300005262 Bacteria 1191
34 Ga0070676_10006900 3300005328 Bacteria 6079
35 Ga0070683_100079799 3300005329 Bacteria 3063
36 Ga0070690_100032956 3300005330 Bacteria 3239
37 Ga0070690_100373390 3300005330 Unclassified 1041
38 Ga0068869_100019413 3300005334 Bacteria 4644
39 Ga0070666_10004542 3300005335 Bacteria 8456
40 Ga0070666_10378560 3300005335 Unclassified 1016
41 Ga0068868_100004001 3300005338 Bacteria 10289
42 Ga0070692_10056728 3300005345 Bacteria 2052
43 Ga0070668_100022968 3300005347 Bacteria 4716
44 Ga0070669_100106360 3300005353 Bacteria 2124
45 Ga0070675_100061455 3300005354 Unclassified 3102
46 Ga0070671_100006589 3300005355 Bacteria 9282
47 Ga0070667_100012524 3300005367 Bacteria 7015
48 Ga0070709_10035927 3300005434 Bacteria 3014
49 Ga0070709_10295045 3300005434 Bacteria 1182
50 Ga0070714_100069362 3300005435 Bacteria 3044
51 Ga0070714_100206877 3300005435 Bacteria 1797
52 Ga0070714_100265632 3300005435 Bacteria 1590
53 Ga0070711_100370949 3300005439 Bacteria 1155
54 Ga0070708_100000590 3300005445 Bacteria 27234
55 Ga0070663_100038554 3300005455 Bacteria 3334
56 Ga0070678_100083989 3300005456 Unclassified 2422
57 Ga0070662_100005630 3300005457 Bacteria 8010
58 Ga0070681_10126869 3300005458 Bacteria 2484
59 Ga0068867_100020762 3300005459 Bacteria 4682
60 Ga0070698_100201667 3300005471 Bacteria 1925
61 Ga0070699_100105417 3300005518 Bacteria 2473
62 Ga0070684_100061753 3300005535 Bacteria 3280
63 Ga0070697_100015509 3300005536 Bacteria 5982
64 Ga0070697_100037614 3300005536 Bacteria 3909
65 Ga0070697_100039730 3300005536 Bacteria 3805
66 Ga0070697_100095081 3300005536 Bacteria 2470
67 Ga0070697_100158205 3300005536 Bacteria 1913
68 Ga0070697_100296524 3300005536 Bacteria 1389
69 Ga0070695_100323207 3300005545 Bacteria 1148
70 Ga0070665_100016899 3300005548 Bacteria 7316
71 Ga0070665_100108176 3300005548 Bacteria 2783
72 Ga0070665_100146478 3300005548 Bacteria 2364
73 Ga0070704_100333625 3300005549 Bacteria 1275
74 Ga0068854_100323676 3300005578 Bacteria 1254
75 Ga0068856_100099785 3300005614 Bacteria 2895
76 Ga0068856_100192685 3300005614 Bacteria 2052
77 Ga0068852_100074445 3300005616 Bacteria 2991
78 Ga0068852_100358311 3300005616 Bacteria 1426
79 Ga0068859_100088653 3300005617 Bacteria 3143
80 Ga0068863_100085213 3300005841 Bacteria 2995
81 Ga0068863_100173289 3300005841 Bacteria 2070
82 Ga0068858_100022548 3300005842 Bacteria 5874
83 Ga0068860_100019276 3300005843 Bacteria 6622
84 Ga0068860_100437607 3300005843 Bacteria 1298
85 Ga0068862_100304011 3300005844 Bacteria 1468
86 Ga0081455_10156003 3300005937 Bacteria 1755
87 Ga0081539_10010606 3300005985 Bacteria 7443
88 Ga0081539_10142109 3300005985 Bacteria 1165
89 Ga0075365_10004901 3300006038 Bacteria 7154
90 Ga0075365_10105146 3300006038 Bacteria 1936
91 Ga0075432_10030072 3300006058 Bacteria 1877
92 Ga0070715_10018843 3300006163 Bacteria 2637
93 Ga0070715_10126279 3300006163 Bacteria 1225
94 Ga0070716_100267128 3300006173 Bacteria 1173
95 Ga0070712_100402671 3300006175 Bacteria 1131
96 Ga0097621_100059554 3300006237 Bacteria 3127
97 Ga0068871_100030448 3300006358 Bacteria 4250
98 Ga0075428_100019867 3300006844 Bacteria 7437
99 Ga0075430_100162762 3300006846 Bacteria 1857
100 Ga0075431_100209930 3300006847 Bacteria 1989
101 Ga0075434_100024483 3300006871 Archaea 5901
102 Ga0075429_100035009 3300006880 Bacteria 4364
103 Ga0068865_100030435 3300006881 Bacteria 3591
104 Ga0075436_100009927 3300006914 Bacteria 6510
105 Ga0097620_100088655 3300006931 Bacteria 3143
106 Ga0075435_100004917 3300007076 Bacteria 9266
107 Ga0075435_100034821 3300007076 Archaea 3992
108 Ga0099794_10052902 3300007265 Bacteria 1958
109 Ga0099794_10088948 3300007265 Bacteria 1531
110 Ga0099794_10136817 3300007265 Bacteria 1239
111 Ga0099795_10021718 3300007788 Bacteria 2109
112 Ga0105240_10548733 3300009093 Bacteria 1279
113 Ga0105247_10137608 3300009101 Bacteria 1597
114 Ga0114129_10466847 3300009147 Unclassified 1653
115 Ga0105243_10025042 3300009148 Bacteria 4557
116 Ga0105248_10013890 3300009177 Bacteria 8860
117 Ga0105248_10022225 3300009177 Bacteria 7033
118 Ga0105237_10019832 3300009545 Bacteria 6942
119 Ga0105237_10030141 3300009545 Bacteria 5512
120 Ga0105237_10057781 3300009545 Unclassified 3882
121 Ga0105237_10602222 3300009545 Unclassified 1106
122 Ga0105249_10034580 3300009553 Bacteria 4581
123 Ga0105249_10128524 3300009553 Bacteria 2416
124 Ga0123341_1002866 3300009765 Bacteria 14487
125 Ga0123342_1019294 3300009766 Bacteria 5238
126 Ga0099796_10004789 3300010159 Bacteria 3311
127 Ga0105239_10008923 3300010375 Bacteria 11345
128 Ga0105239_10009764 3300010375 Bacteria 10788
129 Ga0105239_10191055 3300010375 Bacteria 2292
130 Ga0105239_10531871 3300010375 Bacteria 1338
131 Ga0105246_10008492 3300011119 Bacteria 6315
132 Ga0157371_10000010 3300013102 Bacteria 384921
