F455952

General Info

Members Datasets Scaffolds Average Seq Length
503 360 1000 169

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1000025|JGI25154J39366_100002511
Length 197
Sequence MSEPFLAMLILFGGNFAIRGWAMAWGQILSIAQNTALFSLLGTTYGGNGQTTFALPDLRGRAPIGWGQGPGLSNYSLGQIGGTENTTLLITNMPAHNHTGVISGGTSTISASTGAGTTNTPGPTMVPAVLPTIGSGPGATQIKGYKVQDNTTTLAPGTVSGNVTIGIAGGSQPFSIQNPYLALTYLIALEGIFPSRN

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
180 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
282 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
298 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
299 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
304 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
305 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
306 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
317 2643221611 Acidovorax sp. Root219 Isolate Unclassified
318 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
319 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
320 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
321 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
322 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
323 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
324 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
325 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
326 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
327 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
328 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
329 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
330 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
331 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
332 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
333 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
334 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
335 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
336 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
337 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
338 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
339 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
340 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
341 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
342 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
343 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
344 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
345 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
346 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
347 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
348 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
349 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
350 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
351 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
352 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
353 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
354 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
355 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
356 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
357 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
358 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
359 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
360 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.87
Metatranscriptomes 1.99
Isolates 9.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 6.76
Rhizoplane 3.38
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000025 3300002738 Bacteria 211189
2 MRS1b_contig_3585791 2162886011 Bacteria 941
3 LJQas_1010480 3300000549 Bacteria 1110
4 JGI24736J21556_1021942 3300001904 Bacteria 1000
5 JGI24740J21852_10010677 3300001979 Bacteria 3525
6 JGI24743J22301_10069433 3300001991 Bacteria 734
7 JGI25156J39149_1008579 3300002705 Bacteria 2557
8 JGI25157J39369_1000700 3300002741 Bacteria 18085
9 JGI25157J39369_1002640 3300002741 Unclassified 4209
10 JGI25406J46586_10118235 3300003203 Bacteria 781
11 JGI25153J46596_10002276 3300003215 Bacteria 11185
12 rootH1_10041215 3300003323 Bacteria 2479
13 rootH1_10067345 3300003323 Bacteria 3056
14 rootH1_10303365 3300003323 Bacteria 2866
15 JGI25160J50197_1006075 3300003354 Bacteria 4929
16 Ga0055535_1001614 3300003761 Bacteria 10567
17 Ga0055542_1013046 3300003762 Bacteria 1413
18 Ga0058863_10026864 3300004799 Unclassified 965
19 Ga0065165_1013992 3300005262 Bacteria 3143
20 Ga0065714_10037453 3300005288 Bacteria 959
21 Ga0065714_10146305 3300005288 Bacteria 1136
22 Ga0065714_10153743 3300005288 Bacteria 1090
23 Ga0065704_10142336 3300005289 Bacteria 1459
24 Ga0065712_10080023 3300005290 Bacteria 3153
25 Ga0065712_10149860 3300005290 Bacteria 1378
26 Ga0070676_10243677 3300005328 Bacteria 1197
27 Ga0070690_100005999 3300005330 Bacteria 6863
28 Ga0070690_100051113 3300005330 Bacteria 2637
29 Ga0070670_100004949 3300005331 Bacteria 11211
