F455976

General Info

Members Datasets Scaffolds Average Seq Length
503 334 1006 154

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100631070|Ga0068853_1006310702
Length 170
Sequence MIDFGFDKLALIGAVALIVIGPEKLPRVARTVGTLLGKAQRYVADVKAEVNRSIELEELQKMKSQFETAARDVHDTVNKELGQVRSDIDGRVSTFDSTAHTGESAMRPHDADWPGGSAPAYKPPRKNWRLKRSVVPTWYKQRNGVRMHAQSGAARVARFRPRRSGTGSAI

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
35 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
92 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
117 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
189 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
190 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
197 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
219 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
228 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
229 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
230 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
231 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
232 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
233 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
234 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
235 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
259 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
288 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
289 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
290 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
291 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
307 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
319 2547132374 Acidovorax radicis N35 Isolate Unclassified
320 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
321 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
322 2643221609 Acidovorax sp. Root217 Isolate Unclassified
323 2643221611 Acidovorax sp. Root219 Isolate Unclassified
324 2721755523 Delftia sp. HK171 Isolate Unclassified
325 2738541337 Pelomonas sp. BT06 Isolate Unclassified
326 2738543012 Acidovorax sp. CF301 Isolate Unclassified
327 2816332133 Acidovorax radicis 2721A Isolate Unclassified
328 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
329 2885266251 Ralstonia sp. SET104 Isolate Nodule
330 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
331 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
332 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
333 2928058823 Ralstonia sp. 1138 Isolate Unclassified
334 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.65
Metatranscriptomes 4.97
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.45
Nodule 0.8
Rhizoplane 2.19
Rhizosphere 60.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100631070 3300005539 Bacteria 1019
2 JGI24741J21665_1000028 3300001915 Bacteria 34664
3 JGI24740J21852_10001179 3300001979 Bacteria 11793
4 JGI24740J21852_10001926 3300001979 Bacteria 9506
5 JGI25155J39150_1000022 3300002704 Bacteria 142950
6 JGI25156J39149_1001747 3300002705 Bacteria 8685
7 JGI25156J39149_1010513 3300002705 Bacteria 2169
8 JGI25154J39366_1000782 3300002738 Bacteria 14066
9 JGI25154J39366_1001575 3300002738 Bacteria 7820
10 JGI25157J39369_1000267 3300002741 Bacteria 38232