133 Ga0157369_10007546 3300013105 Bacteria 12515
134 Ga0157369_10047020 3300013105 Bacteria 4687
135 Ga0157369_10323700 3300013105 Bacteria 1602
136 Ga0157374_10011419 3300013296 Bacteria 7689
137 Ga0163162_10017404 3300013306 Bacteria 7030
138 Ga0163162_10121598 3300013306 Bacteria 2715
139 Ga0157372_10000042 3300013307 Bacteria 157651
140 Ga0157375_10002517 3300013308 Bacteria 15906
141 Ga0157375_10040322 3300013308 Bacteria 4500
142 Ga0163163_10169228 3300014325 Bacteria 2231
143 Ga0157380_10110424 3300014326 Bacteria 2309
144 Ga0182008_10047706 3300014497 Bacteria 2128
145 Ga0157379_10657412 3300014968 Unclassified 981
146 Ga0157376_10044208 3300014969 Bacteria 3660
147 Ga0163161_10009972 3300017792 Bacteria 6580
148 Ga0213872_10001762 3300021361 Bacteria 13555
149 Ga0213872_10017616 3300021361 Unclassified 3299
150 Ga0213872_10021111 3300021361 Bacteria 2998
151 Ga0213872_10053213 3300021361 Bacteria 1836
152 Ga0213874_10013408 3300021377 Bacteria 2123
153 Ga0209435_100010 3300025206 Bacteria 475373
154 Ga0209566_100224 3300025225 Bacteria 55927
155 Ga0209566_100804 3300025225 Bacteria 16378
156 Ga0209674_100043 3300025226 Bacteria 369728
157 Ga0209674_100251 3300025226 Bacteria 44867
158 Ga0207425_1000034 3300025245 Bacteria 227886
159 Ga0209646_1000001 3300025246 Bacteria 3092932
160 Ga0209646_1000002 3300025246 Bacteria 1425781
161 Ga0209026_1000001 3300025250 Bacteria 1228671
162 Ga0209026_1000178 3300025250 Bacteria 96368
163 Ga0209677_103747 3300025253 Bacteria 4740
164 Ga0209148_1000304 3300025254 Bacteria 70717
165 Ga0209759_1000001 3300025256 Bacteria 2799452
166 Ga0209129_1000094 3300025258 Bacteria 172051
167 Ga0209233_1018881 3300025261 Bacteria 1844
168 Ga0209673_1007651 3300025273 Bacteria 4930
169 Ga0209130_1026996 3300025284 Bacteria 1224
170 Ga0209676_1000065 3300025292 Bacteria 318605
171 Ga0209676_1001898 3300025292 Bacteria 17041
172 Ga0209025_1000184 3300025294 Bacteria 155611
173 Ga0209758_1000061 3300025297 Bacteria 320172
174 Ga0209758_1000159 3300025297 Bacteria 155588
175 Ga0209758_1030228 3300025297 Bacteria 2248
176 Ga0209050_1003257 3300025298 Bacteria 12215
177 Ga0209050_1025431 3300025298 Bacteria 2012
178 Ga0209050_1035450 3300025298 Bacteria 1474
179 Ga0207426_1021609 3300025302 Bacteria 2223
180 Ga0209051_1003976 3300025303 Bacteria 9396
181 Ga0209051_1025340 3300025303 Bacteria 2416
182 Ga0209257_1000013 3300025304 Bacteria 1047305
183 Ga0209257_1000504 3300025304 Bacteria 68999
184 Ga0207653_10008309 3300025885 Bacteria 3236
185 Ga0207653_10019751 3300025885 Bacteria 2126
186 Ga0207692_10101262 3300025898 Bacteria 1582
187 Ga0207642_10059203 3300025899 Bacteria 1770
188 Ga0207680_10008276 3300025903 Bacteria 5097
189 Ga0207685_10010530 3300025905 Bacteria 2735
190 Ga0207699_10008443 3300025906 Bacteria 5084
191 Ga0207645_10005397 3300025907 Bacteria 9273
192 Ga0207684_10494497 3300025910 Bacteria 1049
193 Ga0207684_10500741 3300025910 Bacteria 1041
194 Ga0207707_10009640 3300025912 Bacteria 8377
195 Ga0207707_10253345 3300025912 Bacteria 1529
196 Ga0207671_10011927 3300025914 Bacteria 7027
197 Ga0207671_10016362 3300025914 Bacteria 5766
198 Ga0207671_10307724 3300025914 Unclassified 1252
199 Ga0207693_10199443 3300025915 Bacteria 1574
200 Ga0207693_10341517 3300025915 Unclassified 1172
201 Ga0207649_10044907 3300025920 Bacteria 2707
202 Ga0207646_10142106 3300025922 Bacteria 2162
203 Ga0207646_10215719 3300025922 Unclassified 1733
204 Ga0207681_10380911 3300025923 Bacteria 1135
205 Ga0207687_10011037 3300025927 Bacteria 5905
206 Ga0207664_10293581 3300025929 Bacteria 1429
207 Ga0207664_10321674 3300025929 Bacteria 1365
208 Ga0207644_10060249 3300025931 Bacteria 2746
209 Ga0207706_10003934 3300025933 Bacteria 14082
210 Ga0207706_10018087 3300025933 Bacteria 6341
211 Ga0207686_10186029 3300025934 Bacteria 1477
212 Ga0207709_10124676 3300025935 Bacteria 1745
213 Ga0207665_10286625 3300025939 Bacteria 1227
214 Ga0207711_10006116 3300025941 Bacteria 10167
215 Ga0207711_10139428 3300025941 Bacteria 2181
216 Ga0207689_10042828 3300025942 Bacteria 3743
217 Ga0207667_10112612 3300025949 Bacteria 2806
218 Ga0207667_10644609 3300025949 Bacteria 1065
219 Ga0207712_10018179 3300025961 Bacteria 4575
220 Ga0207712_10324877 3300025961 Bacteria 1271
221 Ga0207668_10085314 3300025972 Unclassified 2304
222 Ga0207658_10015533 3300025986 Bacteria 5223
223 Ga0207677_10022319 3300026023 Bacteria 3888
224 Ga0207703_10024365 3300026035 Bacteria 4762
225 Ga0207678_10007546 3300026067 Bacteria 9614
226 Ga0207678_10031341 3300026067 Bacteria 4638
227 Ga0207678_10085406 3300026067 Unclassified 2698
228 Ga0207678_10371497 3300026067 Bacteria 1235
229 Ga0207702_10075722 3300026078 Bacteria 2908
230 Ga0207702_10162980 3300026078 Bacteria 2038
231 Ga0207648_10022742 3300026089 Bacteria 5626
