F455939

General Info

Members Datasets Scaffolds Average Seq Length
502 287 495 140

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0586416|Ga0530510_0586416_326_775
Length 149
Sequence MRHRWSGRKLNRTSAHRKAMFVNMAAALIKHEQITTTLPKAKDLRPVVDNLITLGKRGKENLHARRQAISRLGGDAKLADKLFTTLAERYADRPGGYTRVLKAGFRFGDAAPMAIIELVDRDPDAKGQDSGPTQQTAQAEAEAAQASAT

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
3 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
4 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
5 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
6 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
7 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
71 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
91 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
205 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
259 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
268 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
273 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
274 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
275 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 5.38
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.96
Nodule 0.2
Rhizoplane 1.99
Rhizosphere 81.47
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1022824 3300003163 Bacteria 2259
2 JGI25153J46596_10000255 3300003215 Bacteria 43499
3 JGI25153J46596_10048865 3300003215 Bacteria 1232
4 Ga0006777J48905_1011379 3300003308 Bacteria 3133
5 Ga0007410J51695_1024477 3300003574 Bacteria 543
6 Ga0007410J51695_1031739 3300003574 Bacteria 677
7 Ga0007409J51694_1035704 3300003575 Bacteria 814
8 Ga0007429J51699_1023684 3300003579 Bacteria 1403
9 Ga0032354_1029473 3300003693 Bacteria 1344
10 Ga0032354_1035534 3300003693 Bacteria 859
11 Ga0055530_10051239 3300003791 Bacteria 958
12 Ga0055531_10020097 3300003794 Bacteria 2661
13 Ga0070680_100516138 3300005336 Bacteria 1023
14 Ga0070680_100598157 3300005336 Bacteria 947
15 Ga0070680_101149451 3300005336 Bacteria 671
16 Ga0070669_100011674 3300005353 Bacteria 6233
17 Ga0070675_100711169 3300005354 Bacteria 915
18 Ga0070714_100121168 3300005435 Bacteria 2327
19 Ga0070714_100189401 3300005435 Bacteria 1876
20 Ga0070714_101667332 3300005435 Bacteria 623
21 Ga0070713_100022836 3300005436 Bacteria 4842
22 Ga0070713_101593839 3300005436 Bacteria 634
23 Ga0070711_100255823 3300005439 Bacteria 1376
24 Ga0070700_100217372 3300005441 Bacteria 1352
25 Ga0070708_100208932 3300005445 Bacteria 1829
26 Ga0070681_10073194 3300005458 Bacteria 3388
27 Ga0070681_10368944 3300005458 Bacteria 1346
28 Ga0070681_10416850 3300005458 Bacteria 1255
29 Ga0070681_10863369 3300005458 Bacteria 823
30 Ga0070706_100220450 3300005467 Bacteria 1771
31 Ga0070706_100322535 3300005467 Bacteria 1440
32 Ga0070707_100040754 3300005468 Bacteria 4443
33 Ga0070698_100183441 3300005471 Bacteria 2031
34 Ga0070698_101201170 3300005471 Bacteria 708
35 Ga0070699_100778108 3300005518 Bacteria 876
36 Ga0070679_100234395 3300005530 Bacteria 1795
37 Ga0070679_100757703 3300005530 Bacteria 914
38 Ga0070697_100141639 3300005536 Bacteria 2023
39 Ga0070697_100157350 3300005536 Bacteria 1919
40 Ga0070697_101401107 3300005536 Bacteria 624
41 Ga0068853_100202687 3300005539 Bacteria 1806
42 Ga0070695_100299912 3300005545 Bacteria 1187
43 Ga0070696_100007402 3300005546 Bacteria 7338
44 Ga0070665_100004437 3300005548 Bacteria 14745
45 Ga0068855_100116465 3300005563 Bacteria 3062
46 Ga0068855_100534514 3300005563 Bacteria 1271
47 Ga0070664_100592002 3300005564 Bacteria 1028
48 Ga0068856_100152105 3300005614 Bacteria 2323
49 Ga0068856_100337891 3300005614 Bacteria 1524
50 Ga0068856_100598529 3300005614 Bacteria 1124
51 Ga0068856_100637922 3300005614 Bacteria 1086
52 Ga0068861_100005050 3300005719 Bacteria 8901
53 Ga0068870_10507843 3300005840 Bacteria 805
54 Ga0068858_101924070 3300005842 Bacteria 584
55 Ga0081455_10242929 3300005937 Bacteria 1322
56 Ga0081455_10329639 3300005937 Bacteria 1084
57 Ga0081538_10001852 3300005981 Bacteria 21341
58 Ga0081540_1050965 3300005983 Bacteria 2051
59 Ga0081540_1194183 3300005983 Bacteria 745
60 Ga0081540_1228746 3300005983 Bacteria 658
61 Ga0070717_10695835 3300006028 Bacteria 923
62 Ga0075432_10293152 3300006058 Bacteria 673
63 Ga0070715_10218359 3300006163 Bacteria 979
64 Ga0070716_100222639 3300006173 Bacteria 1269
65 Ga0070712_100262779 3300006175 Bacteria 1383
66 Ga0070712_100297790 3300006175 Bacteria 1304
67 Ga0075362_10158567 3300006177 Bacteria 1088
68 Ga0075362_10531063 3300006177 Bacteria 604
69 Ga0075366_10159910 3300006195 Bacteria 1365
70 Ga0075366_10183136 3300006195 Bacteria 1272
71 Ga0075366_10217961 3300006195 Bacteria 1162
72 Ga0075370_10100739 3300006353 Bacteria 1671
73 Ga0075370_10547757 3300006353 Bacteria 699
74 Ga0075428_101010063 3300006844 Bacteria 880
75 Ga0075428_101551935 3300006844 Bacteria 693
76 Ga0075428_102028851 3300006844 Bacteria 596
77 Ga0075430_100020125 3300006846 Bacteria 5679
78 Ga0075431_100016870 3300006847 Bacteria 7416
79 Ga0075431_100055348 3300006847 Bacteria 4092
80 Ga0075431_100729227 3300006847 Bacteria 967
81 Ga0075431_101478209 3300006847 Bacteria 638
82 Ga0075429_100160321 3300006880 Bacteria 1970
83 Ga0075429_100427658 3300006880 Bacteria 1160
84 Ga0075436_100214036 3300006914 Bacteria 1366
85 Ga0075435_100283784 3300007076 Bacteria 1414
86 Ga0099795_10048274 3300007788 Bacteria 1541
87 Ga0105240_10000330 3300009093 Bacteria 89049
88 Ga0105240_10202070 3300009093 Bacteria 2328
89 Ga0105240_10578471 3300009093 Bacteria 1239
90 Ga0105240_10974630 3300009093 Bacteria 908
91 Ga0111539_10007165 3300009094 Bacteria 14294
92 Ga0111539_10096527 3300009094 Bacteria 3472
93 Ga0111539_10248012 3300009094 Bacteria 2073
94 Ga0105247_10115173 3300009101 Bacteria 1735
95 Ga0105247_10780966 3300009101 Bacteria 727
96 Ga0114129_10197683 3300009147 Bacteria 2726
97 Ga0114129_10483733 3300009147 Bacteria 1619
98 Ga0114129_11712501 3300009147 Bacteria 767
99 Ga0105243_11933974 3300009148 Bacteria 623
100 Ga0105241_10602959 3300009174 Bacteria 992
101 Ga0105241_11089783 3300009174 Bacteria 752
102 Ga0105242_10581614 3300009176 Bacteria 1078
103 Ga0105237_10391861 3300009545 Bacteria 1394
104 Ga0105237_10468371 3300009545 Bacteria 1266
105 Ga0105237_11801141 3300009545 Bacteria 620
106 Ga0105238_10201271 3300009551 Bacteria 1967
107 Ga0105238_10722873 3300009551 Bacteria 1008
108 Ga0105238_11304375 3300009551 Bacteria 752
109 Ga0105249_10118985 3300009553 Bacteria 2508
110 Ga0105249_10824341 3300009553 Bacteria 992
111 Ga0105249_12095076 3300009553 Bacteria 638
112 Ga0105030_117612 3300009987 Bacteria 640
113 Ga0105028_104464 3300009993 Bacteria 1457
114 Ga0099796_10085683 3300010159 Bacteria 1163
115 Ga0105239_11499145 3300010375 Bacteria 779
116 Ga0157325_1026219 3300012485 Bacteria 556
117 Ga0157373_10942077 3300013100 Bacteria 642
118 Ga0157370_10892164 3300013104 Bacteria 807
119 Ga0163162_10248782 3300013306 Bacteria 1909
120 Ga0163162_10268205 3300013306 Bacteria 1839
121 Ga0157375_10751948 3300013308 Bacteria 1126
122 Ga0157375_12366796 3300013308 Bacteria 634
123 Ga0163163_10168840 3300014325 Bacteria 2234