11 JGI25150J39212_1005166 3300002774 Bacteria 2816
12 JGI25159J45721_1001655 3300002987 Bacteria 9032
13 JGI25159J45721_1005702 3300002987 Bacteria 3860
14 Ga0006778J45830_1034936 3300003162 Bacteria 1145
15 JGI25151J46595_10008108 3300003187 Bacteria 5087
16 JGI25151J46595_10080009 3300003187 Bacteria 950
17 Ga0006777J48905_1039068 3300003308 Bacteria 1069
18 rootH1_10005761 3300003316 Bacteria 1593
19 rootH1_10005763 3300003316 Bacteria 2150
20 rootH2_10188057 3300003320 Bacteria 1580
21 rootL2_10000300 3300003322 Bacteria 57400
22 rootH1_10006628 3300003323 Bacteria 3787
23 rootH1_10037279 3300003323 Bacteria 2878
24 rootH1_10285916 3300003323 Bacteria 1161
25 Ga0006562J51391_1041993 3300003578 Bacteria 5083
26 Ga0006562J51391_1041996 3300003578 Bacteria 940
27 Ga0055539_1000218 3300003752 Bacteria 40999
28 Ga0055539_1000629 3300003752 Bacteria 9477
29 Ga0055539_1001741 3300003752 Bacteria 3787
30 Ga0055533_1000045 3300003756 Bacteria 223637
31 Ga0055533_1002513 3300003756 Bacteria 4136
32 Ga0055532_1000066 3300003758 Bacteria 139987
33 Ga0055525_1000508 3300003759 Bacteria 19258
34 Ga0055525_1000681 3300003759 Bacteria 12795
35 Ga0055527_1003231 3300003760 Bacteria 2479
36 Ga0055535_1000046 3300003761 Bacteria 139987
37 Ga0055535_1000047 3300003761 Bacteria 139836
38 Ga0055542_1001269 3300003762 Bacteria 13689
39 Ga0055529_1000087 3300003763 Bacteria 139975
40 Ga0055529_1000148 3300003763 Bacteria 100809
41 Ga0055526_1005018 3300003771 Bacteria 7740
42 Ga0055526_1026899 3300003771 Bacteria 1796
43 Ga0055537_1000205 3300003773 Bacteria 44266
44 Ga0055524_1000073 3300003775 Bacteria 123033
45 Ga0055524_1003149 3300003775 Bacteria 8126
46 Ga0055524_1006310 3300003775 Bacteria 5155
47 Ga0055534_1003185 3300003784 Bacteria 5294
48 Ga0055534_1016112 3300003784 Bacteria 1348
49 Ga0055528_1000289 3300003790 Bacteria 42964
50 Ga0055530_10000848 3300003791 Bacteria 25191
51 Ga0055530_10023684 3300003791 Bacteria 1758
52 Ga0055540_1000037 3300003792 Bacteria 162957
53 Ga0055540_1008994 3300003792 Bacteria 3517
54 Ga0055540_1012084 3300003792 Bacteria 2736
55 Ga0055531_10006730 3300003794 Bacteria 6433
56 Ga0055531_10015923 3300003794 Bacteria 3277
57 Ga0055541_1000458 3300003841 Bacteria 11711
58 Ga0055541_1006040 3300003841 Bacteria 2084
59 Ga0055543_1003646 3300004625 Bacteria 4442
60 Ga0065165_1000177 3300005262 Bacteria 113446
61 Ga0065165_1028154 3300005262 Bacteria 1819
62 Ga0065704_10132575 3300005289 Bacteria 1611
63 Ga0070658_10131807 3300005327 Bacteria 2083
64 Ga0070658_10162913 3300005327 Bacteria 1871
65 Ga0070658_10195232 3300005327 Bacteria 1707
66 Ga0070658_10214041 3300005327 Bacteria 1628
67 Ga0070658_10231462 3300005327 Bacteria 1565
68 Ga0070683_101240214 3300005329 Bacteria 717
69 Ga0070690_100011825 3300005330 Bacteria 5119
70 Ga0070670_100001787 3300005331 Bacteria 17505
71 Ga0070677_10057427 3300005333 Bacteria 1595
72 Ga0068869_100683689 3300005334 Bacteria 874
73 Ga0068869_101146033 3300005334 Bacteria 682
74 Ga0068868_100542785 3300005338 Bacteria 1024
75 Ga0070660_100746875 3300005339 Bacteria 821
76 Ga0070689_101691704 3300005340 Bacteria 576
77 Ga0070661_100000262 3300005344 Bacteria 43135
78 Ga0070661_100592101 3300005344 Bacteria 896
79 Ga0070661_100728086 3300005344 Bacteria 810