232 Ga0207676_10363510 3300026095 Bacteria 1342
233 Ga0207674_10037779 3300026116 Bacteria 5018
234 Ga0207683_10007919 3300026121 Bacteria 9093
235 Ga0209179_1007755 3300027512 Bacteria 1783
236 Ga0209588_1001679 3300027671 Bacteria 5827
237 Ga0268266_10159817 3300028379 Bacteria 2037
238 Ga0268265_10154470 3300028380 Bacteria 1940
239 Ga0268264_10072001 3300028381 Unclassified 2930
240 Ga0268264_10478415 3300028381 Bacteria 1211
241 Ga0307515_10002427 3300028794 Bacteria 40656
242 Ga0307515_10028947 3300028794 Bacteria 9388
243 Ga0307515_10178602 3300028794 Bacteria 2083
244 Ga0265338_10006059 3300028800 Bacteria 15526
245 Ga0265338_10030280 3300028800 Bacteria 5337
246 Ga0265338_10083833 3300028800 Bacteria 2664
247 Ga0316181_1013750 3300030744 Bacteria 4862
248 Ga0265770_1000128 3300030878 Bacteria 9195
249 Ga0265760_10000177 3300031090 Bacteria 16628
250 Ga0265330_10057018 3300031235 Unclassified 1704
251 Ga0265320_10015692 3300031240 Bacteria 4274
252 Ga0265325_10004468 3300031241 Bacteria 8835
253 Ga0265340_10006498 3300031247 Bacteria 6431
254 Ga0265340_10041787 3300031247 Bacteria 2253
255 Ga0265340_10044968 3300031247 Bacteria 2159
256 Ga0265339_10000503 3300031249 Bacteria 30482
257 Ga0265316_10010656 3300031344 Bacteria 8358
258 Ga0307513_10000001 3300031456 Bacteria 1660464
259 Ga0307513_10002593 3300031456 Bacteria 24972
260 Ga0307513_10048472 3300031456 Bacteria 4611
261 Ga0307513_10271482 3300031456 Bacteria 1479
262 Ga0307408_100004109 3300031548 Bacteria 9932
263 Ga0265313_10000099 3300031595 Bacteria 88958
264 Ga0307508_10126733 3300031616 Bacteria 2156
265 Ga0265314_10005117 3300031711 Bacteria 11938
266 Ga0265342_10012537 3300031712 Bacteria 5738
267 Ga0307516_10088512 3300031730 Bacteria 2929
268 Ga0307516_10213024 3300031730 Bacteria 1645
269 Ga0307405_10004876 3300031731 Bacteria 6404
270 Ga0307406_10017470 3300031901 Bacteria 4177
271 Ga0307412_10113248 3300031911 Bacteria 1941
272 Ga0307415_100007992 3300032126 Bacteria 5833
273 Ga0307507_10022362 3300033179 Bacteria 6989
274 Ga0307510_10165207 3300033180 Bacteria 1803
275 Ga0373945_0026235 3300035116 Bacteria 2029
276 Ga0373947_0030872 3300035725 Bacteria 3151
277 Ga0372808_005184 3300036459 Bacteria 1707
278 Ga0395899_0000401 3300037312 Bacteria 50789
279 Ga0395899_0006184 3300037312 Bacteria 9278
280 Ga0395899_0425105 3300037312 Bacteria 875
281 Ga0395900_0033235 3300037418 Bacteria 5309
282 Ga0395900_0406486 3300037418 Bacteria 1324
283 Ga0395898_0099719 3300037466 Bacteria 2789
284 Ga0395905_0000872 3300037471 Bacteria 39336
285 Ga0395905_0022154 3300037471 Bacteria 6011
286 Ga0395905_0114802 3300037471 Bacteria 2530
287 Ga0436364_0178301 3300037853 Bacteria 6943
288 Ga0436364_1111527 3300037853 Bacteria 2607
289 Ga0436364_1455769 3300037853 Bacteria 2480
290 Ga0242419_002725 3300038698 Bacteria 1164
291 Ga0436361_0093651 3300039447 Bacteria 2423
292 Ga0436361_0576920 3300039447 Bacteria 94641
293 Ga0436361_0602027 3300039447 Bacteria 7208
294 Ga0436361_0654582 3300039447 Bacteria 9126
295 Ga0436361_1068692 3300039447 Bacteria 2028
296 Ga0436361_1144974 3300039447 Unclassified 1182
297 Ga0436363_0064738 3300039450 Bacteria 4813
298 Ga0451791_0456434 3300041451 Bacteria 1075
299 Ga0466969_0012766 3300044656 Bacteria 4427
300 Ga0466969_0083979 3300044656 Bacteria 1516
301 Ga0466972_0000127 3300044658 Bacteria 63923
302 Ga0466982_0000004 3300044672 Bacteria 386724
303 Ga0466965_0023867 3300044683 Bacteria 2955
304 Ga0466966_0002115 3300044684 Bacteria 12903
305 Ga0466966_0019063 3300044684 Bacteria 4520
306 Ga0466966_0019698 3300044684 Bacteria 4439
307 Ga0466966_0233442 3300044684 Bacteria 1109
308 Ga0466961_0004150 3300044693 Bacteria 9046
309 Ga0466961_0040225 3300044693 Bacteria 2998
310 Ga0466970_0000159 3300044765 Bacteria 32178
311 Ga0466970_0045323 3300044765 Bacteria 2341
312 Ga0466957_0027612 3300044842 Bacteria 3375
313 Ga0466957_0044781 3300044842 Unclassified 2682
314 Ga0466960_0001187 3300044901 Bacteria 9389
315 Ga0466960_0021917 3300044901 Unclassified 2851
316 Ga0466960_0045939 3300044901 Bacteria 2088
317 Ga0466959_0025887 3300045049 Bacteria 4351
318 Ga0466959_0036510 3300045049 Bacteria 3632
319 Ga0466959_0096267 3300045049 Bacteria 2122
320 Ga0466958_0002885 3300045836 Bacteria 8767
321 Ga0466958_0154678 3300045836 Bacteria 1447
322 Ga0466958_0168764 3300045836 Bacteria 1385
323 Ga0495590_0030829 3300046457 Bacteria 1878
324 Ga0495590_0048684 3300046457 Bacteria 1479
325 Ga0495591_000537 3300046458 Bacteria 29393
326 Ga0495629_0000037 3300046459 Bacteria 117099
327 Ga0495583_0002496 3300046506 Bacteria 15613
328 Ga0495606_0001399 3300046507 Bacteria 32508
329 Ga0495606_0001402 3300046507 Bacteria 32434
330 Ga0495610_0003212 3300046512 Bacteria 12940
331 Ga0495610_0010882 3300046512 Bacteria 5614