30 Ga0070670_100381828 3300005331 Bacteria 1241
31 Ga0068869_100001770 3300005334 Bacteria 12931
32 Ga0068869_100103319 3300005334 Bacteria 2159
33 Ga0068869_100901227 3300005334 Bacteria 765
34 Ga0070666_10006804 3300005335 Bacteria 7044
35 Ga0070680_100024813 3300005336 Bacteria 4792
36 Ga0068868_100000513 3300005338 Bacteria 25868
37 Ga0068868_100099612 3300005338 Bacteria 2351
38 Ga0070660_100011649 3300005339 Bacteria 6259
39 Ga0070689_100023208 3300005340 Bacteria 4642
40 Ga0070689_100061486 3300005340 Bacteria 2922
41 Ga0070691_10528455 3300005341 Bacteria 686
42 Ga0070687_100137167 3300005343 Bacteria 1420
43 Ga0070687_100739015 3300005343 Unclassified 691
44 Ga0070661_100081367 3300005344 Bacteria 2391
45 Ga0070692_10011135 3300005345 Bacteria 4121
46 Ga0070692_10018199 3300005345 Bacteria 3373
47 Ga0070692_10048312 3300005345 Unclassified 2204
48 Ga0070668_100012747 3300005347 Bacteria 6257
49 Ga0070669_100024053 3300005353 Unclassified 4365
50 Ga0070669_100069679 3300005353 Bacteria 2598
51 Ga0070669_100362676 3300005353 Bacteria 1179
52 Ga0070671_100095480 3300005355 Bacteria 2492
53 Ga0070671_100166668 3300005355 Bacteria 1863
54 Ga0070674_100618437 3300005356 Unclassified 917
55 Ga0070673_100022523 3300005364 Bacteria 4587
56 Ga0070673_101198068 3300005364 Unclassified 711
57 Ga0070659_100000437 3300005366 Bacteria 31405
58 Ga0070667_100075014 3300005367 Bacteria 2887
59 Ga0070667_100460872 3300005367 Bacteria 1162
60 Ga0070709_10075324 3300005434 Bacteria 2189
61 Ga0070713_101225766 3300005436 Bacteria 726
62 Ga0070710_10498593 3300005437 Bacteria 833
63 Ga0070711_100018416 3300005439 Bacteria 4458
64 Ga0070705_100595508 3300005440 Unclassified 854
65 Ga0070705_100972921 3300005440 Unclassified 687
66 Ga0070700_100001026 3300005441 Bacteria 13798
67 Ga0070700_100092403 3300005441 Unclassified 1977
68 Ga0070694_100036907 3300005444 Unclassified 3239
69 Ga0070663_100767764 3300005455 Unclassified 824
70 Ga0070662_100095471 3300005457 Bacteria 2241
71 Ga0070662_100155982 3300005457 Unclassified 1782
72 Ga0070685_10045374 3300005466 Bacteria 2520
73 Ga0070685_10456124 3300005466 Bacteria 896
74 Ga0070706_100906577 3300005467 Bacteria 814
75 Ga0070707_100037936 3300005468 Bacteria 4601
76 Ga0070697_100076984 3300005536 Bacteria 2744
77 Ga0068853_100017586 3300005539 Bacteria 5900
78 Ga0070686_100093282 3300005544 Bacteria 2018
79 Ga0070695_100000714 3300005545 Bacteria 17670
80 Ga0070695_100256098 3300005545 Bacteria 1276
81 Ga0070696_100100244 3300005546 Bacteria 2074
82 Ga0070693_100003595 3300005547 Bacteria 7236
83 Ga0070693_100008236 3300005547 Bacteria 5127
84 Ga0070665_100137064 3300005548 Bacteria 2450
85 Ga0070704_100035895 3300005549 Unclassified 3373
86 Ga0070704_100670284 3300005549 Unclassified 917
87 Ga0070704_100686014 3300005549 Bacteria 907
88 Ga0068855_100345358 3300005563 Bacteria 1640
89 Ga0070664_100416443 3300005564 Bacteria 1230
90 Ga0070664_100684623 3300005564 Bacteria 954
91 Ga0068857_100711342 3300005577 Bacteria 955
92 Ga0068854_100298763 3300005578 Bacteria 1302
93 Ga0068854_100885214 3300005578 Bacteria 784
94 Ga0068856_100019362 3300005614 Bacteria 6607
95 Ga0070702_100209994 3300005615 Bacteria 1295
96 Ga0068852_100015113 3300005616 Bacteria 5972
97 Ga0068852_100052227 3300005616 Bacteria 3512
98 Ga0068859_100079652 3300005617 Bacteria 3316
99 Ga0068859_100099968 3300005617 Bacteria 2956
100 Ga0068864_100055319 3300005618 Bacteria 3425
101 Ga0068864_100469478 3300005618 Bacteria 1206
102 Ga0068866_10059105 3300005718 Bacteria 1982
103 Ga0068861_100027087 3300005719 Bacteria 4172
104 Ga0068863_100095124 3300005841 Bacteria 2827
105 Ga0068858_100091082 3300005842 Bacteria 2838
106 Ga0068860_100078015 3300005843 Bacteria 3150
107 Ga0068862_100021413 3300005844 Bacteria 5402
108 Ga0068862_101022061 3300005844 Bacteria 818
109 Ga0081538_10044625 3300005981 Unclassified 2762
110 Ga0081539_10055841 3300005985 Bacteria 2194
111 Ga0081539_10197210 3300005985 Unclassified 933
112 Ga0075365_10039414 3300006038 Bacteria 3076
113 Ga0075364_10000219 3300006051 Bacteria 27057
114 Ga0075364_10025156 3300006051 Bacteria 3787
115 Ga0075364_10054039 3300006051 Bacteria 2626
116 Ga0070715_10000068 3300006163 Bacteria 33105
117 Ga0070715_10238856 3300006163 Bacteria 944
118 Ga0070716_100368775 3300006173 Unclassified 1022
119 Ga0070716_100437164 3300006173 Bacteria 950
120 Ga0070712_100088880 3300006175 Bacteria 2258
121 Ga0070712_100596128 3300006175 Bacteria 935
122 Ga0075367_10099756 3300006178 Bacteria 1774
123 Ga0097621_100010379 3300006237 Bacteria 6812
124 Ga0075428_100152424 3300006844 Bacteria 2511
125 Ga0075430_100023918 3300006846 Bacteria 5202
126 Ga0075430_100032014 3300006846 Bacteria 4463
127 Ga0075430_100137547 3300006846 Bacteria 2035
128 Ga0075431_100002439 3300006847 Bacteria 17891
129 Ga0075431_100089044 3300006847 Bacteria 3186
130 Ga0075431_100305824 3300006847 Bacteria 1606
131 Ga0075433_10203048 3300006852 Bacteria 1762
132 Ga0075434_100056963 3300006871 Bacteria 3884