124 Ga0163163_10556632 3300014325 Bacteria 1209
125 Ga0157380_10070603 3300014326 Bacteria 2822
126 Ga0157379_10342094 3300014968 Bacteria 1368
127 Ga0157376_11106977 3300014969 Bacteria 818
128 Ga0184598_104859 3300019182 Bacteria 1703
129 Ga0184599_100208 3300019188 Bacteria 768
130 Ga0184600_125891 3300019190 Bacteria 690
131 Ga0184603_144702 3300019192 Bacteria 1018
132 Ga0213872_10004734 3300021361 Bacteria 7136
133 Ga0213872_10024586 3300021361 Bacteria 2771
134 Ga0213872_10120550 3300021361 Bacteria 1160
135 Ga0213872_10290718 3300021361 Bacteria 680
136 Ga0213876_10058902 3300021384 Bacteria 2027
137 Ga0213876_10064483 3300021384 Bacteria 1934
138 Ga0213875_10000643 3300021388 Bacteria 27836
139 Ga0213875_10097928 3300021388 Bacteria 1368
140 Ga0213871_10029821 3300021441 Bacteria 1417
141 Ga0213871_10153487 3300021441 Bacteria 702
142 Ga0247552_100593 3300023536 Bacteria 924
143 Ga0247555_100249 3300023539 Bacteria 1287
144 Ga0247554_103360 3300023547 Bacteria 626
145 Ga0247551_101611 3300023552 Bacteria 782
146 Ga0247553_100740 3300023672 Bacteria 1259
147 Ga0209148_1002262 3300025254 Bacteria 6965
148 Ga0209455_1000393 3300025272 Bacteria 37949
149 Ga0209025_1000053 3300025294 Bacteria 317600
150 Ga0209758_1000118 3300025297 Bacteria 195889
151 Ga0209758_1011868 3300025297 Bacteria 4969
152 Ga0209758_1015902 3300025297 Bacteria 3863
153 Ga0209050_1008047 3300025298 Bacteria 5735
154 Ga0209257_1000733 3300025304 Bacteria 49710
155 Ga0207682_10000101 3300025893 Bacteria 38917
156 Ga0207710_10066583 3300025900 Bacteria 1644
157 Ga0207699_10050521 3300025906 Bacteria 2452
158 Ga0207684_11286298 3300025910 Bacteria 603
159 Ga0207707_10014060 3300025912 Bacteria 6977
160 Ga0207707_10675970 3300025912 Bacteria 868
161 Ga0207707_11247254 3300025912 Bacteria 600
162 Ga0207695_10002225 3300025913 Bacteria 29133
163 Ga0207695_10106398 3300025913 Bacteria 2791
164 Ga0207695_10127661 3300025913 Bacteria 2504
165 Ga0207695_10499166 3300025913 Bacteria 1099
166 Ga0207671_10305583 3300025914 Bacteria 1257
167 Ga0207693_10050235 3300025915 Bacteria 3275
168 Ga0207660_11012162 3300025917 Bacteria 678
169 Ga0207652_10112074 3300025921 Bacteria 2420
170 Ga0207646_10326875 3300025922 Bacteria 1385
171 Ga0207646_11944794 3300025922 Bacteria 500
172 Ga0207681_11156108 3300025923 Bacteria 650
173 Ga0207681_11273916 3300025923 Bacteria 617
174 Ga0207694_10006922 3300025924 Bacteria 8609
175 Ga0207694_10191216 3300025924 Bacteria 1663
176 Ga0207700_10015558 3300025928 Bacteria 5022
177 Ga0207700_10171778 3300025928 Bacteria 1809
178 Ga0207700_10612950 3300025928 Bacteria 969
179 Ga0207664_10081920 3300025929 Bacteria 2627
180 Ga0207664_10204430 3300025929 Bacteria 1706
181 Ga0207664_10298500 3300025929 Bacteria 1417
182 Ga0207644_11343508 3300025931 Bacteria 601
183 Ga0207669_10140105 3300025937 Bacteria 1677
184 Ga0207665_10042330 3300025939 Bacteria 3044
185 Ga0207665_10131283 3300025939 Bacteria 1779
186 Ga0207711_10504667 3300025941 Bacteria 1127
187 Ga0207661_10912805 3300025944 Bacteria 809
188 Ga0207667_10056460 3300025949 Bacteria 4125
189 Ga0207667_10122444 3300025949 Bacteria 2680
190 Ga0207667_10660758 3300025949 Bacteria 1050
191 Ga0207667_11356731 3300025949 Bacteria 686
192 Ga0207712_10120753 3300025961 Bacteria 1982
193 Ga0207668_12034764 3300025972 Bacteria 517
194 Ga0207677_10985845 3300026023 Bacteria 763
195 Ga0207639_10394911 3300026041 Bacteria 1245
196 Ga0207639_11446743 3300026041 Bacteria 645
197 Ga0207708_10106771 3300026075 Bacteria 2171
198 Ga0207702_10057067 3300026078 Bacteria 3317
199 Ga0207702_10103261 3300026078 Bacteria 2521
200 Ga0207702_11313614 3300026078 Bacteria 717
201 Ga0207675_100020948 3300026118 Bacteria 6096
202 Ga0207428_10000169 3300027907 Bacteria 90667
203 Ga0207428_10138771 3300027907 Bacteria 1857
204 Ga0207428_10521386 3300027907 Bacteria 861
205 Ga0268266_10005613 3300028379 Bacteria 11650
206 Ga0268266_12208678 3300028379 Bacteria 522
207 Ga0268265_10007117 3300028380 Bacteria 7552
208 Ga0268265_10007119 3300028380 Bacteria 7550
209 Ga0265338_11004126 3300028800 Bacteria 565
210 Ga0265320_10011539 3300031240 Bacteria 5192
211 Ga0265340_10186540 3300031247 Bacteria 936
212 Ga0265339_10050345 3300031249 Bacteria 2278
213 Ga0265331_10002468 3300031250 Bacteria 12504
214 Ga0265331_10143233 3300031250 Bacteria 1086
215 Ga0265331_10481555 3300031250 Bacteria 558
216 Ga0265327_10013369 3300031251 Bacteria 5453
217 Ga0265327_10263838 3300031251 Bacteria 764
218 Ga0307513_10226844 3300031456 Bacteria 1684
219 Ga0307513_10724916 3300031456 Bacteria 700
220 Ga0307408_100228483 3300031548 Bacteria 1522
221 Ga0307408_100856198 3300031548 Bacteria 829
222 Ga0307408_100976525 3300031548 Bacteria 779
223 Ga0265313_10000458 3300031595 Bacteria 43153
224 Ga0265313_10003739 3300031595 Bacteria 12105
225 Ga0307508_10033438 3300031616 Bacteria 4641
226 Ga0265314_10014121 3300031711 Bacteria 6411
227 Ga0265314_10070462 3300031711 Bacteria 2342
228 Ga0265314_10231278 3300031711 Bacteria 1072
229 Ga0265314_10450611 3300031711 Bacteria 685
230 Ga0265314_10599167 3300031711 Bacteria 568
231 Ga0307516_10528182 3300031730 Bacteria 834
232 Ga0307413_10359822 3300031824 Bacteria 1126
233 Ga0307413_11256741 3300031824 Bacteria 646
234 Ga0307410_10282419 3300031852 Bacteria 1303
235 Ga0307407_10388292 3300031903 Bacteria 998
236 Ga0307407_11099688 3300031903 Bacteria 618
237 Ga0307409_100037100 3300031995 Bacteria 3590
238 Ga0307409_100054853 3300031995 Bacteria 3073
239 Ga0307409_101008971 3300031995 Bacteria 851
240 Ga0307416_100560821 3300032002 Bacteria 1217
241 Ga0307416_100976792 3300032002 Bacteria 949
242 Ga0307411_10196125 3300032005 Bacteria 1546
243 Ga0307411_11153964 3300032005 Bacteria 701
244 Ga0316053_100571 3300032120 Bacteria 1740
245 Ga0307415_100310803 3300032126 Bacteria 1310
246 Ga0307415_100722362 3300032126 Bacteria 901
247 Ga0307510_10534012 3300033180 Bacteria 618
248 Ga0373926_0022634 3300035083 Bacteria 2180
249 Ga0373926_0347509 3300035083 Bacteria 582
250 Ga0373923_0125242 3300035111 Bacteria 1151
251 Ga0373945_0583218 3300035116 Bacteria 504
252 Ga0316574_0213182 3300035398 Bacteria 1239
253 Ga0373924_0167171 3300035410 Bacteria 966
254 Ga0373935_0011852 3300035692 Bacteria 5238
255 Ga0373935_0144144 3300035692 Bacteria 1611
256 Ga0373935_0547579 3300035692 Bacteria 843
257 Ga0373927_0457587 3300035695 Bacteria 843
258 Ga0373927_0602827 3300035695 Bacteria 726
259 Ga0373933_0135613 3300035724 Bacteria 1551
260 Ga0373937_0034479 3300036401 Bacteria 4604
261 Ga0373937_0187720 3300036401 Bacteria 1942
262 Ga0373925_0533009 3300037068 Bacteria 965
263 Ga0373925_0972163 3300037068 Bacteria 699
264 Ga0395899_0922341 3300037312 Bacteria 531
265 Ga0395898_0245071 3300037466 Bacteria 1709
266 Ga0395898_0560078 3300037466 Bacteria 1085
267 Ga0395898_0614879 3300037466 Bacteria 1029
268 Ga0395898_0640130 3300037466 Bacteria 1006
269 Ga0436364_0616684 3300037853 Bacteria 34041
270 Ga0436364_0752883 3300037853 Bacteria 33808
271 Ga0436364_0945697 3300037853 Bacteria 1585
272 Ga0436364_1043967 3300037853 Bacteria 517