332 Ga0495610_0016675 3300046512 Bacteria 4218
333 Ga0495610_0062862 3300046512 Bacteria 1760
334 Ga0495616_0073892 3300046513 Bacteria 1644
335 Ga0495620_0000998 3300046515 Bacteria 17497
336 Ga0495628_0010130 3300046516 Bacteria 8016
337 Ga0495632_0000763 3300046519 Bacteria 28910
338 Ga0495643_0018942 3300046522 Bacteria 3987
339 Ga0495643_0102091 3300046522 Bacteria 1469
340 Ga0495648_0000230 3300046524 Bacteria 64054
341 Ga0495648_0098025 3300046524 Bacteria 1624
342 Ga0495654_0006138 3300046530 Bacteria 6879
343 Ga0495654_0071984 3300046530 Bacteria 1637
344 Ga0495640_0035889 3300046533 Bacteria 3507
345 Ga0495633_0027160 3300046558 Bacteria 2800
346 Ga0495634_0065849 3300046642 Bacteria 2400
347 Ga0495661_0000532 3300046665 Bacteria 39216
348 Ga0495660_0052171 3300046810 Bacteria 2223
349 Ga0495674_0362812 3300047319 Bacteria 1174
350 Ga0495680_0159471 3300047322 Unclassified 1639
351 Ga0495683_0000320 3300047323 Bacteria 40260
352 Ga0495673_0000186 3300047469 Bacteria 100563
353 Ga0495681_0002727 3300047470 Bacteria 12496
354 Ga0495681_0003614 3300047470 Bacteria 10756
355 Ga0495686_0024626 3300047472 Bacteria 3952
356 Ga0495686_0075392 3300047472 Bacteria 2068
357 Ga0496101_0079684 3300048904 Bacteria 2418
358 Ga0496101_0084564 3300048904 Bacteria 2350
359 Ga0496103_0001512 3300048906 Bacteria 15549
360 Ga0496104_0310389 3300048907 Bacteria 1490
361 Ga0496104_0373279 3300048907 Bacteria 1339
362 Ga0496113_0082176 3300048916 Bacteria 2470
363 Ga0496115_0000158 3300048918 Bacteria 63464
364 Ga0496115_0001891 3300048918 Bacteria 14988
365 Ga0496115_0132725 3300048918 Bacteria 2052
366 Ga0496116_0022624 3300048919 Bacteria 4705
367 Ga0496116_0029040 3300048919 Bacteria 3993
368 Ga0496116_0030233 3300048919 Bacteria 3894
369 Ga0496117_0034192 3300048920 Bacteria 3834
370 Ga0496117_0174525 3300048920 Bacteria 1243
371 Ga0496118_0032001 3300048921 Bacteria 4345
372 Ga0496118_0088683 3300048921 Bacteria 2138
373 Ga0496119_0000510 3300048922 Bacteria 52939
374 Ga0496119_0011826 3300048922 Bacteria 7170
375 Ga0496119_0174578 3300048922 Bacteria 1132
376 Ga0496120_0091987 3300048923 Bacteria 1619
377 Ga0496121_0002329 3300048924 Bacteria 29339
378 Ga0496121_0019649 3300048924 Bacteria 6744
379 Ga0496121_0032365 3300048924 Bacteria 4754
380 Ga0496121_0047233 3300048924 Bacteria 3675
381 Ga0496122_0000107 3300048925 Bacteria 193163
382 Ga0496122_0008719 3300048925 Bacteria 10854
383 Ga0496122_0020299 3300048925 Bacteria 6013
384 Ga0496122_0036949 3300048925 Bacteria 3940
385 Ga0496122_0038100 3300048925 Bacteria 3858
386 Ga0496123_0000063 3300048926 Bacteria 216072
387 Ga0496123_0008119 3300048926 Bacteria 9704
388 Ga0496123_0021416 3300048926 Bacteria 5025
389 Ga0496123_0035166 3300048926 Bacteria 3575
390 Ga0496124_0019735 3300048927 Bacteria 6259
391 Ga0496124_0020417 3300048927 Bacteria 6120
392 Ga0496124_0045289 3300048927 Bacteria 3772
393 Ga0496124_0051399 3300048927 Bacteria 3507
394 Ga0496125_0005448 3300048928 Bacteria 14138
395 Ga0496126_0007322 3300048929 Bacteria 12121
396 Ga0496126_0043949 3300048929 Bacteria 4118
397 Ga0496126_0272543 3300048929 Bacteria 1404
398 Ga0501032_0040524 3300049569 Bacteria 3166
399 Ga0501032_0068253 3300049569 Bacteria 2374
400 Ga0501033_0041388 3300049570 Bacteria 3438
401 Ga0501034_0042703 3300049571 Bacteria 4590
402 Ga0501034_0132759 3300049571 Bacteria 2473
403 Ga0501034_0400263 3300049571 Bacteria 1296
404 Ga0501038_0059948 3300049574 Bacteria 3258
405 Ga0501038_0125475 3300049574 Bacteria 2113
406 Ga0501043_0227844 3300049579 Bacteria 1440
407 Ga0501047_0000850 3300049581 Bacteria 31408
408 Ga0501047_0013929 3300049581 Bacteria 7640
409 Ga0501047_0057377 3300049581 Bacteria 3765
410 Ga0501047_0083155 3300049581 Bacteria 3077
411 Ga0501047_0240515 3300049581 Bacteria 1661
412 Ga0501070_0152299 3300049586 Bacteria 1908
413 Ga0501073_0003935 3300049589 Bacteria 11142
414 Ga0501073_0092160 3300049589 Bacteria 2106
415 Ga0501077_0015630 3300049593 Bacteria 4780
416 Ga0501080_0121926 3300049742 Bacteria 2415
417 Ga0501269_000016 3300049766 Bacteria 58863
418 Ga0501035_0000238 3300049822 Bacteria 65886
419 Ga0501044_0002163 3300049823 Bacteria 22528
420 Ga0501044_0029336 3300049823 Bacteria 5801
421 Ga0501044_0176978 3300049823 Bacteria 2102
422 Ga0501044_0199369 3300049823 Bacteria 1960
423 nmdc:mga05p37_102488_c1 3300050507 Bacteria 3525
424 nmdc:mga05p37_147575_c1 3300050507 Bacteria 2879
425 nmdc:mga09592_207356_c1 3300050508 Bacteria 1698
426 nmdc:mga0qj67_199992_c1 3300050509 Bacteria 1624
427 nmdc:mga06r32_49844_c1 3300050510 Bacteria 4006
428 nmdc:mga0n895_45503_c1 3300050512 Archaea 4283
429 nmdc:mga0n895_8184_c1 3300050512 Bacteria 9038
430 nmdc:mga0rr50_3298_c1 3300050513 Bacteria 9266
431 nmdc:mga08x19_1479_c1 3300050514 Bacteria 14556