133 Ga0068865_100050201 3300006881 Bacteria 2880
134 Ga0097620_100079652 3300006931 Bacteria 3316
135 Ga0097620_100099964 3300006931 Bacteria 2956
136 Ga0075435_100263784 3300007076 Bacteria 1468
137 Ga0105251_10043885 3300009011 Bacteria 2163
138 Ga0105244_10081516 3300009036 Bacteria 1601
139 Ga0105245_10067605 3300009098 Bacteria 3236
140 Ga0105247_10065465 3300009101 Bacteria 2261
141 Ga0105247_11191589 3300009101 Bacteria 606
142 Ga0114129_10017606 3300009147 Bacteria 10171
143 Ga0114129_10210844 3300009147 Bacteria 2626
144 Ga0114129_10263576 3300009147 Bacteria 2308
145 Ga0114129_10846272 3300009147 Bacteria 1163
146 Ga0114129_11400649 3300009147 Bacteria 863
147 Ga0114129_11651391 3300009147 Bacteria 783
148 Ga0105243_10315082 3300009148 Bacteria 1423
149 Ga0105243_10828415 3300009148 Bacteria 914
150 Ga0105243_11838428 3300009148 Bacteria 637
151 Ga0105241_10512710 3300009174 Bacteria 1071
152 Ga0105242_10001700 3300009176 Bacteria 17415
153 Ga0105242_10005282 3300009176 Bacteria 9971
154 Ga0105242_10110519 3300009176 Bacteria 2342
155 Ga0105242_10227206 3300009176 Bacteria 1671
156 Ga0105248_10247208 3300009177 Bacteria 2008
157 Ga0105237_10316691 3300009545 Bacteria 1563
158 Ga0105249_10000092 3300009553 Bacteria 125188
159 Ga0105249_10210249 3300009553 Bacteria 1909
160 Ga0105249_10282643 3300009553 Bacteria 1658
161 Ga0105249_10353338 3300009553 Bacteria 1489
162 Ga0105249_10714379 3300009553 Bacteria 1063
163 Ga0105239_10794674 3300010375 Bacteria 1084
164 Ga0105246_10351345 3300011119 Bacteria 1208
165 Ga0157371_10341777 3300013102 Bacteria 1089
166 Ga0157369_10483639 3300013105 Bacteria 1281
167 Ga0157369_10850923 3300013105 Unclassified 936
168 Ga0157374_10077447 3300013296 Bacteria 3147
169 Ga0157374_10090146 3300013296 Bacteria 2922
170 Ga0157378_10050897 3300013297 Bacteria 3685
171 Ga0157378_10081313 3300013297 Bacteria 2928
172 Ga0163162_10000002 3300013306 Bacteria 717331
173 Ga0163162_10048688 3300013306 Bacteria 4247
174 Ga0163162_10111213 3300013306 Bacteria 2837
175 Ga0157372_11513665 3300013307 Unclassified 773
176 Ga0157375_10086695 3300013308 Bacteria 3182
177 Ga0163163_10099403 3300014325 Bacteria 2931
178 Ga0157380_10009008 3300014326 Bacteria 7129
179 Ga0157380_10016696 3300014326 Bacteria 5420
180 Ga0157380_10173413 3300014326 Unclassified 1887
181 Ga0157380_10442146 3300014326 Bacteria 1246
182 Ga0182008_10000032 3300014497 Bacteria 162985
183 Ga0157377_10093747 3300014745 Bacteria 1778
184 Ga0157379_10049298 3300014968 Bacteria 3759
185 Ga0157376_10133138 3300014969 Bacteria 2221
186 Ga0157376_11272498 3300014969 Bacteria 765
187 Ga0163161_10050447 3300017792 Bacteria 3012
188 Ga0163161_10215541 3300017792 Bacteria 1484
189 Ga0163161_10632850 3300017792 Bacteria 885
190 Ga0213872_10045997 3300021361 Bacteria 1986
191 Ga0213876_10000935 3300021384 Bacteria 19266
192 Ga0213875_10227601 3300021388 Bacteria 878
193 Ga0209258_100252 3300025242 Bacteria 97179
194 Ga0209646_1000037 3300025246 Bacteria 355116
195 Ga0209026_1000050 3300025250 Bacteria 254994
196 Ga0209026_1000290 3300025250 Bacteria 56927
197 Ga0209148_1000217 3300025254 Bacteria 98076
198 Ga0209759_1000229 3300025256 Bacteria 83575
199 Ga0209758_1007454 3300025297 Bacteria 7440
200 Ga0207426_1000371 3300025302 Bacteria 79084
201 Ga0209257_1033040 3300025304 Bacteria 1632
202 Ga0207713_1113747 3300025735 Bacteria 916
203 Ga0207682_10125532 3300025893 Bacteria 1142
204 Ga0207642_10284038 3300025899 Bacteria 953
205 Ga0207710_10016665 3300025900 Bacteria 3110
206 Ga0207710_10116558 3300025900 Bacteria 1272
207 Ga0207680_10050854 3300025903 Bacteria 2475
208 Ga0207685_10000059 3300025905 Bacteria 33076
209 Ga0207699_10588361 3300025906 Bacteria 810
210 Ga0207699_10667961 3300025906 Bacteria 760
211 Ga0207684_11009377 3300025910 Unclassified 696
212 Ga0207695_11394358 3300025913 Bacteria 581
213 Ga0207671_10169395 3300025914 Bacteria 1695
214 Ga0207693_10075453 3300025915 Bacteria 2640
215 Ga0207693_10111695 3300025915 Bacteria 2144
216 Ga0207660_10112525 3300025917 Bacteria 2050
217 Ga0207662_10101789 3300025918 Bacteria 1781
218 Ga0207657_10007640 3300025919 Bacteria 11064
219 Ga0207649_10098144 3300025920 Bacteria 1933
220 Ga0207681_10100805 3300025923 Bacteria 2082
221 Ga0207650_10036271 3300025925 Bacteria 3586
222 Ga0207659_10096964 3300025926 Bacteria 2214
223 Ga0207687_11116222 3300025927 Bacteria 677
224 Ga0207700_10229675 3300025928 Bacteria 1577
225 Ga0207700_10441137 3300025928 Bacteria 1146
226 Ga0207644_10047647 3300025931 Bacteria 3059
227 Ga0207644_10125202 3300025931 Bacteria 1961
228 Ga0207690_10000535 3300025932 Bacteria 24774
229 Ga0207706_10121990 3300025933 Unclassified 2292
230 Ga0207706_10127371 3300025933 Bacteria 2239
231 Ga0207686_10001331 3300025934 Bacteria 14069
232 Ga0207686_10011983 3300025934 Bacteria 4759
233 Ga0207686_10081792 3300025934 Bacteria 2109
234 Ga0207686_10296884 3300025934 Bacteria 1199
235 Ga0207670_10024018 3300025936 Bacteria 3805