273 Ga0395901_0020718 3300038443 Bacteria 6731
274 Ga0395901_0399437 3300038443 Bacteria 1412
275 Ga0436365_0449991 3300039437 Bacteria 922
276 Ga0436365_0657275 3300039437 Bacteria 3782
277 Ga0436365_0708355 3300039437 Bacteria 750
278 Ga0436365_1163211 3300039437 Bacteria 1276
279 Ga0436365_1458468 3300039437 Bacteria 1004
280 Ga0436365_1582319 3300039437 Bacteria 777
281 Ga0436360_0125274 3300039438 Bacteria 767
282 Ga0436360_0896911 3300039438 Bacteria 686
283 Ga0436360_0897153 3300039438 Bacteria 751
284 Ga0436360_0906696 3300039438 Bacteria 761
285 Ga0436360_1294346 3300039438 Bacteria 656
286 Ga0436361_0026958 3300039447 Bacteria 1816
287 Ga0436361_0169334 3300039447 Bacteria 2647
288 Ga0436361_0172899 3300039447 Bacteria 13852
289 Ga0436361_0450045 3300039447 Bacteria 1122
290 Ga0436361_0756213 3300039447 Bacteria 1977
291 Ga0436361_0909345 3300039447 Bacteria 2716
292 Ga0436361_0974425 3300039447 Bacteria 783
293 Ga0451793_0831431 3300041452 Bacteria 582
294 Ga0451805_068841 3300041461 Bacteria 641
295 Ga0439431_0200582 3300041997 Bacteria 581
296 Ga0439441_093753 3300042001 Bacteria 667
297 Ga0450907_009419 3300042146 Bacteria 1619
298 Ga0450908_019778 3300042184 Bacteria 1185
299 Ga0451577_0118764 3300042876 Bacteria 2368
300 Ga0451577_1701856 3300042876 Bacteria 555
301 Ga0466972_0567218 3300044658 Bacteria 536
302 Ga0453683_0050267 3300044673 Bacteria 2612
303 Ga0453683_0578861 3300044673 Bacteria 731
304 Ga0466961_0344900 3300044693 Bacteria 907
305 Ga0453684_0000204 3300044712 Bacteria 258105
306 Ga0453684_0001066 3300044712 Bacteria 87216
307 Ga0453684_0022894 3300044712 Bacteria 9243
308 Ga0453684_0030448 3300044712 Bacteria 7625
309 Ga0453684_0930890 3300044712 Bacteria 929
310 Ga0453684_0956144 3300044712 Bacteria 914
311 Ga0466957_0062005 3300044842 Bacteria 2296
312 Ga0466957_1013737 3300044842 Bacteria 597
313 Ga0466959_0202557 3300045049 Bacteria 1381
314 Ga0451576_0003457 3300045051 Bacteria 21664
315 Ga0451576_0358653 3300045051 Bacteria 1526
316 Ga0451576_0752603 3300045051 Bacteria 1023
317 Ga0451576_0839385 3300045051 Bacteria 964
318 Ga0451576_1873187 3300045051 Bacteria 619
319 Ga0466958_0000676 3300045836 Bacteria 14782
320 Ga0495594_0483805 3300046499 Bacteria 703
321 Ga0495606_0197832 3300046507 Bacteria 1148
322 Ga0495610_0066434 3300046512 Bacteria 1698
323 Ga0495622_0087863 3300046557 Bacteria 1429
324 Ga0495625_0166930 3300046660 Bacteria 1471
325 Ga0495625_0343774 3300046660 Bacteria 945
326 Ga0495623_0334838 3300046679 Bacteria 828
327 Ga0495624_0727785 3300046690 Bacteria 588
328 Ga0495649_0319965 3300046694 Bacteria 787
329 Ga0495686_0059571 3300047472 Bacteria 2376
330 Ga0496100_1614277 3300048903 Bacteria 512
331 Ga0496104_1013010 3300048907 Bacteria 734
332 Ga0496106_0952045 3300048909 Bacteria 677
333 Ga0496106_1090991 3300048909 Bacteria 626
334 Ga0496107_1087397 3300048910 Bacteria 578
335 Ga0496108_0580953 3300048911 Bacteria 977
336 Ga0496114_1539070 3300048917 Bacteria 553
337 Ga0496115_0689753 3300048918 Bacteria 804
338 Ga0496126_0159669 3300048929 Bacteria 1927
339 Ga0496126_0187059 3300048929 Bacteria 1756
340 Ga0496126_1083858 3300048929 Bacteria 596
341 Ga0495682_0048305 3300049460 Bacteria 1552
342 Ga0501290_038837 3300049513 Bacteria 707
343 Ga0501318_006274 3300049534 Bacteria 1209
344 Ga0501318_012072 3300049534 Bacteria 985
345 Ga0501321_020519 3300049537 Bacteria 818
346 Ga0501031_0504443 3300049568 Bacteria 780
347 Ga0501032_0002699 3300049569 Bacteria 13837
348 Ga0501033_0001070 3300049570 Bacteria 24898
349 Ga0501033_0296387 3300049570 Bacteria 1139
350 Ga0501034_0018340 3300049571 Bacteria 7178
351 Ga0501034_0118633 3300049571 Bacteria 2633
352 Ga0501036_0002486 3300049572 Bacteria 14452
353 Ga0501036_0075252 3300049572 Bacteria 2856
354 Ga0501036_0165236 3300049572 Bacteria 1866
355 Ga0501037_0018944 3300049573 Bacteria 5074
356 Ga0501037_0069590 3300049573 Bacteria 2562
357 Ga0501038_0003703 3300049574 Bacteria 14244
358 Ga0501038_0341845 3300049574 Bacteria 1167
359 Ga0501039_0001114 3300049575 Bacteria 19752
360 Ga0501039_1127293 3300049575 Bacteria 608
361 Ga0501040_0060953 3300049576 Bacteria 2594
362 Ga0501041_0065309 3300049577 Bacteria 2229
363 Ga0501041_0218969 3300049577 Bacteria 1195
364 Ga0501041_0243462 3300049577 Bacteria 1130
365 Ga0501042_0180044 3300049578 Bacteria 1525
366 Ga0501043_0003581 3300049579 Bacteria 12750
367 Ga0501043_0037779 3300049579 Bacteria 3798
368 Ga0501043_0163336 3300049579 Bacteria 1740
369 Ga0501043_0190651 3300049579 Bacteria 1594
370 Ga0501043_0564648 3300049579 Bacteria 844
371 Ga0501046_0004973 3300049580 Bacteria 11929
372 Ga0501046_0197393 3300049580 Bacteria 1498
373 Ga0501046_1185093 3300049580 Bacteria 525
374 Ga0501047_0016963 3300049581 Bacteria 6962
375 Ga0501047_0023157 3300049581 Bacteria 5962
376 Ga0501047_0432333 3300049581 Bacteria 1147
377 Ga0501048_0074223 3300049582 Bacteria 2400
378 Ga0501048_0329869 3300049582 Bacteria 1087
379 Ga0501067_0016218 3300049583 Bacteria 4117
380 Ga0501067_0117845 3300049583 Bacteria 1477
381 Ga0501068_0052382 3300049584 Bacteria 2469
382 Ga0501068_0990365 3300049584 Bacteria 554
383 Ga0501069_0000390 3300049585 Bacteria 19839
384 Ga0501069_0054767 3300049585 Bacteria 2221
385 Ga0501069_0634014 3300049585 Bacteria 643
386 Ga0501070_0003931 3300049586 Bacteria 12809
387 Ga0501070_0089453 3300049586 Bacteria 2548
388 Ga0501070_0842277 3300049586 Bacteria 718
389 Ga0501071_0032674 3300049587 Bacteria 3696
390 Ga0501071_0573039 3300049587 Bacteria 867
391 Ga0501071_0658251 3300049587 Bacteria 806
392 Ga0501072_0144592 3300049588 Bacteria 1896
393 Ga0501073_0000690 3300049589 Bacteria 23740
394 Ga0501073_0047213 3300049589 Bacteria 3026
395 Ga0501073_0147178 3300049589 Bacteria 1632
396 Ga0501073_0292240 3300049589 Bacteria 1124
397 Ga0501073_0454131 3300049589 Bacteria 886
398 Ga0501074_0003587 3300049590 Bacteria 11013
399 Ga0501074_1323036 3300049590 Bacteria 505
400 Ga0501075_0145720 3300049591 Bacteria 1805
401 Ga0501076_0487961 3300049592 Bacteria 1015
402 Ga0501076_0976578 3300049592 Bacteria 698
403 Ga0501076_1200471 3300049592 Bacteria 624
404 Ga0501077_0087185 3300049593 Bacteria 1978
405 Ga0501077_0304882 3300049593 Bacteria 1015
406 Ga0501077_0377994 3300049593 Bacteria 905
407 Ga0501079_0186350 3300049741 Bacteria 1620
408 Ga0501080_0000697 3300049742 Bacteria 27008
409 Ga0501080_0009920 3300049742 Bacteria 8701
410 Ga0501080_0016495 3300049742 Bacteria 6823
411 Ga0501080_0380139 3300049742 Bacteria 1272
412 Ga0501080_1007502 3300049742 Bacteria 722
413 Ga0501081_0040914 3300049743 Bacteria 3173
414 Ga0501083_0001821 3300049744 Bacteria 14622
415 Ga0501083_0007860 3300049744 Bacteria 7555
416 Ga0501083_0233222 3300049744 Bacteria 1199
417 Ga0501083_0326659 3300049744 Bacteria 997
418 Ga0501083_0896007 3300049744 Bacteria 577
419 Ga0501035_0001027 3300049822 Bacteria 29312
420 Ga0501035_1068240 3300049822 Bacteria 632
421 Ga0501044_0004947 3300049823 Bacteria 14904
422 Ga0501044_0038516 3300049823 Bacteria 4992
423 Ga0501044_0447466 3300049823 Bacteria 1199
424 Ga0501044_0457210 3300049823 Bacteria 1182