432 nmdc:mga08x19_78993_c1 3300050514 Bacteria 2157
433 nmdc:mga0a205_106095_c1 3300050515 Bacteria 2708
434 nmdc:mga0a205_10744_c1 3300050515 Bacteria 8416
435 nmdc:mga0a205_147596_c1 3300050515 Archaea 2252
436 Ga0500610_0066486 3300053079 Bacteria 1880
437 Ga0495619_0089018 3300053085 Bacteria 2088
438 Ga0500644_0001980 3300053088 Bacteria 5222
439 Ga0500651_0001456 3300053093 Bacteria 11910
440 Ga0500555_001763 3300053103 Bacteria 6467
441 Ga0500556_0000097 3300053104 Bacteria 81329
442 Ga0500556_0021320 3300053104 Bacteria 2088
443 Ga0500593_000169 3300053117 Bacteria 26386
444 Ga0500595_020216 3300053119 Bacteria 2401
445 Ga0500608_000191 3300053122 Bacteria 24609
446 Ga0500658_0032375 3300053134 Bacteria 2050
447 Ga0500559_0093628 3300053136 Bacteria 1378
448 Ga0500561_0012313 3300053137 Bacteria 1822
449 Ga0500564_011335 3300053138 Bacteria 3929
450 Ga0500568_0000514 3300053139 Bacteria 28491
451 Ga0500568_0002443 3300053139 Bacteria 10935
452 Ga0500568_0026664 3300053139 Bacteria 2423
453 Ga0500577_0021776 3300053142 Bacteria 2117
454 Ga0500590_018124 3300053148 Bacteria 3644
455 Ga0500600_0072975 3300053149 Bacteria 1877
456 Ga0500636_0003875 3300053177 Bacteria 8444
457 Ga0500636_0062574 3300053177 Bacteria 2170
458 Ga0500645_003789 3300053730 Bacteria 6014
459 Ga0500645_043330 3300053730 Bacteria 1325
460 Ga0500609_002688 3300053731 Bacteria 2531
461 Ga0500661_010546 3300055283 Bacteria 1682
462 Ga0501082_0006824 3300060353 Bacteria 9869
463 Ga0466962_0020843 3300061719 Bacteria 3150
464 Ga0466962_0123292 3300061719 Bacteria 1251
465 2509151009 2508501128 Bacteria 8613869
466 2511247257 2511231002 Bacteria 5042903
467 2585844718 2585427594 Bacteria 6180594
468 2599625301 2599185214 Bacteria 8209958
469 2599673247 2599185226 Bacteria 8233575
470 2599682917 2599185227 Bacteria 8246414
471 2599694855 2599185229 Bacteria 8216126
472 2601639996 2600255286 Bacteria 5390125
473 2738803878 2738541293 Bacteria 7065685
474 2819678588 2818991460 Bacteria 7595395
475 2821112462 2821111986 Bacteria 6894338
476 2838060427 2838054893 Bacteria 7451788
477 2854921135 2854916844 Bacteria 5725939
478 2856746432 2856741275 Bacteria 8096094
479 2862285650 2862281513 Bacteria 9621493
480 2874125582 2874123672 Bacteria 7238285
481 2874126210 2874123672 Bacteria 7238285
482 2883293605 2883291878 Bacteria 5894118
483 2884793882 2884791551 Bacteria 8511252
484 2891567992 2891562705 Bacteria 8039471
485 2899804085 2899803654 Bacteria 5577784
486 2904428186 2904424332 Bacteria 7633521
487 2904600364 2904595352 Bacteria 6124848
488 2904697022 2904690495 Bacteria 9412302
489 2908762709 2908756301 Bacteria 8864324
490 2928077798 2928070936 Bacteria 8062541
491 2929923644 2929921140 Bacteria 8649150
492 2946055091 2946053406 Bacteria 6978655
493 2984531423 2984527788 Bacteria 5288478
494 2984532678 2984532647 Bacteria 5288506
495 3002144215 3002141150 Bacteria 5254435
496 3003932260 3003930520 Bacteria 5667563
497 8002319370 8002317523 Bacteria 8051857
498 8003155223 8003151029 Bacteria 8187759
499 8007377458 8007375930 Bacteria 4080554
500 8024489975 8024486573 Bacteria 6540512
501 8046994208 8046991243 Bacteria 8497463
502 8056695063 8056689827 Bacteria 6712655
503 Ga0500652_108143
504 JGI24740J21852_10000667
505 JGI24735J21928_10001891
506 JGI25155J39150_1000175
507 JGI25156J39149_1000379
508 JGI25154J39366_1000014
509 JGI25154J39366_1000312
510 JGI25157J39369_1000421
511 JGI25150J39212_1000504
512 JGI25151J46595_10000081
513 JGI25153J46596_10000117
514 JGI25153J46596_10010217
515 rootH1_10039163
516 rootH1_10118901
517 rootH1_10169498
518 rootH2_10183889
519 rootH2_10250409
520 rootL2_10061303
521 rootL2_10156153
522 rootL2_10181767
523 rootH1_10176393
524 rootH1_10193019
525 rootH1_10385647
526 Ga0055533_1000925
527 Ga0055542_1000674
528 Ga0055536_1002997
529 Ga0055540_1004264
530 Ga0055531_10000030
531 Ga0055531_10038177
532 Ga0055541_1002029
533 Ga0065165_1000636
534 Ga0065165_1000907
535 Ga0065165_1050049
536 Ga0070676_10006900
537 Ga0070683_100079799
538 Ga0070690_100032956
539 Ga0070690_100373390
540 Ga0068869_100019413
541 Ga0070666_10004542
542 Ga0070666_10378560
543 Ga0068868_100004001
544 Ga0070692_10056728
545 Ga0070668_100022968
546 Ga0070669_100106360
547 Ga0070675_100061455
548 Ga0070671_100006589
549 Ga0070667_100012524
550 Ga0070709_10035927
551 Ga0070709_10295045
552 Ga0070714_100069362
553 Ga0070714_100206877
554 Ga0070714_100265632
555 Ga0070711_100370949
556 Ga0070708_100000590
557 Ga0070663_100038554
558 Ga0070678_100083989
559 Ga0070662_100005630
560 Ga0070681_10126869
561 Ga0068867_100020762
562 Ga0070698_100201667
563 Ga0070699_100105417
564 Ga0070684_100061753
565 Ga0070697_100015509
566 Ga0070697_100037614
567 Ga0070697_100039730
568 Ga0070697_100095081
569 Ga0070697_100158205
570 Ga0070697_100296524