236 Ga0207704_10024455 3300025938 Bacteria 3276
237 Ga0207704_10499082 3300025938 Bacteria 980
238 Ga0207665_10086921 3300025939 Bacteria 2161
239 Ga0207665_10426977 3300025939 Unclassified 1013
240 Ga0207691_10020607 3300025940 Bacteria 6234
241 Ga0207711_10041631 3300025941 Bacteria 3912
242 Ga0207689_10011112 3300025942 Bacteria 7731
243 Ga0207689_10170532 3300025942 Bacteria 1794
244 Ga0207689_10237434 3300025942 Bacteria 1507
245 Ga0207679_10313722 3300025945 Bacteria 1356
246 Ga0207679_10554546 3300025945 Bacteria 1031
247 Ga0207679_11136946 3300025945 Bacteria 716
248 Ga0207667_10781721 3300025949 Bacteria 952
249 Ga0207712_10000135 3300025961 Bacteria 77342
250 Ga0207712_11567390 3300025961 Unclassified 590
251 Ga0207668_10003342 3300025972 Bacteria 9398
252 Ga0207640_10201376 3300025981 Bacteria 1509
253 Ga0207640_10375268 3300025981 Bacteria 1151
254 Ga0207658_10039642 3300025986 Bacteria 3399
255 Ga0207677_10000065 3300026023 Bacteria 88193
256 Ga0207677_10119925 3300026023 Bacteria 1976
257 Ga0207703_10043031 3300026035 Bacteria 3623
258 Ga0207639_10472393 3300026041 Bacteria 1142
259 Ga0207708_10001475 3300026075 Bacteria 17580
260 Ga0207708_10235062 3300026075 Bacteria 1472
261 Ga0207702_10030748 3300026078 Bacteria 4473
262 Ga0207641_10089104 3300026088 Bacteria 2695
263 Ga0207676_10073518 3300026095 Bacteria 2751
264 Ga0207675_100012195 3300026118 Bacteria 8028
265 Ga0207683_10379328 3300026121 Bacteria 1299
266 Ga0207698_10061202 3300026142 Bacteria 2932
267 Ga0207698_10356573 3300026142 Bacteria 1383
268 Ga0268265_10029443 3300028380 Unclassified 3941
269 Ga0268265_11204697 3300028380 Bacteria 755
270 Ga0268264_10080783 3300028381 Bacteria 2777
271 Ga0265338_10029923 3300028800 Bacteria 5384
272 Ga0316176_1123934 3300030732 Bacteria 1011
273 Ga0265762_1035543 3300030760 Bacteria 959
274 Ga0265767_100429 3300030836 Bacteria 1768
275 Ga0265325_10040260 3300031241 Bacteria 2455
276 Ga0265339_10000205 3300031249 Bacteria 48438
277 Ga0307408_100154382 3300031548 Bacteria 1816
278 Ga0265313_10000353 3300031595 Bacteria 50100
279 Ga0307508_10013297 3300031616 Bacteria 7528
280 Ga0265342_10103102 3300031712 Bacteria 1622
281 Ga0307516_10031784 3300031730 Bacteria 5320
282 Ga0307405_10496620 3300031731 Bacteria 977
283 Ga0307413_10001087 3300031824 Bacteria 9944
284 Ga0307413_10003345 3300031824 Bacteria 6736
285 Ga0307410_10735499 3300031852 Bacteria 834
286 Ga0307406_10123128 3300031901 Bacteria 1807
287 Ga0307412_10105003 3300031911 Bacteria 2006
288 Ga0307412_10934668 3300031911 Bacteria 762
289 Ga0307409_100059689 3300031995 Bacteria 2970
290 Ga0307409_101039770 3300031995 Bacteria 838
291 Ga0307416_100045428 3300032002 Bacteria 3459
292 Ga0307416_100104981 3300032002 Bacteria 2472
293 Ga0307416_102874930 3300032002 Unclassified 576
294 Ga0307414_10009476 3300032004 Bacteria 5596
295 Ga0307414_10599642 3300032004 Bacteria 987
296 Ga0307411_10000001 3300032005 Bacteria 931810
297 Ga0307411_10040107 3300032005 Bacteria 2968
298 Ga0307415_100016347 3300032126 Bacteria 4421
299 Ga0307415_100213486 3300032126 Bacteria 1541
300 Ga0307415_100657238 3300032126 Bacteria 940
301 Ga0373940_0168393 3300035088 Bacteria 707
302 Ga0373945_0073210 3300035116 Bacteria 1301
303 Ga0373961_0217662 3300035241 Bacteria 680
304 Ga0373927_0144169 3300035695 Bacteria 1559
305 Ga0395900_1162217 3300037418 Bacteria 688
306 Ga0395900_1878692 3300037418 Unclassified 509
307 Ga0436364_1180439 3300037853 Bacteria 1849
308 Ga0436365_1526301 3300039437 Bacteria 136420
309 Ga0436361_0400086 3300039447 Bacteria 7525
310 Ga0436363_0118154 3300039450 Bacteria 946
311 Ga0439465_0036843 3300041413 Bacteria 1572
312 Ga0451797_1019589 3300041453 Bacteria 786
313 Ga0439431_0005150 3300041997 Bacteria 2883
314 Ga0439448_0022006 3300042005 Bacteria 1978
315 Ga0439449_0144239 3300042007 Bacteria 887
316 Ga0450896_005192 3300042133 Bacteria 1775
317 Ga0439446_0054471 3300042156 Bacteria 1200
318 Ga0439459_0022508 3300042438 Bacteria 1220
319 Ga0450893_0113209 3300042532 Bacteria 561
320 Ga0451577_0173725 3300042876 Bacteria 1942
321 Ga0451577_0566924 3300042876 Bacteria 1031
322 Ga0451577_0603856 3300042876 Bacteria 996
323 Ga0453683_0221162 3300044673 Bacteria 1204
324 Ga0453683_0259218 3300044673 Bacteria 1109
325 Ga0466963_0047368 3300044694 Bacteria 2837
326 Ga0466964_0646058 3300044706 Bacteria 585
327 Ga0466971_0073418 3300044719 Bacteria 1555
328 Ga0466971_0147766 3300044719 Bacteria 1096
329 Ga0466970_0077973 3300044765 Bacteria 1787
330 Ga0466957_0073494 3300044842 Bacteria 2119
331 Ga0466957_0119400 3300044842 Bacteria 1679
332 Ga0451576_0853319 3300045051 Bacteria 956
333 Ga0451576_0876293 3300045051 Bacteria 942
334 Ga0466958_0009055 3300045836 Bacteria 5529
335 Ga0466967_0157127 3300045976 Bacteria 2131
336 Ga0466967_0836030 3300045976 Bacteria 915
337 Ga0495607_0218435 3300046501 Bacteria 934
338 Ga0495583_0013117 3300046506 Bacteria 4643
339 Ga0495606_0001529 3300046507 Bacteria 30601