425 Ga0501044_0458110 3300049823 Bacteria 1181
426 Ga0501045_0037286 3300049824 Bacteria 3533
427 Ga0501045_0433176 3300049824 Bacteria 978
428 nmdc:mga03683_44605_c1 3300050489 Bacteria 1833
429 nmdc:mga03683_480348_c1 3300050489 Bacteria 600
430 nmdc:mga03n38_339485_c1 3300050490 Bacteria 815
431 nmdc:mga0k408_382088_c1 3300050493 Bacteria 839
432 nmdc:mga0k408_393378_c1 3300050493 Bacteria 825
433 nmdc:mga0k408_71743_c1 3300050493 Bacteria 2022
434 nmdc:mga07m45_374846_c1 3300050496 Bacteria 826
435 nmdc:mga07m45_700327_c1 3300050496 Bacteria 583
436 nmdc:mga05p37_1118418_c1 3300050507 Bacteria 823
437 nmdc:mga05p37_223422_c1 3300050507 Bacteria 2272
438 nmdc:mga05p37_65305_c1 3300050507 Bacteria 4477
439 nmdc:mga09592_363970_c1 3300050508 Bacteria 1251
440 nmdc:mga09592_506695_c1 3300050508 Bacteria 1039
441 nmdc:mga0qj67_287000_c1 3300050509 Bacteria 1334
442 nmdc:mga0qj67_4326_c1 3300050509 Bacteria 10284
443 nmdc:mga06r32_107761_c1 3300050510 Bacteria 2738
444 nmdc:mga06r32_66110_c1 3300050510 Bacteria 3489
445 nmdc:mga06r32_677322_c1 3300050510 Bacteria 998
446 nmdc:mga08y16_174347_c1 3300050511 Bacteria 2233
447 nmdc:mga08y16_205_c1 3300050511 Bacteria 53058
448 nmdc:mga0rr50_278190_c1 3300050513 Bacteria 1396
449 nmdc:mga08x19_48964_c1 3300050514 Bacteria 2709
450 Ga0500578_0371616 3300053086 Bacteria 831
451 Ga0500646_0060385 3300053090 Bacteria 1114
452 Ga0500647_0125582 3300053091 Bacteria 1212
453 Ga0500651_0002419 3300053093 Bacteria 9846
454 Ga0500566_0162343 3300053094 Bacteria 1163
455 Ga0500641_0000684 3300053096 Bacteria 12231
456 Ga0500650_0209686 3300053098 Bacteria 885
457 Ga0500555_032945 3300053103 Bacteria 1462
458 Ga0500556_0090524 3300053104 Bacteria 1168
459 Ga0500562_086456 3300053108 Bacteria 850
460 Ga0500594_0151411 3300053118 Bacteria 745
461 Ga0500595_000405 3300053119 Bacteria 27569
462 Ga0500614_294191 3300053123 Bacteria 509
463 Ga0500642_0158217 3300053130 Bacteria 1062
464 Ga0500658_0198219 3300053134 Bacteria 917
465 Ga0500658_0523160 3300053134 Bacteria 535
466 Ga0500568_0014297 3300053139 Bacteria 3588
467 Ga0500568_0067744 3300053139 Bacteria 1371
468 Ga0500577_0345843 3300053142 Bacteria 650
469 Ga0500588_0000252 3300053146 Bacteria 7705
470 Ga0500588_0351011 3300053146 Bacteria 560
471 Ga0500604_0005515 3300053151 Bacteria 3341
472 Ga0500616_0005115 3300053153 Bacteria 9037
473 Ga0500622_0125292 3300053156 Bacteria 1241
474 Ga0500634_0234067 3300053161 Bacteria 777
475 Ga0500576_202563 3300053725 Bacteria 673
476 Ga0500609_034659 3300053731 Bacteria 696
477 Ga0500599_005902 3300053736 Bacteria 1550
478 Ga0501084_0069429 3300054114 Bacteria 2950
479 Ga0501084_1342801 3300054114 Bacteria 599
480 Ga0590071_013268 3300059421 Bacteria 1928
481 Ga0590074_004867 3300059423 Bacteria 2216
482 Ga0590075_035702 3300059424 Bacteria 1266
483 Ga0590077_081540 3300059426 Bacteria 745
484 Ga0587084_017396 3300059477 Bacteria 1037
485 Ga0587088_062027 3300059508 Bacteria 760
486 Ga0587101_088031 3300059623 Bacteria 599
487 Ga0587117_041328 3300059627 Bacteria 735
488 Ga0587062_052224 3300059639 Bacteria 695
489 Ga0501082_0014871 3300060353 Bacteria 6703
490 Ga0501082_0028321 3300060353 Bacteria 4827
491 Ga0501082_0248258 3300060353 Bacteria 1549
492 Ga0501082_0494852 3300060353 Bacteria 1069
493 Ga0530510_0103131 3300061734 Bacteria 2086
494 Ga0530510_0276446 3300061734 Bacteria 1254
495 Ga0530510_0586416 3300061734 Bacteria 848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1050965 Ga0081540_10509654 127
2 3300005467 Ga0070706_100220450 Ga0070706_1002204501 132
3 3300009101 Ga0105247_10780966 Ga0105247_107809661 132
4 3300025910 Ga0207684_11286298 Ga0207684_112862981 132
5 3300044712 Ga0453684_0030448 Ga0453684_0030448_2231_2632 132
6 3300044712 Ga0453684_0022894 Ga0453684_0022894_4401_4805 133
7 3300045051 Ga0451576_1873187 Ga0451576_1873187_129_533 133
8 3300005445 Ga0070708_100208932 Ga0070708_1002089325 134
9 3300005471 Ga0070698_101201170 Ga0070698_1012011701 134
10 3300005518 Ga0070699_100778108 Ga0070699_1007781081 134
11 3300005563 Ga0068855_100116465 Ga0068855_1001164656 134
12 3300025949 Ga0207667_10122444 Ga0207667_101224442 134
13 3300039438 Ga0436360_0896911 Ga0436360_0896911_169_576 134
14 3300039438 Ga0436360_1294346 Ga0436360_1294346_150_557 134
15 3300039447 Ga0436361_0169334 Ga0436361_0169334_453_860 134
16 3300039447 Ga0436361_0909345 Ga0436361_0909345_696_1103 134
17 3300039447 Ga0436361_0974425 Ga0436361_0974425_188_595 134
18 3300041461 Ga0451805_068841 Ga0451805_068841_31_438 134
19 3300042001 Ga0439441_093753 Ga0439441_093753_179_586 134
20 3300044673 Ga0453683_0050267 Ga0453683_0050267_1769_2176 134
21 3300044673 Ga0453683_0578861 Ga0453683_0578861_79_486 134
22 3300044693 Ga0466961_0344900 Ga0466961_0344900_288_695 134
23 3300044712 Ga0453684_0930890 Ga0453684_0930890_84_491 134
24 3300044842 Ga0466957_0062005 Ga0466957_0062005_1026_1433 134
25 3300045051 Ga0451576_0003457 Ga0451576_0003457_427_834 134
26 3300045051 Ga0451576_0358653 Ga0451576_0358653_397_804 134
27 3300045051 Ga0451576_0839385 Ga0451576_0839385_69_476 134
28 3300045836 Ga0466958_0000676 Ga0466958_0000676_8481_8888 134
29 3300053151 Ga0500604_0005515 Ga0500604_0005515_1921_2331 134
30 3300005336 Ga0070680_101149451 Ga0070680_1011494511 135
31 3300005458 Ga0070681_10368944 Ga0070681_103689443 135
32 3300009545 Ga0105237_11801141 Ga0105237_118011411 135
33 3300009553 Ga0105249_10824341 Ga0105249_108243412 135
34 3300010375 Ga0105239_11499145 Ga0105239_114991451 135
35 3300013306 Ga0163162_10268205 Ga0163162_102682052 135
36 3300013308 Ga0157375_10751948 Ga0157375_107519482 135
37 3300014968 Ga0157379_10342094 Ga0157379_103420942 135
38 3300014969 Ga0157376_11106977 Ga0157376_111069772 135
39 3300031548 Ga0307408_100856198 Ga0307408_1008561981 135
40 3300032002 Ga0307416_100976792 Ga0307416_1009767922 135
41 3300037853 Ga0436364_0945697 Ga0436364_0945697_763_1173 135
42 3300037853 Ga0436364_1043967 Ga0436364_1043967_68_478 135
43 3300039437 Ga0436365_1582319 Ga0436365_1582319_29_439 135
44 3300039447 Ga0436361_0172899 Ga0436361_0172899_13173_13583 135
45 3300039447 Ga0436361_0450045 Ga0436361_0450045_361_771 135
46 3300039447 Ga0436361_0756213 Ga0436361_0756213_646_1056 135
47 3300041452 Ga0451793_0831431 Ga0451793_0831431_58_471 135
48 3300044712 Ga0453684_0956144 Ga0453684_0956144_292_702 135
49 3300045049 Ga0466959_0202557 Ga0466959_0202557_288_701 135
50 3300046507 Ga0495606_0197832 Ga0495606_0197832_648_1061 135
51 3300046660 Ga0495625_0166930 Ga0495625_0166930_724_1137 135
52 3300047472 Ga0495686_0059571 Ga0495686_0059571_1461_1874 135
53 3300048903 Ga0496100_1614277 Ga0496100_1614277_68_478 135
54 3300048929 Ga0496126_0187059 Ga0496126_0187059_11_427 135
55 3300049570 Ga0501033_0296387 Ga0501033_0296387_91_501 135
56 3300049571 Ga0501034_0118633 Ga0501034_0118633_1846_2259 135
57 3300049572 Ga0501036_0075252 Ga0501036_0075252_57_470 135
58 3300049573 Ga0501037_0069590 Ga0501037_0069590_1679_2092 135
59 3300049574 Ga0501038_0341845 Ga0501038_0341845_452_865 135
60 3300049575 Ga0501039_1127293 Ga0501039_1127293_29_442 135