571 Ga0070695_100323207
572 Ga0070665_100016899
573 Ga0070665_100108176
574 Ga0070665_100146478
575 Ga0070704_100333625
576 Ga0068854_100323676
577 Ga0068856_100099785
578 Ga0068856_100192685
579 Ga0068852_100074445
580 Ga0068852_100358311
581 Ga0068859_100088653
582 Ga0068863_100085213
583 Ga0068863_100173289
584 Ga0068858_100022548
585 Ga0068860_100019276
586 Ga0068860_100437607
587 Ga0068862_100304011
588 Ga0081455_10156003
589 Ga0081539_10010606
590 Ga0081539_10142109
591 Ga0075365_10004901
592 Ga0075365_10105146
593 Ga0075432_10030072
594 Ga0070715_10018843
595 Ga0070715_10126279
596 Ga0070716_100267128
597 Ga0070712_100402671
598 Ga0097621_100059554
599 Ga0068871_100030448
600 Ga0075428_100019867
601 Ga0075430_100162762
602 Ga0075431_100209930
603 Ga0075434_100024483
604 Ga0075429_100035009
605 Ga0068865_100030435
606 Ga0075436_100009927
607 Ga0097620_100088655
608 Ga0075435_100004917
609 Ga0075435_100034821
610 Ga0099794_10052902
611 Ga0099794_10088948
612 Ga0099794_10136817
613 Ga0099795_10021718
614 Ga0105240_10548733
615 Ga0105247_10137608
616 Ga0114129_10466847
617 Ga0105243_10025042
618 Ga0105248_10013890
619 Ga0105248_10022225
620 Ga0105237_10019832
621 Ga0105237_10030141
622 Ga0105237_10057781
623 Ga0105237_10602222
624 Ga0105249_10034580
625 Ga0105249_10128524
626 Ga0123341_1002866
627 Ga0123342_1019294
628 Ga0099796_10004789
629 Ga0105239_10008923
630 Ga0105239_10009764
631 Ga0105239_10191055
632 Ga0105239_10531871
633 Ga0105246_10008492
634 Ga0157371_10000010
635 Ga0157369_10007546
636 Ga0157369_10047020
637 Ga0157369_10323700
638 Ga0157374_10011419
639 Ga0163162_10017404
640 Ga0163162_10121598
641 Ga0157372_10000042
642 Ga0157375_10002517
643 Ga0157375_10040322
644 Ga0163163_10169228
645 Ga0157380_10110424
646 Ga0182008_10047706
647 Ga0157379_10657412
648 Ga0157376_10044208
649 Ga0163161_10009972
650 Ga0213872_10001762
651 Ga0213872_10017616
652 Ga0213872_10021111
653 Ga0213872_10053213
654 Ga0213874_10013408
655 Ga0209435_100010
656 Ga0209566_100224
657 Ga0209566_100804
658 Ga0209674_100043
659 Ga0209674_100251
660 Ga0207425_1000034
661 Ga0209646_1000001
662 Ga0209646_1000002
663 Ga0209026_1000001
664 Ga0209026_1000178
665 Ga0209677_103747
666 Ga0209148_1000304
667 Ga0209759_1000001
668 Ga0209129_1000094
669 Ga0209233_1018881
670 Ga0209673_1007651
671 Ga0209130_1026996
672 Ga0209676_1000065
673 Ga0209676_1001898
674 Ga0209025_1000184
675 Ga0209758_1000061
676 Ga0209758_1000159
677 Ga0209758_1030228
678 Ga0209050_1003257
679 Ga0209050_1025431
680 Ga0209050_1035450
681 Ga0207426_1021609
682 Ga0209051_1003976
683 Ga0209051_1025340
684 Ga0209257_1000013
685 Ga0209257_1000504
686 Ga0207653_10008309
687 Ga0207653_10019751
688 Ga0207692_10101262
689 Ga0207642_10059203
690 Ga0207680_10008276
691 Ga0207685_10010530
692 Ga0207699_10008443
693 Ga0207645_10005397
694 Ga0207684_10494497
695 Ga0207684_10500741
696 Ga0207707_10009640
697 Ga0207707_10253345
698 Ga0207671_10011927
699 Ga0207671_10016362
700 Ga0207671_10307724
701 Ga0207693_10199443
702 Ga0207693_10341517
703 Ga0207649_10044907
704 Ga0207646_10142106
705 Ga0207646_10215719
706 Ga0207681_10380911
707 Ga0207687_10011037
708 Ga0207664_10293581
709 Ga0207664_10321674
710 Ga0207644_10060249
711 Ga0207706_10003934
712 Ga0207706_10018087
713 Ga0207686_10186029
714 Ga0207709_10124676
715 Ga0207665_10286625
716 Ga0207711_10006116
717 Ga0207711_10139428
718 Ga0207689_10042828
719 Ga0207667_10112612
720 Ga0207667_10644609
721 Ga0207712_10018179
722 Ga0207712_10324877
723 Ga0207668_10085314
724 Ga0207658_10015533
725 Ga0207677_10022319
726 Ga0207703_10024365
727 Ga0207678_10007546
728 Ga0207678_10031341
729 Ga0207678_10085406
730 Ga0207678_10371497
731 Ga0207702_10075722
732 Ga0207702_10162980
733 Ga0207648_10022742
734 Ga0207676_10363510
735 Ga0207674_10037779
736 Ga0207683_10007919
737 Ga0209179_1007755
738 Ga0209588_1001679
739 Ga0268266_10159817
740 Ga0268265_10154470
741 Ga0268264_10072001
742 Ga0268264_10478415
743 Ga0307515_10002427
744 Ga0307515_10028947
745 Ga0307515_10178602
746 Ga0265338_10006059
747 Ga0265338_10030280
748 Ga0265338_10083833
749 Ga0316181_1013750
750 Ga0265770_1000128
751 Ga0265760_10000177
752 Ga0265330_10057018
753 Ga0265320_10015692
754 Ga0265325_10004468
755 Ga0265340_10006498
756 Ga0265340_10041787
757 Ga0265340_10044968
758 Ga0265339_10000503
759 Ga0265316_10010656
760 Ga0307513_10000001
761 Ga0307513_10002593
762 Ga0307513_10048472
763 Ga0307513_10271482
764 Ga0307408_100004109
765 Ga0265313_10000099
766 Ga0307508_10126733
767 Ga0265314_10005117
768 Ga0265342_10012537
769 Ga0307516_10088512
770 Ga0307516_10213024
771 Ga0307405_10004876
772 Ga0307406_10017470
773 Ga0307412_10113248
774 Ga0307415_100007992
775 Ga0307507_10022362
776 Ga0307510_10165207
777 Ga0373945_0026235
778 Ga0373947_0030872
779 Ga0372808_005184