80 Ga0070675_100080667 3300005354 Bacteria 2712
81 Ga0070671_100302083 3300005355 Bacteria 1363
82 Ga0070674_100820015 3300005356 Bacteria 805
83 Ga0070673_100090389 3300005364 Bacteria 2501
84 Ga0070673_100880911 3300005364 Bacteria 829
85 Ga0070659_100010276 3300005366 Bacteria 6885
86 Ga0070667_100108445 3300005367 Bacteria 2406
87 Ga0070714_100408005 3300005435 Bacteria 1285
88 Ga0070663_100000023 3300005455 Bacteria 111250
89 Ga0070678_100077866 3300005456 Bacteria 2502
90 Ga0070681_10295848 3300005458 Bacteria 1529
91 Ga0068867_100530378 3300005459 Bacteria 1017
92 Ga0070707_100410982 3300005468 Bacteria 1314
93 Ga0070699_100297848 3300005518 Bacteria 1447
94 Ga0070679_100041543 3300005530 Bacteria 4576
95 Ga0068853_100764927 3300005539 Bacteria 924
96 Ga0070672_100036721 3300005543 Bacteria 3734
97 Ga0068855_100006806 3300005563 Bacteria 13869
98 Ga0068855_100008847 3300005563 Bacteria 12171
99 Ga0070664_100000018 3300005564 Bacteria 125281
100 Ga0068857_100013055 3300005577 Bacteria 7236
101 Ga0068854_100000172 3300005578 Bacteria 43732
102 Ga0068854_100060333 3300005578 Bacteria 2744
103 Ga0068856_100000070 3300005614 Bacteria 95320
104 Ga0068856_100001716 3300005614 Bacteria 22915
105 Ga0068856_100184807 3300005614 Bacteria 2098
106 Ga0068856_100994231 3300005614 Bacteria 857
107 Ga0070702_100666645 3300005615 Bacteria 789
108 Ga0068852_100064160 3300005616 Bacteria 3201
109 Ga0068852_100295795 3300005616 Bacteria 1565
110 Ga0068852_100523313 3300005616 Bacteria 1184
111 Ga0068864_100013594 3300005618 Bacteria 6748
112 Ga0068861_100053942 3300005719 Bacteria 3061
113 Ga0068858_100386328 3300005842 Bacteria 1344
114 Ga0075365_10041054 3300006038 Bacteria 3020
115 Ga0075364_10280407 3300006051 Bacteria 1134
116 Ga0075432_10005352 3300006058 Bacteria 4373
117 Ga0075362_10089716 3300006177 Bacteria 1426
118 Ga0075362_10232635 3300006177 Bacteria 903
119 Ga0075366_10013052 3300006195 Bacteria 4725
120 Ga0075366_10101384 3300006195 Bacteria 1727
121 Ga0075366_10252601 3300006195 Bacteria 1076
122 Ga0097621_101128027 3300006237 Bacteria 737
123 Ga0075370_10009322 3300006353 Bacteria 5094
124 Ga0075370_10013610 3300006353 Bacteria 4329
125 Ga0075370_10448060 3300006353 Bacteria 777
126 Ga0068871_100071350 3300006358 Bacteria 2856
127 Ga0099823_1000139 3300006944 Bacteria 37935
128 Ga0105240_10008945 3300009093 Bacteria 14239
129 Ga0105240_10187562 3300009093 Bacteria 2434
130 Ga0105240_10305376 3300009093 Bacteria 1819
131 Ga0105240_10335499 3300009093 Bacteria 1719
132 Ga0105240_12510791 3300009093 Bacteria 533
133 Ga0105245_10123990 3300009098 Bacteria 2416
134 Ga0114129_11090694 3300009147 Bacteria 1000
135 Ga0105241_10185778 3300009174 Bacteria 1727
136 Ga0105242_10001936 3300009176 Bacteria 16289
137 Ga0105237_10922694 3300009545 Bacteria 880
138 Ga0105238_10005849 3300009551 Bacteria 12180
139 Ga0105238_10035826 3300009551 Bacteria 5044
140 Ga0105239_10241713 3300010375 Bacteria 2026
141 Ga0105246_10140899 3300011119 Bacteria 1813
142 Ga0157319_1000008 3300012497 Bacteria 315600
143 Ga0157326_1001164 3300012513 Bacteria 2924
144 Ga0157373_10031842 3300013100 Bacteria 3797
145 Ga0157371_10000275 3300013102 Bacteria 69649
146 Ga0157371_11287482 3300013102 Bacteria 565