340 Ga0495628_0601846 3300046516 Unclassified 785
341 Ga0495631_0006658 3300046518 Bacteria 5940
342 Ga0495631_0064602 3300046518 Bacteria 1584
343 Ga0495644_0241212 3300046523 Bacteria 701
344 Ga0495663_0046652 3300046525 Bacteria 1331
345 Ga0495652_0362137 3300046529 Bacteria 1036
346 Ga0495609_0022213 3300046538 Bacteria 2924
347 Ga0495645_0061373 3300046543 Bacteria 2724
348 Ga0495633_0000776 3300046558 Bacteria 28552
349 Ga0495633_0112705 3300046558 Bacteria 1261
350 Ga0495667_0230520 3300046559 Bacteria 1181
351 Ga0495611_0107523 3300046648 Bacteria 1297
352 Ga0495625_0017249 3300046660 Bacteria 5653
353 Ga0495625_0152292 3300046660 Bacteria 1554
354 Ga0495635_0604462 3300046663 Bacteria 716
355 Ga0495669_0000011 3300046684 Bacteria 158720
356 Ga0495672_0083334 3300047320 Bacteria 1776
357 Ga0495687_000077 3300047443 Bacteria 148889
358 Ga0495686_0285464 3300047472 Bacteria 916
359 Ga0496100_0315525 3300048903 Bacteria 1173
360 Ga0496100_0557143 3300048903 Bacteria 887
361 Ga0496103_0405780 3300048906 Bacteria 875
362 Ga0496104_0205197 3300048907 Bacteria 1883
363 Ga0496104_1145732 3300048907 Bacteria 681
364 Ga0496105_0177059 3300048908 Bacteria 1747
365 Ga0496108_1618907 3300048911 Bacteria 535
366 Ga0496110_0473479 3300048913 Unclassified 1141
367 Ga0496110_0804851 3300048913 Bacteria 844
368 Ga0496111_0726237 3300048914 Bacteria 721
369 Ga0496112_0196472 3300048915 Bacteria 1978
370 Ga0496113_0028422 3300048916 Bacteria 4022
371 Ga0496113_0145418 3300048916 Bacteria 1867
372 Ga0496114_0054330 3300048917 Bacteria 3340
373 Ga0496114_0072232 3300048917 Bacteria 2902
374 Ga0496115_0247608 3300048918 Bacteria 1468
375 Ga0496117_0001287 3300048920 Bacteria 36971
376 Ga0496118_0001350 3300048921 Bacteria 37040
377 Ga0496121_0003107 3300048924 Bacteria 24004
378 Ga0496122_0003368 3300048925 Bacteria 21040
379 Ga0496123_0002880 3300048926 Bacteria 20186
380 Ga0496124_0005075 3300048927 Bacteria 15016
381 Ga0496125_0004515 3300048928 Bacteria 15998
382 Ga0496125_0403429 3300048928 Bacteria 798
383 Ga0496126_0022071 3300048929 Bacteria 6202
384 Ga0496126_0031130 3300048929 Bacteria 5046
385 Ga0501032_0073744 3300049569 Bacteria 2274
386 Ga0501034_0000462 3300049571 Bacteria 67291
387 Ga0501034_0346971 3300049571 Bacteria 1413
388 Ga0501037_0207704 3300049573 Bacteria 1382
389 Ga0501043_0264624 3300049579 Bacteria 1321
390 Ga0501046_0031293 3300049580 Bacteria 4315
391 Ga0501047_0038356 3300049581 Bacteria 4636
392 Ga0501047_0203853 3300049581 Bacteria 1838
393 Ga0501047_0311574 3300049581 Bacteria 1414
394 Ga0501067_0422011 3300049583 Bacteria 744
395 Ga0501068_0120906 3300049584 Bacteria 1632
396 Ga0501068_0149200 3300049584 Unclassified 1469
397 Ga0501069_0050086 3300049585 Bacteria 2322
398 Ga0501070_0013611 3300049586 Bacteria 6856
399 Ga0501070_1464006 3300049586 Unclassified 517
400 Ga0501073_0211197 3300049589 Bacteria 1341
401 Ga0501074_0069229 3300049590 Bacteria 2537
402 Ga0501235_027726 3300049669 Bacteria 1271
403 Ga0501249_009717 3300049679 Bacteria 2001
404 Ga0501079_0077104 3300049741 Bacteria 2578
405 Ga0501080_0042679 3300049742 Bacteria 4222
406 Ga0501080_0279012 3300049742 Bacteria 1519
407 Ga0501241_026082 3300049758 Bacteria 1090
408 Ga0501266_000023 3300049763 Bacteria 82396
409 Ga0501035_1159949 3300049822 Bacteria 601
410 Ga0501044_0344954 3300049823 Bacteria 1410
411 Ga0501044_0636249 3300049823 Bacteria 957
412 nmdc:mga03683_102317_c1 3300050489 Bacteria 1260
413 nmdc:mga03n38_26765_c1 3300050490 Bacteria 2385
414 nmdc:mga00v17_44324_c1 3300050491 Bacteria 2682
415 nmdc:mga0yw44_29501_c1 3300050492 Bacteria 3167
416 nmdc:mga0yw44_32864_c1 3300050492 Bacteria 3026
417 nmdc:mga05p37_1091298_c1 3300050507 Bacteria 837
418 nmdc:mga05p37_1342_c1 3300050507 Bacteria 28603
419 nmdc:mga05p37_1427824_c1 3300050507 Bacteria 695
420 nmdc:mga05p37_812235_c1 3300050507 Bacteria 1021
421 nmdc:mga09592_143450_c1 3300050508 Bacteria 2059
422 nmdc:mga0qj67_11676_c1 3300050509 Bacteria 6589
423 nmdc:mga06r32_126897_c1 3300050510 Bacteria 2521
424 nmdc:mga06r32_14293_c1 3300050510 Bacteria 7200
425 nmdc:mga06r32_551835_c1 3300050510 Bacteria 1126
426 nmdc:mga08y16_1687210_c1 3300050511 Unclassified 589
427 nmdc:mga08y16_722286_c1 3300050511 Bacteria 994
428 nmdc:mga0n895_579034_c1 3300050512 Bacteria 1126
429 nmdc:mga0rr50_207993_c2 3300050513 Bacteria 1162
430 nmdc:mga0a205_1458812_c1 3300050515 Bacteria 532
431 nmdc:mga0a205_243466_c1 3300050515 Bacteria 1679
432 nmdc:mga0a205_635635_c1 3300050515 Bacteria 919
433 Ga0500610_0000028 3300053079 Bacteria 52793
434 Ga0495655_0001346 3300053083 Bacteria 3779
435 Ga0500644_0000203 3300053088 Bacteria 35985
436 Ga0500644_0291550 3300053088 Bacteria 696
437 Ga0500641_0000417 3300053096 Bacteria 15703
438 Ga0500652_005122 3300053131 Bacteria 4102
439 Ga0500658_0000003 3300053134 Bacteria 512506
440 Ga0500568_0003948 3300053139 Bacteria 8071
441 Ga0500568_0011991 3300053139 Bacteria 4000
442 Ga0500568_0032027 3300053139 Unclassified 2164