780 Ga0395899_0000401
781 Ga0395899_0006184
782 Ga0395899_0425105
783 Ga0395900_0033235
784 Ga0395900_0406486
785 Ga0395898_0099719
786 Ga0395905_0000872
787 Ga0395905_0022154
788 Ga0395905_0114802
789 Ga0436364_0178301
790 Ga0436364_1111527
791 Ga0436364_1455769
792 Ga0242419_002725
793 Ga0436361_0093651
794 Ga0436361_0576920
795 Ga0436361_0602027
796 Ga0436361_0654582
797 Ga0436361_1068692
798 Ga0436361_1144974
799 Ga0436363_0064738
800 Ga0451791_0456434
801 Ga0466969_0012766
802 Ga0466969_0083979
803 Ga0466972_0000127
804 Ga0466982_0000004
805 Ga0466965_0023867
806 Ga0466966_0002115
807 Ga0466966_0019063
808 Ga0466966_0019698
809 Ga0466966_0233442
810 Ga0466961_0004150
811 Ga0466961_0040225
812 Ga0466970_0000159
813 Ga0466970_0045323
814 Ga0466957_0027612
815 Ga0466957_0044781
816 Ga0466960_0001187
817 Ga0466960_0021917
818 Ga0466960_0045939
819 Ga0466959_0025887
820 Ga0466959_0036510
821 Ga0466959_0096267
822 Ga0466958_0002885
823 Ga0466958_0154678
824 Ga0466958_0168764
825 Ga0495590_0030829
826 Ga0495590_0048684
827 Ga0495591_000537
828 Ga0495629_0000037
829 Ga0495583_0002496
830 Ga0495606_0001399
831 Ga0495606_0001402
832 Ga0495610_0003212
833 Ga0495610_0010882
834 Ga0495610_0016675
835 Ga0495610_0062862
836 Ga0495616_0073892
837 Ga0495620_0000998
838 Ga0495628_0010130
839 Ga0495632_0000763
840 Ga0495643_0018942
841 Ga0495643_0102091
842 Ga0495648_0000230
843 Ga0495648_0098025
844 Ga0495654_0006138
845 Ga0495654_0071984
846 Ga0495640_0035889
847 Ga0495633_0027160
848 Ga0495634_0065849
849 Ga0495661_0000532
850 Ga0495660_0052171
851 Ga0495674_0362812
852 Ga0495680_0159471
853 Ga0495683_0000320
854 Ga0495673_0000186
855 Ga0495681_0002727
856 Ga0495681_0003614
857 Ga0495686_0024626
858 Ga0495686_0075392
859 Ga0496101_0079684
860 Ga0496101_0084564
861 Ga0496103_0001512
862 Ga0496104_0310389
863 Ga0496104_0373279
864 Ga0496113_0082176
865 Ga0496115_0000158
866 Ga0496115_0001891
867 Ga0496115_0132725
868 Ga0496116_0022624
869 Ga0496116_0029040
870 Ga0496116_0030233
871 Ga0496117_0034192
872 Ga0496117_0174525
873 Ga0496118_0032001
874 Ga0496118_0088683
875 Ga0496119_0000510
876 Ga0496119_0011826
877 Ga0496119_0174578
878 Ga0496120_0091987
879 Ga0496121_0002329
880 Ga0496121_0019649
881 Ga0496121_0032365
882 Ga0496121_0047233
883 Ga0496122_0000107
884 Ga0496122_0008719
885 Ga0496122_0020299
886 Ga0496122_0036949
887 Ga0496122_0038100
888 Ga0496123_0000063
889 Ga0496123_0008119
890 Ga0496123_0021416
891 Ga0496123_0035166
892 Ga0496124_0019735
893 Ga0496124_0020417
894 Ga0496124_0045289
895 Ga0496124_0051399
896 Ga0496125_0005448
897 Ga0496126_0007322
898 Ga0496126_0043949
899 Ga0496126_0272543
900 Ga0501032_0040524
901 Ga0501032_0068253
902 Ga0501033_0041388
903 Ga0501034_0042703
904 Ga0501034_0132759
905 Ga0501034_0400263
906 Ga0501038_0059948
907 Ga0501038_0125475
908 Ga0501043_0227844
909 Ga0501047_0000850
910 Ga0501047_0013929
911 Ga0501047_0057377
912 Ga0501047_0083155
913 Ga0501047_0240515
914 Ga0501070_0152299
915 Ga0501073_0003935
916 Ga0501073_0092160
917 Ga0501077_0015630
918 Ga0501080_0121926
919 Ga0501269_000016
920 Ga0501035_0000238
921 Ga0501044_0002163
922 Ga0501044_0029336
923 Ga0501044_0176978
924 Ga0501044_0199369
925 nmdc:mga05p37_102488_c1
926 nmdc:mga05p37_147575_c1
927 nmdc:mga09592_207356_c1
928 nmdc:mga0qj67_199992_c1
929 nmdc:mga06r32_49844_c1
930 nmdc:mga0n895_45503_c1
931 nmdc:mga0n895_8184_c1
932 nmdc:mga0rr50_3298_c1
933 nmdc:mga08x19_1479_c1
934 nmdc:mga08x19_78993_c1
935 nmdc:mga0a205_106095_c1
936 nmdc:mga0a205_10744_c1
937 nmdc:mga0a205_147596_c1
938 Ga0500610_0066486
939 Ga0495619_0089018
940 Ga0500644_0001980
941 Ga0500651_0001456
942 Ga0500555_001763
943 Ga0500556_0000097
944 Ga0500556_0021320
945 Ga0500593_000169
946 Ga0500595_020216
947 Ga0500608_000191
948 Ga0500658_0032375
949 Ga0500559_0093628
950 Ga0500561_0012313
951 Ga0500564_011335
952 Ga0500568_0000514
953 Ga0500568_0002443
954 Ga0500568_0026664
955 Ga0500577_0021776
956 Ga0500590_018124
957 Ga0500600_0072975
958 Ga0500636_0003875
959 Ga0500636_0062574
960 Ga0500645_003789
961 Ga0500645_043330
962 Ga0500609_002688
963 Ga0500661_010546
964 Ga0501082_0006824
965 Ga0466962_0020843
966 Ga0466962_0123292
967 2509151009
968 2511247257
969 2585844718
970 2599625301
971 2599673247
972 2599682917
973 2599694855
974 2601639996
975 2738803878
976 2819678588
977 2821112462
978 2838060427
979 2854921135
980 2856746432
981 2862285650
982 2874125582
983 2874126210
984 2883293605
985 2884793882
986 2891567992
987 2899804085
988 2904428186
989 2904600364
990 2904697022
991 2908762709
992 2928077798
993 2929923644
994 2946055091
995 2984531423
996 2984532678
997 3002144215
998 3003932260
999 8002319370
1000 8003155223
1001 8007377458
1002 8024489975
1003 8046994208
1004 8056695063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