147 Ga0157370_10000237 3300013104 Bacteria 70247
148 Ga0157369_10014161 3300013105 Bacteria 9011
149 Ga0157369_10075100 3300013105 Bacteria 3624
150 Ga0157374_10330368 3300013296 Bacteria 1512
151 Ga0157378_10116216 3300013297 Bacteria 2460
152 Ga0163162_10963971 3300013306 Bacteria 963
153 Ga0157372_10003200 3300013307 Bacteria 17677
154 Ga0157372_10238484 3300013307 Bacteria 2110
155 Ga0157375_10858386 3300013308 Bacteria 1054
156 Ga0163163_10280743 3300014325 Bacteria 1717
157 Ga0182008_10015684 3300014497 Bacteria 3950
158 Ga0157379_10557773 3300014968 Bacteria 1066
159 Ga0157376_10047410 3300014969 Bacteria 3547
160 Ga0157376_10314695 3300014969 Bacteria 1486
161 Ga0157376_10572452 3300014969 Bacteria 1120
162 Ga0182006_1000649 3300015261 Bacteria 24690
163 Ga0182007_10023578 3300015262 Bacteria 2163
164 Ga0182007_10043506 3300015262 Bacteria 1492
165 Ga0163161_10461803 3300017792 Bacteria 1028
166 Ga0197907_11174022 3300020069 Bacteria 2409
167 Ga0206356_10395674 3300020070 Bacteria 1873
168 Ga0206351_10335588 3300020077 Bacteria 14215
169 Ga0206352_11359209 3300020078 Bacteria 764
170 Ga0206350_10996245 3300020080 Bacteria 865
171 Ga0154015_1075080 3300020610 Bacteria 10032
172 Ga0224712_10054633 3300022467 Bacteria 1568
173 Ga0209435_100002 3300025206 Bacteria 794178
174 Ga0209784_100052 3300025224 Bacteria 182783
175 Ga0209566_100068 3300025225 Bacteria 177484
176 Ga0209566_100235 3300025225 Bacteria 53611
177 Ga0209566_101594 3300025225 Bacteria 6017
178 Ga0209674_100073 3300025226 Bacteria 223689
179 Ga0209674_100087 3300025226 Bacteria 182783
180 Ga0209674_100189 3300025226 Bacteria 66805
181 Ga0209672_100308 3300025228 Bacteria 32831
182 Ga0209672_104105 3300025228 Bacteria 2793
183 Ga0209147_100090 3300025229 Bacteria 176176
184 Ga0209563_100061 3300025230 Bacteria 274295
185 Ga0209563_100108 3300025230 Bacteria 143470
186 Ga0207427_101037 3300025231 Bacteria 11594
187 Ga0209258_100072 3300025242 Bacteria 274355
188 Ga0209258_100130 3300025242 Bacteria 176078
189 Ga0209258_101087 3300025242 Bacteria 11629
190 Ga0207425_1003534 3300025245 Bacteria 4972
191 Ga0207425_1008573 3300025245 Bacteria 2606
192 Ga0209646_1000001 3300025246 Bacteria 3092932
193 Ga0209646_1000076 3300025246 Bacteria 212891
194 Ga0209646_1000119 3300025246 Bacteria 147427
195 Ga0209026_1000001 3300025250 Bacteria 1228671
196 Ga0209026_1000011 3300025250 Bacteria 507291
197 Ga0209026_1005478 3300025250 Bacteria 3408
198 Ga0209026_1009263 3300025250 Bacteria 1951
199 Ga0209026_1040838 3300025250 Bacteria 672
200 Ga0209677_100043 3300025253 Bacteria 222331
201 Ga0209677_100070 3300025253 Bacteria 143311
202 Ga0209677_100751 3300025253 Bacteria 16421
203 Ga0209677_102144 3300025253 Bacteria 7722
204 Ga0209677_103667 3300025253 Bacteria 4831
205 Ga0209148_1000451 3300025254 Bacteria 45012
206 Ga0209148_1005580 3300025254 Bacteria 2864
207 Ga0209759_1000001 3300025256 Bacteria 2799452
208 Ga0209759_1000034 3300025256 Bacteria 271209
209 Ga0209759_1001263 3300025256 Bacteria 15243
210 Ga0209759_1001427 3300025256 Bacteria 13561
211 Ga0209759_1001696 3300025256 Bacteria 11450
212 Ga0209759_1001850 3300025256 Bacteria 10558
213 Ga0209759_1010380 3300025256 Bacteria 2735
214 Ga0209759_1028439 3300025256 Bacteria 1137