443 Ga0500589_078035 3300053147 Bacteria 1483
444 Ga0500627_0209109 3300053158 Bacteria 873
445 Ga0500645_000001 3300053730 Bacteria 455558
446 Ga0501084_0064835 3300054114 Bacteria 3056
447 Ga0587083_0063080 3300059505 Bacteria 841
448 Ga0587086_042205 3300059507 Unclassified 710
449 Ga0587109_023302 3300059624 Bacteria 1121
450 Ga0587076_020642 3300059645 Bacteria 1083
451 Ga0587107_064510 3300059652 Bacteria 654
452 Ga0587071_063967 3300060344 Bacteria 787
453 Ga0587111_0028617 3300060346 Bacteria 1123
454 Ga0501082_0019281 3300060353 Bacteria 5880
455 2513235864 2513020052 Bacteria 5120511
456 2644072710 2643221611 Bacteria 6820941
457 2644072712 2643221611 Bacteria 6820941
458 2688596215 2687453392 Bacteria 6880454
459 2776612199 2775506987 Bacteria 5373360
460 2819428860 2818991318 Bacteria 5266538
461 2856329496 2856328259 Bacteria 6528202
462 2856339825 2856334872 Bacteria 7037011
463 2857369149 2857367948 Bacteria 6965560
464 2857618879 2857618242 Bacteria 5635925
465 2865003017 2865002811 Bacteria 6333767
466 2869271903 2869271264 Bacteria 6908218
467 2874168169 2874162495 Bacteria 6174670
468 2876404587 2876399893 Bacteria 6927900
469 2876410497 2876406927 Bacteria 6191900
470 2878778349 2878774303 Bacteria 6108671
471 2878781130 2878781027 Bacteria 6834456
472 2906388115 2906386501 Bacteria 5977019
473 2906408934 2906408224 Bacteria 6162342
474 2922152413 2922151315 Bacteria 6902399
475 2922173206 2922172374 Bacteria 6167644
476 2922184776 2922178524 Bacteria 6025201
477 2924754060 2924748358 Bacteria 6154725
478 2929925730 2929921140 Bacteria 8649150
479 2939623077 2939622612 Bacteria 4698046
480 2958126814 2958122699 Bacteria 7280457
481 2958140183 2958137437 Bacteria 6050276
482 2958162500 2958158011 Bacteria 6058449
483 2961140880 2961136820 Bacteria 6775228
484 2965026750 2965025482 Bacteria 6532201
485 2965038160 2965032056 Bacteria 6887443
486 2965051005 2965047637 Bacteria 6623551
487 2965107260 2965102966 Bacteria 6800987
488 2965116921 2965110997 Bacteria 6693150
489 2970550845 2970547951 Bacteria 6931819
490 2977875844 2977872689 Bacteria 7270173
491 2977938013 2977935797 Bacteria 6252826
492 2977964322 2977957713 Bacteria 6877875
493 2979796832 2979793036 Bacteria 6808957
494 2987651501 2987645492 Bacteria 6117018
495 2987673848 2987673487 Bacteria 6884027
496 3004241419 3004239961 Bacteria 6892290
497 3004337009 3004334049 Bacteria 8449246
498 649870773 649633066 Bacteria 6690028
499 8003153300 8003151029 Bacteria 8187759
500 8004306863 8004300914 Bacteria 6132239
501 JGI25154J39366_1000025
502 MRS1b_contig_3585791
503 LJQas_1010480
504 JGI24736J21556_1021942
505 JGI24740J21852_10010677
506 JGI24743J22301_10069433
507 JGI25156J39149_1008579
508 JGI25157J39369_1000700
509 JGI25157J39369_1002640
510 JGI25406J46586_10118235
511 JGI25153J46596_10002276
512 rootH1_10041215
513 rootH1_10067345
514 rootH1_10303365
515 JGI25160J50197_1006075
516 Ga0055535_1001614
517 Ga0055542_1013046
518 Ga0058863_10026864
519 Ga0065165_1013992
520 Ga0065714_10037453
521 Ga0065714_10146305
522 Ga0065714_10153743
523 Ga0065704_10142336
524 Ga0065712_10080023
525 Ga0065712_10149860
526 Ga0070676_10243677
527 Ga0070690_100005999
528 Ga0070690_100051113
529 Ga0070670_100004949
530 Ga0070670_100381828
531 Ga0068869_100001770
532 Ga0068869_100103319
533 Ga0068869_100901227
534 Ga0070666_10006804
535 Ga0070680_100024813
536 Ga0068868_100000513
537 Ga0068868_100099612
538 Ga0070660_100011649
539 Ga0070689_100023208
540 Ga0070689_100061486
541 Ga0070691_10528455
542 Ga0070687_100137167
543 Ga0070687_100739015
544 Ga0070661_100081367
545 Ga0070692_10011135
546 Ga0070692_10018199
547 Ga0070692_10048312
548 Ga0070668_100012747
549 Ga0070669_100024053
550 Ga0070669_100069679
551 Ga0070669_100362676
552 Ga0070671_100095480
553 Ga0070671_100166668
554 Ga0070674_100618437
555 Ga0070673_100022523
556 Ga0070673_101198068
557 Ga0070659_100000437
558 Ga0070667_100075014
559 Ga0070667_100460872
560 Ga0070709_10075324
561 Ga0070713_101225766
562 Ga0070710_10498593
563 Ga0070711_100018416
564 Ga0070705_100595508
565 Ga0070705_100972921
566 Ga0070700_100001026
567 Ga0070700_100092403
568 Ga0070694_100036907
569 Ga0070663_100767764
570 Ga0070662_100095471
571 Ga0070662_100155982
572 Ga0070685_10045374
573 Ga0070685_10456124
574 Ga0070706_100906577
575 Ga0070707_100037936
576 Ga0070697_100076984
577 Ga0068853_100017586
578 Ga0070686_100093282
579 Ga0070695_100000714
580 Ga0070695_100256098
581 Ga0070696_100100244
582 Ga0070693_100003595
583 Ga0070693_100008236
584 Ga0070665_100137064
585 Ga0070704_100035895
586 Ga0070704_100670284
587 Ga0070704_100686014
588 Ga0068855_100345358
589 Ga0070664_100416443
590 Ga0070664_100684623
591 Ga0068857_100711342
592 Ga0068854_100298763
593 Ga0068854_100885214
594 Ga0068856_100019362
595 Ga0070702_100209994
596 Ga0068852_100015113
597 Ga0068852_100052227
598 Ga0068859_100079652
599 Ga0068859_100099968
600 Ga0068864_100055319
601 Ga0068864_100469478