49

142

0.92

PF05368

NmrA

NmrA-like family

49

142

0.88

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

50

171

0.86

PF07993

NAD_binding_4

Male sterility protein

51

115

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

50

123

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

53

224

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s2j-assembly1.cif.gz_A square conformation of ktra r16k mutant ring with bound atp 0.841 2 109
4j91-assembly1.cif.gz_A-2 diamond-shaped octameric structure of ktra with adp bound 0.8361 3 109
4j91-assembly1.cif.gz_C-2 diamond-shaped octameric structure of ktra with adp bound 0.8357 3 109
4j91-assembly1.cif.gz_B-2 diamond-shaped octameric structure of ktra with adp bound 0.8355 3 109
4j91-assembly1.cif.gz_D-2 diamond-shaped octameric structure of ktra with adp bound 0.8352 3 109
ID Description Score Start End Superfamily
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9823 1 261 3.40.50.720
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9786 1 261 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9762 1 259 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 1 259 3.40.50.720
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8901 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Y3TQQ8-F1-model_v4 NAD-dependent dehydratase 0.9796 1 291 GO:0004029
GO:0005737
AF-A0A254Q6J3-F1-model_v4 SDR family oxidoreductase 0.979 1 292 GO:0004029
GO:0005737
AF-A0A7V3MJ56-F1-model_v4 3-beta hydroxysteroid dehydrogenase 0.9773 161 298 GO:0004029
GO:0005737
AF-B6HC03-F1-model_v4 Pc18g00870 protein 0.9771 1 298 GO:0004029
GO:0005737
AF-A0A4Q6CMB8-F1-model_v4 deleted 0.9771 1 83

Map