215 Ga0209565_1000128 3300025263 Bacteria 108959
216 Ga0209565_1000574 3300025263 Bacteria 24961
217 Ga0209455_1000053 3300025272 Bacteria 365949
218 Ga0209455_1000119 3300025272 Bacteria 174994
219 Ga0209673_1000008 3300025273 Bacteria 626013
220 Ga0209673_1002844 3300025273 Bacteria 11093
221 Ga0209673_1015129 3300025273 Bacteria 2948
222 Ga0209130_1000338 3300025284 Bacteria 53907
223 Ga0209675_1000099 3300025291 Bacteria 128911
224 Ga0209675_1002753 3300025291 Bacteria 8784
225 Ga0209676_1000023 3300025292 Bacteria 589732
226 Ga0209025_1017583 3300025294 Bacteria 4114
227 Ga0209025_1053449 3300025294 Bacteria 1584
228 Ga0209025_1092482 3300025294 Bacteria 984
229 Ga0209564_1004187 3300025295 Bacteria 9003
230 Ga0209564_1004612 3300025295 Bacteria 8307
231 Ga0209758_1034227 3300025297 Bacteria 2025
232 Ga0209050_1000022 3300025298 Bacteria 565239
233 Ga0209050_1003036 3300025298 Bacteria 12951
234 Ga0209256_1000001 3300025299 Bacteria 2166974
235 Ga0209256_1001514 3300025299 Bacteria 23507
236 Ga0209256_1001861 3300025299 Bacteria 19505
237 Ga0209256_1009421 3300025299 Bacteria 4287
238 Ga0207426_1006673 3300025302 Bacteria 4959
239 Ga0209051_1000013 3300025303 Bacteria 565239
240 Ga0209051_1000904 3300025303 Bacteria 29543
241 Ga0209051_1001714 3300025303 Bacteria 17502
242 Ga0209257_1000042 3300025304 Bacteria 537149
243 Ga0209257_1002401 3300025304 Bacteria 18726
244 Ga0209257_1003376 3300025304 Bacteria 13783
245 Ga0207656_10268405 3300025321 Bacteria 839
246 Ga0207682_10057400 3300025893 Bacteria 1623
247 Ga0207645_10270211 3300025907 Bacteria 1127
248 Ga0207705_10058109 3300025909 Bacteria 2790
249 Ga0207705_10164385 3300025909 Bacteria 1669
250 Ga0207705_10287975 3300025909 Bacteria 1258
251 Ga0207705_10288564 3300025909 Bacteria 1257
252 Ga0207705_10329956 3300025909 Bacteria 1173
253 Ga0207654_10295144 3300025911 Bacteria 1100
254 Ga0207707_10122443 3300025912 Bacteria 2275
255 Ga0207695_10003341 3300025913 Bacteria 22711
256 Ga0207695_10049643 3300025913 Bacteria 4421
257 Ga0207695_10196497 3300025913 Bacteria 1933
258 Ga0207695_10342398 3300025913 Bacteria 1383
259 Ga0207671_10114797 3300025914 Bacteria 2053
260 Ga0207657_10046458 3300025919 Bacteria 3802
261 Ga0207657_10160485 3300025919 Bacteria 1826
262 Ga0207657_10545874 3300025919 Bacteria 906
263 Ga0207649_10000269 3300025920 Bacteria 41142
264 Ga0207649_10016552 3300025920 Bacteria 4161
265 Ga0207652_10048380 3300025921 Bacteria 3635
266 Ga0207694_10009970 3300025924 Bacteria 7161
267 Ga0207694_10585165 3300025924 Bacteria 938
268 Ga0207650_10064948 3300025925 Bacteria 2733
269 Ga0207659_10024900 3300025926 Bacteria 4016
270 Ga0207687_10075631 3300025927 Bacteria 2417
271 Ga0207664_10497498 3300025929 Bacteria 1091
272 Ga0207644_10153013 3300025931 Bacteria 1786
273 Ga0207690_10146006 3300025932 Bacteria 1749
274 Ga0207690_10411637 3300025932 Bacteria 1080
275 Ga0207690_10595258 3300025932 Bacteria 902
276 Ga0207686_10000954 3300025934 Bacteria 17260
277 Ga0207686_10061479 3300025934 Bacteria 2381
278 Ga0207709_10000111 3300025935 Bacteria 127580
279 Ga0207669_10717534 3300025937 Bacteria 823
280 Ga0207691_10004404 3300025940 Bacteria 13651
281 Ga0207689_10142038 3300025942 Bacteria 1978