602 Ga0068866_10059105
603 Ga0068861_100027087
604 Ga0068863_100095124
605 Ga0068858_100091082
606 Ga0068860_100078015
607 Ga0068862_100021413
608 Ga0068862_101022061
609 Ga0081538_10044625
610 Ga0081539_10055841
611 Ga0081539_10197210
612 Ga0075365_10039414
613 Ga0075364_10000219
614 Ga0075364_10025156
615 Ga0075364_10054039
616 Ga0070715_10000068
617 Ga0070715_10238856
618 Ga0070716_100368775
619 Ga0070716_100437164
620 Ga0070712_100088880
621 Ga0070712_100596128
622 Ga0075367_10099756
623 Ga0097621_100010379
624 Ga0075428_100152424
625 Ga0075430_100023918
626 Ga0075430_100032014
627 Ga0075430_100137547
628 Ga0075431_100002439
629 Ga0075431_100089044
630 Ga0075431_100305824
631 Ga0075433_10203048
632 Ga0075434_100056963
633 Ga0068865_100050201
634 Ga0097620_100079652
635 Ga0097620_100099964
636 Ga0075435_100263784
637 Ga0105251_10043885
638 Ga0105244_10081516
639 Ga0105245_10067605
640 Ga0105247_10065465
641 Ga0105247_11191589
642 Ga0114129_10017606
643 Ga0114129_10210844
644 Ga0114129_10263576
645 Ga0114129_10846272
646 Ga0114129_11400649
647 Ga0114129_11651391
648 Ga0105243_10315082
649 Ga0105243_10828415
650 Ga0105243_11838428
651 Ga0105241_10512710
652 Ga0105242_10001700
653 Ga0105242_10005282
654 Ga0105242_10110519
655 Ga0105242_10227206
656 Ga0105248_10247208
657 Ga0105237_10316691
658 Ga0105249_10000092
659 Ga0105249_10210249
660 Ga0105249_10282643
661 Ga0105249_10353338
662 Ga0105249_10714379
663 Ga0105239_10794674
664 Ga0105246_10351345
665 Ga0157371_10341777
666 Ga0157369_10483639
667 Ga0157369_10850923
668 Ga0157374_10077447
669 Ga0157374_10090146
670 Ga0157378_10050897
671 Ga0157378_10081313
672 Ga0163162_10000002
673 Ga0163162_10048688
674 Ga0163162_10111213
675 Ga0157372_11513665
676 Ga0157375_10086695
677 Ga0163163_10099403
678 Ga0157380_10009008
679 Ga0157380_10016696
680 Ga0157380_10173413
681 Ga0157380_10442146
682 Ga0182008_10000032
683 Ga0157377_10093747
684 Ga0157379_10049298
685 Ga0157376_10133138
686 Ga0157376_11272498
687 Ga0163161_10050447
688 Ga0163161_10215541
689 Ga0163161_10632850
690 Ga0213872_10045997
691 Ga0213876_10000935
692 Ga0213875_10227601
693 Ga0209258_100252
694 Ga0209646_1000037
695 Ga0209026_1000050
696 Ga0209026_1000290
697 Ga0209148_1000217
698 Ga0209759_1000229
699 Ga0209758_1007454
700 Ga0207426_1000371
701 Ga0209257_1033040
702 Ga0207713_1113747
703 Ga0207682_10125532
704 Ga0207642_10284038
705 Ga0207710_10016665
706 Ga0207710_10116558
707 Ga0207680_10050854
708 Ga0207685_10000059
709 Ga0207699_10588361
710 Ga0207699_10667961
711 Ga0207684_11009377
712 Ga0207695_11394358
713 Ga0207671_10169395
714 Ga0207693_10075453
715 Ga0207693_10111695
716 Ga0207660_10112525
717 Ga0207662_10101789
718 Ga0207657_10007640
719 Ga0207649_10098144
720 Ga0207681_10100805
721 Ga0207650_10036271
722 Ga0207659_10096964
723 Ga0207687_11116222
724 Ga0207700_10229675
725 Ga0207700_10441137
726 Ga0207644_10047647
727 Ga0207644_10125202
728 Ga0207690_10000535
729 Ga0207706_10121990
730 Ga0207706_10127371
731 Ga0207686_10001331
732 Ga0207686_10011983
733 Ga0207686_10081792
734 Ga0207686_10296884
735 Ga0207670_10024018
736 Ga0207704_10024455
737 Ga0207704_10499082
738 Ga0207665_10086921
739 Ga0207665_10426977
740 Ga0207691_10020607
741 Ga0207711_10041631
742 Ga0207689_10011112
743 Ga0207689_10170532
744 Ga0207689_10237434
745 Ga0207679_10313722
746 Ga0207679_10554546
747 Ga0207679_11136946
748 Ga0207667_10781721
749 Ga0207712_10000135
750 Ga0207712_11567390
751 Ga0207668_10003342
752 Ga0207640_10201376
753 Ga0207640_10375268
754 Ga0207658_10039642
755 Ga0207677_10000065
756 Ga0207677_10119925
757 Ga0207703_10043031
758 Ga0207639_10472393
759 Ga0207708_10001475
760 Ga0207708_10235062
761 Ga0207702_10030748
762 Ga0207641_10089104
763 Ga0207676_10073518
764 Ga0207675_100012195
765 Ga0207683_10379328
766 Ga0207698_10061202
767 Ga0207698_10356573
768 Ga0268265_10029443
769 Ga0268265_11204697
770 Ga0268264_10080783
771 Ga0265338_10029923
772 Ga0316176_1123934
773 Ga0265762_1035543
774 Ga0265767_100429
775 Ga0265325_10040260
776 Ga0265339_10000205
777 Ga0307408_100154382
778 Ga0265313_10000353
779 Ga0307508_10013297
780 Ga0265342_10103102
781 Ga0307516_10031784
782 Ga0307405_10496620
783 Ga0307413_10001087
784 Ga0307413_10003345
785 Ga0307410_10735499
786 Ga0307406_10123128
787 Ga0307412_10105003
788 Ga0307412_10934668
789 Ga0307409_100059689
790 Ga0307409_101039770
791 Ga0307416_100045428
792 Ga0307416_100104981
793 Ga0307416_102874930
794 Ga0307414_10009476
795 Ga0307414_10599642
796 Ga0307411_10000001
797 Ga0307411_10040107
798 Ga0307415_100016347
799 Ga0307415_100213486
800 Ga0307415_100657238
801 Ga0373940_0168393
802 Ga0373945_0073210
803 Ga0373961_0217662
804 Ga0373927_0144169
805 Ga0395900_1162217
806 Ga0395900_1878692
807 Ga0436364_1180439
808 Ga0436365_1526301
809 Ga0436361_0400086
810 Ga0436363_0118154
811 Ga0439465_0036843
812 Ga0451797_1019589
813 Ga0439431_0005150
814 Ga0439448_0022006
815 Ga0439449_0144239
816 Ga0450896_005192
817 Ga0439446_0054471