61 3300049579 Ga0501043_0037779 Ga0501043_0037779_632_1045 135
62 3300049579 Ga0501043_0190651 Ga0501043_0190651_48_461 135
63 3300049580 Ga0501046_0197393 Ga0501046_0197393_1064_1477 135
64 3300049581 Ga0501047_0016963 Ga0501047_0016963_683_1096 135
65 3300049585 Ga0501069_0054767 Ga0501069_0054767_889_1302 135
66 3300049586 Ga0501070_0842277 Ga0501070_0842277_290_703 135
67 3300049587 Ga0501071_0573039 Ga0501071_0573039_112_525 135
68 3300049589 Ga0501073_0047213 Ga0501073_0047213_793_1206 135
69 3300049592 Ga0501076_1200471 Ga0501076_1200471_148_561 135
70 3300049741 Ga0501079_0186350 Ga0501079_0186350_476_889 135
71 3300049742 Ga0501080_0009920 Ga0501080_0009920_8184_8597 135
72 3300049742 Ga0501080_1007502 Ga0501080_1007502_219_629 135
73 3300049744 Ga0501083_0896007 Ga0501083_0896007_115_528 135
74 3300049823 Ga0501044_0038516 Ga0501044_0038516_491_904 135
75 3300049823 Ga0501044_0457210 Ga0501044_0457210_653_1066 135
76 3300050489 nmdc:mga03683_44605_c1 nmdc:mga03683_44605_c1_139_552 135
77 3300050496 nmdc:mga07m45_374846_c1 nmdc:mga07m45_374846_c1_221_634 135
78 3300050496 nmdc:mga07m45_700327_c1 nmdc:mga07m45_700327_c1_63_476 135
79 3300053086 Ga0500578_0371616 Ga0500578_0371616_285_698 135
80 3300053090 Ga0500646_0060385 Ga0500646_0060385_673_1086 135
81 3300053093 Ga0500651_0002419 Ga0500651_0002419_8694_9107 135
82 3300053094 Ga0500566_0162343 Ga0500566_0162343_414_827 135
83 3300053096 Ga0500641_0000684 Ga0500641_0000684_10762_11175 135
84 3300053098 Ga0500650_0209686 Ga0500650_0209686_104_517 135
85 3300053103 Ga0500555_032945 Ga0500555_032945_918_1331 135
86 3300053104 Ga0500556_0090524 Ga0500556_0090524_204_617 135
87 3300053108 Ga0500562_086456 Ga0500562_086456_68_481 135
88 3300053118 Ga0500594_0151411 Ga0500594_0151411_277_690 135
89 3300053119 Ga0500595_000405 Ga0500595_000405_11960_12373 135
90 3300053123 Ga0500614_294191 Ga0500614_294191_25_438 135
91 3300053130 Ga0500642_0158217 Ga0500642_0158217_374_787 135
92 3300053134 Ga0500658_0198219 Ga0500658_0198219_81_494 135
93 3300053134 Ga0500658_0523160 Ga0500658_0523160_42_455 135
94 3300053139 Ga0500568_0014297 Ga0500568_0014297_1410_1823 135
95 3300053142 Ga0500577_0345843 Ga0500577_0345843_29_442 135
96 3300053146 Ga0500588_0351011 Ga0500588_0351011_93_506 135
97 3300053153 Ga0500616_0005115 Ga0500616_0005115_8174_8587 135
98 3300053156 Ga0500622_0125292 Ga0500622_0125292_177_590 135
99 3300053161 Ga0500634_0234067 Ga0500634_0234067_246_659 135
100 3300053736 Ga0500599_005902 Ga0500599_005902_175_588 135
101 3300060353 Ga0501082_0028321 Ga0501082_0028321_4384_4797 135
102 iso_pu_bacteria 2842333319 2842335142 135
103 3300005937 Ga0081455_10329639 Ga0081455_103296392 136
104 3300009093 Ga0105240_10202070 Ga0105240_102020702 136
105 3300009093 Ga0105240_10578471 Ga0105240_105784712 136
106 3300009545 Ga0105237_10391861 Ga0105237_103918612 136
107 3300009545 Ga0105237_10468371 Ga0105237_104683712 136
108 3300009551 Ga0105238_10722873 Ga0105238_107228732 136
109 3300009551 Ga0105238_11304375 Ga0105238_113043752 136
110 3300012485 Ga0157325_1026219 Ga0157325_10262191 136
111 3300013308 Ga0157375_12366796 Ga0157375_123667961 136
112 3300021388 Ga0213875_10000643 Ga0213875_1000064310 136
113 3300035692 Ga0373935_0547579 Ga0373935_0547579_22_438 136
114 3300035695 Ga0373927_0457587 Ga0373927_0457587_350_766 136
115 3300037068 Ga0373925_0533009 Ga0373925_0533009_161_577 136
116 3300037312 Ga0395899_0922341 Ga0395899_0922341_30_443 136
117 3300037466 Ga0395898_0560078 Ga0395898_0560078_165_584 136
118 3300037853 Ga0436364_0752883 Ga0436364_0752883_27514_27927 136
119 3300038443 Ga0395901_0020718 Ga0395901_0020718_3190_3603 136
120 3300039437 Ga0436365_0449991 Ga0436365_0449991_169_585 136
121 3300039437 Ga0436365_0708355 Ga0436365_0708355_254_667 136
122 3300039437 Ga0436365_1458468 Ga0436365_1458468_481_894 136
123 3300042146 Ga0450907_009419 Ga0450907_009419_1056_1466 136
124 3300042184 Ga0450908_019778 Ga0450908_019778_477_887 136
125 3300042876 Ga0451577_1701856 Ga0451577_1701856_39_452 136
126 3300048929 Ga0496126_0159669 Ga0496126_0159669_910_1323 136
127 3300049534 Ga0501318_012072 Ga0501318_012072_501_911 136
128 3300049537 Ga0501321_020519 Ga0501321_020519_19_429 136
129 3300049580 Ga0501046_1185093 Ga0501046_1185093_78_491 136
130 3300049581 Ga0501047_0432333 Ga0501047_0432333_62_475 136
131 3300049583 Ga0501067_0117845 Ga0501067_0117845_298_717 136
132 3300049589 Ga0501073_0292240 Ga0501073_0292240_373_792 136
133 3300049589 Ga0501073_0454131 Ga0501073_0454131_128_541 136
134 3300049590 Ga0501074_1323036 Ga0501074_1323036_15_428 136
135 3300049592 Ga0501076_0487961 Ga0501076_0487961_209_628 136
136 3300049742 Ga0501080_0016495 Ga0501080_0016495_5585_6004 136
137 3300049744 Ga0501083_0007860 Ga0501083_0007860_6193_6612 136
138 3300053091 Ga0500647_0125582 Ga0500647_0125582_565_975 136
139 3300053146 Ga0500588_0000252 Ga0500588_0000252_232_642 136
140 3300053725 Ga0500576_202563 Ga0500576_202563_33_443 136
141 3300053731 Ga0500609_034659 Ga0500609_034659_28_438 136
142 3300054114 Ga0501084_1342801 Ga0501084_1342801_84_503 136
143 3300060353 Ga0501082_0248258 Ga0501082_0248258_90_509 136
144 iso_pu_bacteria 2524023250 2524609958 136
145 iso_pu_bacteria 2597490356 2599101507 136
146 iso_pu_bacteria 2844533157 2844539291 136
147 iso_pu_bacteria 2846952575 2846953769 136
148 iso_pu_bacteria 2848858292 2848860047 136
149 iso_pu_bacteria 2883291878 2883294812 136
150 3300021441 Ga0213871_10153487 Ga0213871_101534871 137
151 3300031251 Ga0265327_10263838 Ga0265327_102638382 137
152 3300032126 Ga0307415_100310803 Ga0307415_1003108033 137
153 3300039438 Ga0436360_0125274 Ga0436360_0125274_322_738 137
154 3300005336 Ga0070680_100516138 Ga0070680_1005161382 138
155 3300005336 Ga0070680_100598157 Ga0070680_1005981572 138
156 3300005353 Ga0070669_100011674 Ga0070669_1000116742 138
157 3300005436 Ga0070713_101593839 Ga0070713_1015938391 138
158 3300005441 Ga0070700_100217372 Ga0070700_1002173721 138
159 3300005458 Ga0070681_10073194 Ga0070681_100731944 138
160 3300005530 Ga0070679_100234395 Ga0070679_1002343952 138
161 3300005546 Ga0070696_100007402 Ga0070696_1000074026 138
162 3300005614 Ga0068856_100337891 Ga0068856_1003378912 138
163 3300005719 Ga0068861_100005050 Ga0068861_10000505011 138
164 3300005840 Ga0068870_10507843 Ga0068870_105078432 138
165 3300006058 Ga0075432_10293152 Ga0075432_102931521 138
166 3300006353 Ga0075370_10100739 Ga0075370_101007392 138
167 3300006844 Ga0075428_102028851 Ga0075428_1020288511 138
168 3300006847 Ga0075431_100729227 Ga0075431_1007292271 138
169 3300009093 Ga0105240_10000330 Ga0105240_1000033070 138
170 3300009094 Ga0111539_10007165 Ga0111539_100071657 138
171 3300009094 Ga0111539_10248012 Ga0111539_102480122 138
172 3300009147 Ga0114129_10197683 Ga0114129_101976832 138
173 3300009147 Ga0114129_11712501 Ga0114129_117125011 138
174 3300009148 Ga0105243_11933974 Ga0105243_119339741 138
175 3300009174 Ga0105241_10602959 Ga0105241_106029591 138
176 3300009174 Ga0105241_11089783 Ga0105241_110897831 138
177 3300009176 Ga0105242_10581614 Ga0105242_105816141 138
178 3300009553 Ga0105249_10118985 Ga0105249_101189852 138