282 Ga0207679_10000032 3300025945 Bacteria 158845
283 Ga0207679_10117450 3300025945 Bacteria 2111
284 Ga0207667_10007788 3300025949 Bacteria 12808
285 Ga0207667_10044142 3300025949 Bacteria 4726
286 Ga0207667_10110652 3300025949 Bacteria 2833
287 Ga0207667_10267144 3300025949 Bacteria 1749
288 Ga0207667_10613497 3300025949 Bacteria 1096
289 Ga0207651_10001608 3300025960 Bacteria 10344
290 Ga0207651_10013837 3300025960 Bacteria 4634
291 Ga0207640_10000166 3300025981 Bacteria 47875
292 Ga0207640_10219832 3300025981 Bacteria 1454
293 Ga0207658_10043142 3300025986 Bacteria 3277
294 Ga0207677_10092121 3300026023 Bacteria 2206
295 Ga0207677_10445752 3300026023 Bacteria 1108
296 Ga0207677_10701818 3300026023 Bacteria 898
297 Ga0207639_10558999 3300026041 Bacteria 1051
298 Ga0207678_10000024 3300026067 Bacteria 125239
299 Ga0207678_10896147 3300026067 Bacteria 784
300 Ga0207702_10000615 3300026078 Bacteria 39296
301 Ga0207702_10001565 3300026078 Bacteria 22647
302 Ga0207702_10484416 3300026078 Bacteria 1204
303 Ga0207676_10002741 3300026095 Bacteria 12542
304 Ga0207674_10002639 3300026116 Bacteria 22407
305 Ga0207674_10005653 3300026116 Bacteria 14825
306 Ga0207675_100023249 3300026118 Bacteria 5764
307 Ga0207698_10017878 3300026142 Bacteria 4819
308 Ga0209281_1000017 3300027111 Bacteria 583251
309 Ga0209973_1039673 3300027252 Bacteria 687
310 Ga0209389_1009996 3300027296 Bacteria 8525
311 Ga0209371_1022923 3300027312 Bacteria 1482
312 Ga0209970_1000036 3300027614 Bacteria 17242
313 Ga0209974_10004079 3300027876 Bacteria 5216
314 Ga0207428_10200482 3300027907 Bacteria 1502
315 Ga0265334_10045164 3300028573 Bacteria 1707
316 Ga0265318_10258469 3300028577 Bacteria 635
317 Ga0265336_10000036 3300028666 Bacteria 154609
318 Ga0307515_10000084 3300028794 Bacteria 221434
319 Ga0307515_10038318 3300028794 Bacteria 7672
320 Ga0265338_10003131 3300028800 Bacteria 23632
321 Ga0265338_10694058 3300028800 Bacteria 703
322 Ga0265324_10000136 3300029957 Bacteria 57490
323 Ga0265330_10000156 3300031235 Bacteria 55313
324 Ga0265332_10000157 3300031238 Bacteria 55228
325 Ga0265320_10072161 3300031240 Bacteria 1625
326 Ga0265325_10200630 3300031241 Bacteria 920
327 Ga0265340_10022607 3300031247 Bacteria 3214
328 Ga0307513_10231184 3300031456 Bacteria 1661
329 Ga0307513_10261928 3300031456 Bacteria 1518
330 Ga0307509_10643061 3300031507 Bacteria 730
331 Ga0307509_10740281 3300031507 Bacteria 649
332 Ga0307408_100004302 3300031548 Bacteria 9664
333 Ga0307408_100518879 3300031548 Bacteria 1046
334 Ga0307408_101426479 3300031548 Bacteria 653
335 Ga0265314_10000446 3300031711 Bacteria 55219
336 Ga0307516_10021203 3300031730 Bacteria 6696
337 Ga0307405_10280798 3300031731 Bacteria 1253
338 Ga0307405_10831055 3300031731 Bacteria 776
339 Ga0307412_10262107 3300031911 Bacteria 1348
340 Ga0307416_102507400 3300032002 Bacteria 614
341 Ga0373957_0023394 3300035120 Bacteria 2210
342 Ga0373924_0066829 3300035410 Bacteria 1512
343 Ga0373931_0016210 3300035691 Bacteria 3665
344 Ga0373937_0189006 3300036401 Bacteria 1935
345 Ga0373937_0831009 3300036401 Bacteria 872
346 Ga0373925_0426654 3300037068 Bacteria 1084
347 Ga0395899_0151568 3300037312 Bacteria 1643
348 Ga0395900_0014922 3300037418 Bacteria 7917