818 Ga0439459_0022508
819 Ga0450893_0113209
820 Ga0451577_0173725
821 Ga0451577_0566924
822 Ga0451577_0603856
823 Ga0453683_0221162
824 Ga0453683_0259218
825 Ga0466963_0047368
826 Ga0466964_0646058
827 Ga0466971_0073418
828 Ga0466971_0147766
829 Ga0466970_0077973
830 Ga0466957_0073494
831 Ga0466957_0119400
832 Ga0451576_0853319
833 Ga0451576_0876293
834 Ga0466958_0009055
835 Ga0466967_0157127
836 Ga0466967_0836030
837 Ga0495607_0218435
838 Ga0495583_0013117
839 Ga0495606_0001529
840 Ga0495628_0601846
841 Ga0495631_0006658
842 Ga0495631_0064602
843 Ga0495644_0241212
844 Ga0495663_0046652
845 Ga0495652_0362137
846 Ga0495609_0022213
847 Ga0495645_0061373
848 Ga0495633_0000776
849 Ga0495633_0112705
850 Ga0495667_0230520
851 Ga0495611_0107523
852 Ga0495625_0017249
853 Ga0495625_0152292
854 Ga0495635_0604462
855 Ga0495669_0000011
856 Ga0495672_0083334
857 Ga0495687_000077
858 Ga0495686_0285464
859 Ga0496100_0315525
860 Ga0496100_0557143
861 Ga0496103_0405780
862 Ga0496104_0205197
863 Ga0496104_1145732
864 Ga0496105_0177059
865 Ga0496108_1618907
866 Ga0496110_0473479
867 Ga0496110_0804851
868 Ga0496111_0726237
869 Ga0496112_0196472
870 Ga0496113_0028422
871 Ga0496113_0145418
872 Ga0496114_0054330
873 Ga0496114_0072232
874 Ga0496115_0247608
875 Ga0496117_0001287
876 Ga0496118_0001350
877 Ga0496121_0003107
878 Ga0496122_0003368
879 Ga0496123_0002880
880 Ga0496124_0005075
881 Ga0496125_0004515
882 Ga0496125_0403429
883 Ga0496126_0022071
884 Ga0496126_0031130
885 Ga0501032_0073744
886 Ga0501034_0000462
887 Ga0501034_0346971
888 Ga0501037_0207704
889 Ga0501043_0264624
890 Ga0501046_0031293
891 Ga0501047_0038356
892 Ga0501047_0203853
893 Ga0501047_0311574
894 Ga0501067_0422011
895 Ga0501068_0120906
896 Ga0501068_0149200
897 Ga0501069_0050086
898 Ga0501070_0013611
899 Ga0501070_1464006
900 Ga0501073_0211197
901 Ga0501074_0069229
902 Ga0501235_027726
903 Ga0501249_009717
904 Ga0501079_0077104
905 Ga0501080_0042679
906 Ga0501080_0279012
907 Ga0501241_026082
908 Ga0501266_000023
909 Ga0501035_1159949
910 Ga0501044_0344954
911 Ga0501044_0636249
912 nmdc:mga03683_102317_c1
913 nmdc:mga03n38_26765_c1
914 nmdc:mga00v17_44324_c1
915 nmdc:mga0yw44_29501_c1
916 nmdc:mga0yw44_32864_c1
917 nmdc:mga05p37_1091298_c1
918 nmdc:mga05p37_1342_c1
919 nmdc:mga05p37_1427824_c1
920 nmdc:mga05p37_812235_c1
921 nmdc:mga09592_143450_c1
922 nmdc:mga0qj67_11676_c1
923 nmdc:mga06r32_126897_c1
924 nmdc:mga06r32_14293_c1
925 nmdc:mga06r32_551835_c1
926 nmdc:mga08y16_1687210_c1
927 nmdc:mga08y16_722286_c1
928 nmdc:mga0n895_579034_c1
929 nmdc:mga0rr50_207993_c2
930 nmdc:mga0a205_1458812_c1
931 nmdc:mga0a205_243466_c1
932 nmdc:mga0a205_635635_c1
933 Ga0500610_0000028
934 Ga0495655_0001346
935 Ga0500644_0000203
936 Ga0500644_0291550
937 Ga0500641_0000417
938 Ga0500652_005122
939 Ga0500658_0000003
940 Ga0500568_0003948
941 Ga0500568_0011991
942 Ga0500568_0032027
943 Ga0500589_078035
944 Ga0500627_0209109
945 Ga0500645_000001
946 Ga0501084_0064835
947 Ga0587083_0063080
948 Ga0587086_042205
949 Ga0587109_023302
950 Ga0587076_020642
951 Ga0587107_064510
952 Ga0587071_063967
953 Ga0587111_0028617
954 Ga0501082_0019281
955 2513235864
956 2644072710
957 2644072712
958 2688596215
959 2776612199
960 2819428860
961 2856329496
962 2856339825
963 2857369149
964 2857618879
965 2865003017
966 2869271903
967 2874168169
968 2876404587
969 2876410497
970 2878778349
971 2878781130
972 2906388115
973 2906408934
974 2922152413
975 2922173206
976 2922184776
977 2924754060
978 2929925730
979 2939623077
980 2958126814
981 2958140183
982 2958162500
983 2961140880
984 2965026750
985 2965038160
986 2965051005
987 2965107260
988 2965116921
989 2970550845
990 2977875844
991 2977938013
992 2977964322
993 2979796832
994 2987651501
995 2987673848
996 3004241419
997 3004337009
998 649870773
999 8003153300
1000 8004306863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.8566 6 59
2xgf-assembly1.cif.gz_C structure of the bacteriophage t4 long tail fibre needle-shaped receptor-binding tip 0.6806 4 106
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.549 6 169
1ocy-assembly1.cif.gz_A structure of the receptor-binding domain of the bacteriophage t4 short tail fibre 0.5464 6 169
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.5334 6 169
ID Description Score Start End Superfamily
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8397 6 59 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8376 4 57 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7872 12 58 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.686 4 57 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6093 6 59 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A7Y2FQZ0-F1-model_v4 Phage tail protein 0.9375 2 175
AF-A4U469-F1-model_v4 Microcystin dependent protein 0.8746 1 175
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.8744 1 175
AF-A0A1M6CTK4-F1-model_v4 Phage Tail Collar Domain 0.8718 1 175
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.8661 1 175

Map