179 3300009987 Ga0105030_117612 Ga0105030_1176121 138
180 3300013100 Ga0157373_10942077 Ga0157373_109420771 138
181 3300013306 Ga0163162_10248782 Ga0163162_102487822 138
182 3300014325 Ga0163163_10168840 Ga0163163_101688402 138
183 3300014326 Ga0157380_10070603 Ga0157380_100706032 138
184 3300021361 Ga0213872_10024586 Ga0213872_100245863 138
185 3300021361 Ga0213872_10120550 Ga0213872_101205501 138
186 3300021361 Ga0213872_10290718 Ga0213872_102907182 138
187 3300025912 Ga0207707_10014060 Ga0207707_100140603 138
188 3300025913 Ga0207695_10002225 Ga0207695_1000222533 138
189 3300025923 Ga0207681_11273916 Ga0207681_112739161 138
190 3300025937 Ga0207669_10140105 Ga0207669_101401052 138
191 3300025949 Ga0207667_11356731 Ga0207667_113567312 138
192 3300025961 Ga0207712_10120753 Ga0207712_101207532 138
193 3300026075 Ga0207708_10106771 Ga0207708_101067712 138
194 3300026078 Ga0207702_11313614 Ga0207702_113136142 138
195 3300026118 Ga0207675_100020948 Ga0207675_1000209486 138
196 3300027907 Ga0207428_10000169 Ga0207428_1000016962 138
197 3300027907 Ga0207428_10521386 Ga0207428_105213862 138
198 3300031250 Ga0265331_10143233 Ga0265331_101432332 138
199 3300031548 Ga0307408_100976525 Ga0307408_1009765252 138
200 3300031595 Ga0265313_10000458 Ga0265313_1000045828 138
201 3300031711 Ga0265314_10450611 Ga0265314_104506111 138
202 3300031730 Ga0307516_10528182 Ga0307516_105281821 138
203 3300031824 Ga0307413_10359822 Ga0307413_103598222 138
204 3300031995 Ga0307409_100054853 Ga0307409_1000548531 138
205 3300032002 Ga0307416_100560821 Ga0307416_1005608212 138
206 3300037466 Ga0395898_0640130 Ga0395898_0640130_321_752 138
207 3300039438 Ga0436360_0906696 Ga0436360_0906696_75_494 138
208 3300039447 Ga0436361_0026958 Ga0436361_0026958_931_1350 138
209 3300049513 Ga0501290_038837 Ga0501290_038837_272_694 138
210 3300049579 Ga0501043_0564648 Ga0501043_0564648_58_558 138
211 3300049585 Ga0501069_0634014 Ga0501069_0634014_18_449 138
212 3300049593 Ga0501077_0377994 Ga0501077_0377994_295_720 138
213 3300049744 Ga0501083_0233222 Ga0501083_0233222_203_628 138
214 3300049822 Ga0501035_1068240 Ga0501035_1068240_45_467 138
215 3300050493 nmdc:mga0k408_393378_c1 nmdc:mga0k408_393378_c1_18_455 138
216 3300050493 nmdc:mga0k408_71743_c1 nmdc:mga0k408_71743_c1_16_447 138
217 3300050507 nmdc:mga05p37_1118418_c1 nmdc:mga05p37_1118418_c1_199_636 138
218 3300050507 nmdc:mga05p37_223422_c1 nmdc:mga05p37_223422_c1_518_949 138
219 3300050510 nmdc:mga06r32_677322_c1 nmdc:mga06r32_677322_c1_180_611 138
220 3300050511 nmdc:mga08y16_205_c1 nmdc:mga08y16_205_c1_14368_14805 138
221 3300059421 Ga0590071_013268 Ga0590071_013268_1429_1863 138
222 3300059426 Ga0590077_081540 Ga0590077_081540_93_527 138
223 3300003215 JGI25153J46596_10000255 JGI25153J46596_1000025538 139
224 3300003791 Ga0055530_10051239 Ga0055530_100512392 139
225 3300003794 Ga0055531_10020097 Ga0055531_100200972 139
226 3300005458 Ga0070681_10416850 Ga0070681_104168501 139
227 3300005458 Ga0070681_10863369 Ga0070681_108633692 139
228 3300005536 Ga0070697_101401107 Ga0070697_1014011071 139
229 3300005614 Ga0068856_100637922 Ga0068856_1006379222 139
230 3300005981 Ga0081538_10001852 Ga0081538_100018527 139
231 3300005983 Ga0081540_1194183 Ga0081540_11941832 139
232 3300005983 Ga0081540_1228746 Ga0081540_12287461 139
233 3300006177 Ga0075362_10158567 Ga0075362_101585672 139
234 3300006177 Ga0075362_10531063 Ga0075362_105310631 139
235 3300006195 Ga0075366_10159910 Ga0075366_101599101 139
236 3300006195 Ga0075366_10183136 Ga0075366_101831361 139
237 3300006195 Ga0075366_10217961 Ga0075366_102179612 139
238 3300006353 Ga0075370_10547757 Ga0075370_105477571 139
239 3300006844 Ga0075428_101010063 Ga0075428_1010100632 139
240 3300006846 Ga0075430_100020125 Ga0075430_1000201255 139
241 3300006847 Ga0075431_100016870 Ga0075431_1000168709 139
242 3300006847 Ga0075431_100055348 Ga0075431_1000553482 139
243 3300006880 Ga0075429_100160321 Ga0075429_1001603213 139
244 3300006880 Ga0075429_100427658 Ga0075429_1004276582 139
245 3300009094 Ga0111539_10096527 Ga0111539_100965274 139
246 3300009101 Ga0105247_10115173 Ga0105247_101151732 139
247 3300009147 Ga0114129_10483733 Ga0114129_104837332 139
248 3300009993 Ga0105028_104464 Ga0105028_1044642 139
249 3300021361 Ga0213872_10004734 Ga0213872_100047342 139
250 3300021388 Ga0213875_10097928 Ga0213875_100979283 139
251 3300021441 Ga0213871_10029821 Ga0213871_100298211 139
252 3300025254 Ga0209148_1002262 Ga0209148_10022623 139
253 3300025272 Ga0209455_1000393 Ga0209455_100039339 139
254 3300025297 Ga0209758_1000118 Ga0209758_1000118175 139
255 3300025297 Ga0209758_1015902 Ga0209758_10159023 139
256 3300025298 Ga0209050_1008047 Ga0209050_10080475 139
257 3300025304 Ga0209257_1000733 Ga0209257_100073343 139
258 3300025900 Ga0207710_10066583 Ga0207710_100665831 139
259 3300025912 Ga0207707_10675970 Ga0207707_106759702 139
260 3300025912 Ga0207707_11247254 Ga0207707_112472541 139
261 3300025913 Ga0207695_10499166 Ga0207695_104991662 139
262 3300025917 Ga0207660_11012162 Ga0207660_110121621 139
263 3300025923 Ga0207681_11156108 Ga0207681_111561081 139
264 3300025941 Ga0207711_10504667 Ga0207711_105046672 139
265 3300026023 Ga0207677_10985845 Ga0207677_109858452 139
266 3300027907 Ga0207428_10138771 Ga0207428_101387712 139
267 3300028379 Ga0268266_12208678 Ga0268266_122086781 139
268 3300028380 Ga0268265_10007117 Ga0268265_100071175 139
269 3300028380 Ga0268265_10007119 Ga0268265_100071197 139
270 3300031240 Ga0265320_10011539 Ga0265320_100115393 139
271 3300031250 Ga0265331_10481555 Ga0265331_104815551 139
272 3300031456 Ga0307513_10226844 Ga0307513_102268441 139
273 3300031456 Ga0307513_10724916 Ga0307513_107249161 139
274 3300031616 Ga0307508_10033438 Ga0307508_100334385 139
275 3300031711 Ga0265314_10014121 Ga0265314_100141215 139
276 3300031711 Ga0265314_10599167 Ga0265314_105991671 139
277 3300031852 Ga0307410_10282419 Ga0307410_102824191 139
278 3300031903 Ga0307407_10388292 Ga0307407_103882921 139
279 3300031995 Ga0307409_100037100 Ga0307409_1000371003 139
280 3300032005 Ga0307411_10196125 Ga0307411_101961252 139
281 3300033180 Ga0307510_10534012 Ga0307510_105340121 139
282 3300037466 Ga0395898_0245071 Ga0395898_0245071_1077_1499 139
283 3300037466 Ga0395898_0614879 Ga0395898_0614879_505_933 139
284 3300037853 Ga0436364_0616684 Ga0436364_0616684_10434_10856 139
285 3300038443 Ga0395901_0399437 Ga0395901_0399437_244_666 139
286 3300039438 Ga0436360_0897153 Ga0436360_0897153_132_554 139
287 3300042876 Ga0451577_0118764 Ga0451577_0118764_1653_2072 139
288 3300044712 Ga0453684_0000204 Ga0453684_0000204_13837_14256 139
289 3300044712 Ga0453684_0001066 Ga0453684_0001066_13842_14261 139
290 3300044842 Ga0466957_1013737 Ga0466957_1013737_146_571 139
291 3300045051 Ga0451576_0752603 Ga0451576_0752603_264_698 139
292 3300046557 Ga0495622_0087863 Ga0495622_0087863_706_1128 139
293 3300049569 Ga0501032_0002699 Ga0501032_0002699_5778_6203 139
294 3300049570 Ga0501033_0001070 Ga0501033_0001070_21998_22423 139
295 3300049571 Ga0501034_0018340 Ga0501034_0018340_1882_2307 139
296 3300049572 Ga0501036_0002486 Ga0501036_0002486_1570_1995 139
297 3300049573 Ga0501037_0018944 Ga0501037_0018944_1705_2130 139
298 3300049574 Ga0501038_0003703 Ga0501038_0003703_1546_1971 139
299 3300049575 Ga0501039_0001114 Ga0501039_0001114_8884_9309 139
300 3300049576 Ga0501040_0060953 Ga0501040_0060953_285_716 139
301 3300049577 Ga0501041_0065309 Ga0501041_0065309_1478_1909 139
302 3300049578 Ga0501042_0180044 Ga0501042_0180044_380_811 139
303 3300049579 Ga0501043_0003581 Ga0501043_0003581_6317_6742 139
304 3300049579 Ga0501043_0163336 Ga0501043_0163336_681_1112 139
305 3300049580 Ga0501046_0004973 Ga0501046_0004973_5195_5620 139
306 3300049581 Ga0501047_0023157 Ga0501047_0023157_666_1091 139
307 3300049582 Ga0501048_0074223 Ga0501048_0074223_442_867 139
308 3300049583 Ga0501067_0016218 Ga0501067_0016218_2046_2471 139
309 3300049584 Ga0501068_0052382 Ga0501068_0052382_1335_1760 139
310 3300049584 Ga0501068_0990365 Ga0501068_0990365_32_463 139
311 3300049585 Ga0501069_0000390 Ga0501069_0000390_6618_7043 139
312 3300049586 Ga0501070_0003931 Ga0501070_0003931_8681_9106 139
313 3300049587 Ga0501071_0032674 Ga0501071_0032674_1935_2366 139
314 3300049588 Ga0501072_0144592 Ga0501072_0144592_1395_1826 139
315 3300049589 Ga0501073_0000690 Ga0501073_0000690_5656_6081 139
316 3300049590 Ga0501074_0003587 Ga0501074_0003587_141_566 139
317 3300049591 Ga0501075_0145720 Ga0501075_0145720_1058_1489 139
318 3300049592 Ga0501076_0976578 Ga0501076_0976578_37_471 139
319 3300049593 Ga0501077_0087185 Ga0501077_0087185_203_634 139
320 3300049593 Ga0501077_0304882 Ga0501077_0304882_286_711 139
321 3300049742 Ga0501080_0000697 Ga0501080_0000697_12470_12895 139
322 3300049743 Ga0501081_0040914 Ga0501081_0040914_542_973 139
323 3300049744 Ga0501083_0001821 Ga0501083_0001821_7688_8113 139
324 3300049822 Ga0501035_0001027 Ga0501035_0001027_9674_10099 139
325 3300049823 Ga0501044_0004947 Ga0501044_0004947_2010_2435 139
326 3300049823 Ga0501044_0447466 Ga0501044_0447466_346_771 139
327 3300049824 Ga0501045_0037286 Ga0501045_0037286_585_1016 139
328 3300050489 nmdc:mga03683_480348_c1 nmdc:mga03683_480348_c1_59_493 139
329 3300050490 nmdc:mga03n38_339485_c1 nmdc:mga03n38_339485_c1_129_563 139
330 3300050493 nmdc:mga0k408_382088_c1 nmdc:mga0k408_382088_c1_129_563 139
331 3300050507 nmdc:mga05p37_65305_c1 nmdc:mga05p37_65305_c1_2774_3193 139
332 3300050508 nmdc:mga09592_363970_c1 nmdc:mga09592_363970_c1_139_558 139
333 3300050508 nmdc:mga09592_506695_c1 nmdc:mga09592_506695_c1_450_869 139
334 3300050509 nmdc:mga0qj67_287000_c1 nmdc:mga0qj67_287000_c1_656_1090 139
335 3300050509 nmdc:mga0qj67_4326_c1 nmdc:mga0qj67_4326_c1_2931_3350 139
336 3300050510 nmdc:mga06r32_107761_c1 nmdc:mga06r32_107761_c1_1704_2123 139
337 3300050510 nmdc:mga06r32_66110_c1 nmdc:mga06r32_66110_c1_162_581 139
338 3300050511 nmdc:mga08y16_174347_c1 nmdc:mga08y16_174347_c1_1099_1518 139
339 3300054114 Ga0501084_0069429 Ga0501084_0069429_1919_2344 139
340 3300059423 Ga0590074_004867 Ga0590074_004867_1099_1533 139
341 3300059424 Ga0590075_035702 Ga0590075_035702_16_450 139
342 3300060353 Ga0501082_0014871 Ga0501082_0014871_4776_5201 139
343 3300061734 Ga0530510_0103131 Ga0530510_0103131_1415_1846 139
344 3300003163 Ga0006759J45824_1022824 Ga0006759J45824_10228243 140
345 3300003215 JGI25153J46596_10048865 JGI25153J46596_100488652 140
346 3300003308 Ga0006777J48905_1011379 Ga0006777J48905_10113795 140
347 3300003574 Ga0007410J51695_1024477 Ga0007410J51695_10244771 140
348 3300003574 Ga0007410J51695_1031739 Ga0007410J51695_10317391 140
349 3300003575 Ga0007409J51694_1035704 Ga0007409J51694_10357042 140
350 3300003579 Ga0007429J51699_1023684 Ga0007429J51699_10236842 140
351 3300003693 Ga0032354_1029473 Ga0032354_10294732 140
352 3300003693 Ga0032354_1035534 Ga0032354_10355342 140
353 3300005354 Ga0070675_100711169 Ga0070675_1007111691 140
354 3300005435 Ga0070714_100121168 Ga0070714_1001211681 140
355 3300005435 Ga0070714_100189401 Ga0070714_1001894011 140
356 3300005435 Ga0070714_101667332 Ga0070714_1016673321 140
357 3300005436 Ga0070713_100022836 Ga0070713_1000228362 140
358 3300005439 Ga0070711_100255823 Ga0070711_1002558232 140
359 3300005467 Ga0070706_100322535 Ga0070706_1003225352 140
360 3300005468 Ga0070707_100040754 Ga0070707_1000407546 140
361 3300005471 Ga0070698_100183441 Ga0070698_1001834412 140
362 3300005530 Ga0070679_100757703 Ga0070679_1007577032 140
363 3300005536 Ga0070697_100141639 Ga0070697_1001416391 140
364 3300005536 Ga0070697_100157350 Ga0070697_1001573502 140
365 3300005539 Ga0068853_100202687 Ga0068853_1002026872 140
366 3300005545 Ga0070695_100299912 Ga0070695_1002999122 140
367 3300005548 Ga0070665_100004437 Ga0070665_10000443712 140
368 3300005563 Ga0068855_100534514 Ga0068855_1005345142 140
369 3300005564 Ga0070664_100592002 Ga0070664_1005920021 140
370 3300005614 Ga0068856_100152105 Ga0068856_1001521053 140
371 3300005614 Ga0068856_100598529 Ga0068856_1005985292 140
372 3300005842 Ga0068858_101924070 Ga0068858_1019240701 140
373 3300005937 Ga0081455_10242929 Ga0081455_102429291 140
374 3300006028 Ga0070717_10695835 Ga0070717_106958352 140
375 3300006163 Ga0070715_10218359 Ga0070715_102183592 140
376 3300006173 Ga0070716_100222639 Ga0070716_1002226392 140
377 3300006175 Ga0070712_100262779 Ga0070712_1002627792 140
378 3300006175 Ga0070712_100297790 Ga0070712_1002977902 140
379 3300006844 Ga0075428_101551935 Ga0075428_1015519352 140
380 3300006847 Ga0075431_101478209 Ga0075431_1014782091 140
381 3300006914 Ga0075436_100214036 Ga0075436_1002140362 140
382 3300007076 Ga0075435_100283784 Ga0075435_1002837843 140
383 3300007788 Ga0099795_10048274 Ga0099795_100482744 140
384 3300009093 Ga0105240_10974630 Ga0105240_109746302 140
385 3300009551 Ga0105238_10201271 Ga0105238_102012712 140
386 3300009553 Ga0105249_12095076 Ga0105249_120950761 140
387 3300010159 Ga0099796_10085683 Ga0099796_100856833 140
388 3300013104 Ga0157370_10892164 Ga0157370_108921641 140
389 3300014325 Ga0163163_10556632 Ga0163163_105566322 140
390 3300019182 Ga0184598_104859 Ga0184598_1048591 140
391 3300019188 Ga0184599_100208 Ga0184599_1002082 140
392 3300019190 Ga0184600_125891 Ga0184600_1258912 140
393 3300019192 Ga0184603_144702 Ga0184603_1447022 140
394 3300021384 Ga0213876_10058902 Ga0213876_100589023 140
395 3300021384 Ga0213876_10064483 Ga0213876_100644833 140
396 3300023536 Ga0247552_100593 Ga0247552_1005932 140
397 3300023539 Ga0247555_100249 Ga0247555_1002492 140
398 3300023547 Ga0247554_103360 Ga0247554_1033602 140
399 3300023552 Ga0247551_101611 Ga0247551_1016111 140
400 3300023672 Ga0247553_100740 Ga0247553_1007402 140
401 3300025294 Ga0209025_1000053 Ga0209025_1000053203 140
402 3300025297 Ga0209758_1011868 Ga0209758_10118684 140
403 3300025893 Ga0207682_10000101 Ga0207682_1000010123 140
404 3300025906 Ga0207699_10050521 Ga0207699_100505215 140
405 3300025913 Ga0207695_10106398 Ga0207695_101063984 140
406 3300025913 Ga0207695_10127661 Ga0207695_101276612 140
407 3300025914 Ga0207671_10305583 Ga0207671_103055832 140
408 3300025915 Ga0207693_10050235 Ga0207693_100502353 140
409 3300025921 Ga0207652_10112074 Ga0207652_101120741 140
410 3300025922 Ga0207646_10326875 Ga0207646_103268753 140
411 3300025922 Ga0207646_11944794 Ga0207646_119447941 140
412 3300025924 Ga0207694_10006922 Ga0207694_1000692214 140
413 3300025924 Ga0207694_10191216 Ga0207694_101912162 140
414 3300025928 Ga0207700_10015558 Ga0207700_100155581 140
415 3300025928 Ga0207700_10171778 Ga0207700_101717781 140
416 3300025928 Ga0207700_10612950 Ga0207700_106129502 140
417 3300025929 Ga0207664_10081920 Ga0207664_100819201 140
418 3300025929 Ga0207664_10204430 Ga0207664_102044301 140
419 3300025929 Ga0207664_10298500 Ga0207664_102985001 140
420 3300025931 Ga0207644_11343508 Ga0207644_113435081 140
421 3300025939 Ga0207665_10042330 Ga0207665_100423302 140
422 3300025939 Ga0207665_10131283 Ga0207665_101312833 140
423 3300025944 Ga0207661_10912805 Ga0207661_109128051 140
424 3300025949 Ga0207667_10056460 Ga0207667_100564606 140
425 3300025949 Ga0207667_10660758 Ga0207667_106607581 140
426 3300025972 Ga0207668_12034764 Ga0207668_120347641 140
427 3300026041 Ga0207639_10394911 Ga0207639_103949112 140
428 3300026041 Ga0207639_11446743 Ga0207639_114467431 140
429 3300026078 Ga0207702_10057067 Ga0207702_100570671 140
430 3300026078 Ga0207702_10103261 Ga0207702_101032612 140
431 3300028379 Ga0268266_10005613 Ga0268266_100056134 140
432 3300028800 Ga0265338_11004126 Ga0265338_110041261 140
433 3300031247 Ga0265340_10186540 Ga0265340_101865402 140
434 3300031249 Ga0265339_10050345 Ga0265339_100503452 140
435 3300031250 Ga0265331_10002468 Ga0265331_1000246810 140
436 3300031251 Ga0265327_10013369 Ga0265327_100133692 140
437 3300031548 Ga0307408_100228483 Ga0307408_1002284832 140
438 3300031595 Ga0265313_10003739 Ga0265313_100037393 140
439 3300031711 Ga0265314_10070462 Ga0265314_100704622 140
440 3300031711 Ga0265314_10231278 Ga0265314_102312782 140
441 3300031824 Ga0307413_11256741 Ga0307413_112567411 140
442 3300031903 Ga0307407_11099688 Ga0307407_110996881 140
443 3300031995 Ga0307409_101008971 Ga0307409_1010089712 140
444 3300032005 Ga0307411_11153964 Ga0307411_111539641 140
445 3300032120 Ga0316053_100571 Ga0316053_1005712 140
446 3300032126 Ga0307415_100722362 Ga0307415_1007223621 140
447 3300035083 Ga0373926_0022634 Ga0373926_0022634_1416_1841 140
448 3300035083 Ga0373926_0347509 Ga0373926_0347509_42_476 140
449 3300035111 Ga0373923_0125242 Ga0373923_0125242_330_764 140
450 3300035116 Ga0373945_0583218 Ga0373945_0583218_52_486 140
451 3300035398 Ga0316574_0213182 Ga0316574_0213182_360_782 140
452 3300035410 Ga0373924_0167171 Ga0373924_0167171_43_477 140
453 3300035692 Ga0373935_0011852 Ga0373935_0011852_4336_4761 140
454 3300035692 Ga0373935_0144144 Ga0373935_0144144_1102_1536 140
455 3300035695 Ga0373927_0602827 Ga0373927_0602827_47_481 140
456 3300035724 Ga0373933_0135613 Ga0373933_0135613_788_1222 140
457 3300036401 Ga0373937_0034479 Ga0373937_0034479_1224_1658 140
458 3300036401 Ga0373937_0187720 Ga0373937_0187720_431_865 140
459 3300037068 Ga0373925_0972163 Ga0373925_0972163_58_483 140
460 3300039437 Ga0436365_0657275 Ga0436365_0657275_1870_2295 140
461 3300039437 Ga0436365_1163211 Ga0436365_1163211_760_1185 140
462 3300041997 Ga0439431_0200582 Ga0439431_0200582_56_496 140
463 3300044658 Ga0466972_0567218 Ga0466972_0567218_67_492 140
464 3300046499 Ga0495594_0483805 Ga0495594_0483805_183_608 140
465 3300046512 Ga0495610_0066434 Ga0495610_0066434_636_1076 140
466 3300046660 Ga0495625_0343774 Ga0495625_0343774_375_815 140
467 3300046679 Ga0495623_0334838 Ga0495623_0334838_229_663 140
468 3300046690 Ga0495624_0727785 Ga0495624_0727785_116_550 140
469 3300046694 Ga0495649_0319965 Ga0495649_0319965_222_662 140
470 3300048907 Ga0496104_1013010 Ga0496104_1013010_113_547 140
471 3300048909 Ga0496106_0952045 Ga0496106_0952045_46_471 140
472 3300048909 Ga0496106_1090991 Ga0496106_1090991_141_575 140
473 3300048910 Ga0496107_1087397 Ga0496107_1087397_71_496 140
474 3300048911 Ga0496108_0580953 Ga0496108_0580953_37_462 140
475 3300048917 Ga0496114_1539070 Ga0496114_1539070_22_456 140
476 3300048918 Ga0496115_0689753 Ga0496115_0689753_210_644 140
477 3300048929 Ga0496126_1083858 Ga0496126_1083858_88_522 140
478 3300049460 Ga0495682_0048305 Ga0495682_0048305_630_1070 140
479 3300049534 Ga0501318_006274 Ga0501318_006274_20_451 140
480 3300049568 Ga0501031_0504443 Ga0501031_0504443_135_563 140
481 3300049572 Ga0501036_0165236 Ga0501036_0165236_431_859 140
482 3300049577 Ga0501041_0218969 Ga0501041_0218969_632_1072 140
483 3300049577 Ga0501041_0243462 Ga0501041_0243462_637_1065 140
484 3300049582 Ga0501048_0329869 Ga0501048_0329869_181_609 140
485 3300049586 Ga0501070_0089453 Ga0501070_0089453_601_1026 140
486 3300049587 Ga0501071_0658251 Ga0501071_0658251_189_617 140
487 3300049589 Ga0501073_0147178 Ga0501073_0147178_911_1336 140
488 3300049742 Ga0501080_0380139 Ga0501080_0380139_437_862 140
489 3300049744 Ga0501083_0326659 Ga0501083_0326659_209_634 140
490 3300049823 Ga0501044_0458110 Ga0501044_0458110_498_923 140
491 3300049824 Ga0501045_0433176 Ga0501045_0433176_227_655 140
492 3300050513 nmdc:mga0rr50_278190_c1 nmdc:mga0rr50_278190_c1_212_637 140
493 3300050514 nmdc:mga08x19_48964_c1 nmdc:mga08x19_48964_c1_2193_2618 140
494 3300053139 Ga0500568_0067744 Ga0500568_0067744_586_1026 140
495 3300059477 Ga0587084_017396 Ga0587084_017396_592_1017 140
496 3300059508 Ga0587088_062027 Ga0587088_062027_17_442 140
497 3300059623 Ga0587101_088031 Ga0587101_088031_72_497 140
498 3300059627 Ga0587117_041328 Ga0587117_041328_111_536 140
499 3300059639 Ga0587062_052224 Ga0587062_052224_249_674 140
500 3300060353 Ga0501082_0494852 Ga0501082_0494852_359_808 140
501 3300061734 Ga0530510_0276446 Ga0530510_0276446_243_671 140
502 3300061734 Ga0530510_0586416 Ga0530510_0586416_326_775 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.9644 14 117
7as8-assembly1.cif.gz_R bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9545 8 116
7qv3-assembly1.cif.gz_N bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9487 8 116
6yxx-assembly1.cif.gz_AR state a of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.9482 12 119
8a5i-assembly1.cif.gz_Q cryo-em structure of lincomycin bound to the listeria monocytogenes 50s ribosomal subunit. 0.9468 8 116
ID Description Score Start End Superfamily
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9666 13 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9582 13 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9576 13 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9493 13 115 3.90.1030.10
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9293 3 116 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A1F9ENG3-F1-model_v4 50S ribosomal protein L17 0.9997 20 114 GO:0003735
GO:0006412
GO:0022625
AF-A0A2W1B7V4-F1-model_v4 50S ribosomal protein L17 0.9967 20 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A1D7W1K6-F1-model_v4 50S ribosomal protein L17 0.9964 20 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A3B8UXI4-F1-model_v4 deleted 0.9958 22 117
AF-A0A7L5AGF4-F1-model_v4 50S ribosomal protein L17 0.9957 20 116 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.37 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map