349 Ga0395900_0539913 3300037418 Bacteria 1112
350 Ga0395900_1379416 3300037418 Bacteria 618
351 Ga0395898_0369082 3300037466 Bacteria 1369
352 Ga0395905_0531096 3300037471 Bacteria 1077
353 Ga0395901_0003179 3300038443 Bacteria 16526
354 Ga0395901_0885197 3300038443 Bacteria 876
355 Ga0436361_0381336 3300039447 Bacteria 707
356 Ga0436361_0388134 3300039447 Bacteria 756
357 Ga0436361_0549273 3300039447 Bacteria 2452
358 Ga0439461_0015911 3300041410 Bacteria 1446
359 Ga0451791_1346074 3300041451 Bacteria 738
360 Ga0451793_1030503 3300041452 Bacteria 583
361 Ga0451798_0731237 3300041458 Bacteria 824
362 Ga0451807_0036747 3300041486 Bacteria 582
363 Ga0439433_0179655 3300041999 Bacteria 553
364 Ga0439437_037087 3300042000 Bacteria 625
365 Ga0439454_004776 3300042011 Bacteria 1582
366 Ga0439455_0174924 3300042012 Bacteria 617
367 Ga0450912_003141 3300042116 Bacteria 1161
368 Ga0450913_001387 3300042117 Bacteria 1322
369 Ga0450917_000154 3300042120 Bacteria 4576
370 Ga0450888_000254 3300042126 Bacteria 4924
371 Ga0450890_001348 3300042127 Bacteria 3543
372 Ga0450891_001772 3300042129 Bacteria 2221
373 Ga0450892_001657 3300042130 Bacteria 2083
374 Ga0450889_001009 3300042144 Bacteria 2969
375 Ga0450916_008013 3300042530 Bacteria 1278
376 Ga0450916_034789 3300042530 Bacteria 746
377 Ga0450893_0001444 3300042532 Bacteria 3642
378 Ga0450893_0007546 3300042532 Bacteria 1767
379 Ga0451577_0012078 3300042876 Bacteria 8124
380 Ga0466986_0029454 3300044650 Bacteria 3714
381 Ga0466969_0057947 3300044656 Bacteria 1887
382 Ga0466969_0067568 3300044656 Bacteria 1724
383 Ga0466972_0024076 3300044658 Bacteria 3022
384 Ga0466978_0083089 3300044671 Bacteria 1998
385 Ga0466965_0002178 3300044683 Bacteria 8245
386 Ga0466965_0015221 3300044683 Bacteria 3654
387 Ga0466961_0027354 3300044693 Bacteria 3668
388 Ga0466961_0068701 3300044693 Bacteria 2249
389 Ga0466963_0036295 3300044694 Bacteria 3214
390 Ga0466963_0324127 3300044694 Bacteria 1084
391 Ga0466963_0520848 3300044694 Bacteria 840
392 Ga0466964_0001613 3300044706 Bacteria 7783
393 Ga0466964_0011423 3300044706 Bacteria 3354
394 Ga0453684_0029736 3300044712 Bacteria 7744
395 Ga0453684_0180425 3300044712 Bacteria 2479
396 Ga0453684_0724004 3300044712 Bacteria 1079
397 Ga0466971_0092621 3300044719 Bacteria 1384
398 Ga0466968_0013197 3300044735 Bacteria 3245
399 Ga0466970_0005112 3300044765 Bacteria 6478
400 Ga0466970_0056352 3300044765 Bacteria 2100
401 Ga0466957_0006987 3300044842 Bacteria 6380
402 Ga0466957_0309900 3300044842 Bacteria 1062
403 Ga0466959_0028132 3300045049 Bacteria 4169
404 Ga0466959_0037488 3300045049 Bacteria 3582
405 Ga0451576_0010377 3300045051 Bacteria 10695
406 Ga0451576_0598810 3300045051 Bacteria 1158
407 Ga0451576_1146200 3300045051 Bacteria 813
408 Ga0466958_0006073 3300045836 Bacteria 6547
409 Ga0466967_0017789 3300045976 Bacteria 5658
410 Ga0466967_0052030 3300045976 Bacteria 3592
411 Ga0466967_1149848 3300045976 Bacteria 773
412 Ga0495638_0218094 3300046460 Bacteria 1068
413 Ga0495639_0051806 3300046475 Bacteria 1867
414 Ga0495585_0004535 3300046492 Bacteria 8991
415 Ga0495585_0201497 3300046492 Bacteria 1013
416 Ga0495583_0000129 3300046506 Bacteria 126766
417 Ga0495606_0006415 3300046507 Bacteria 10855
418 Ga0495608_0245012 3300046511 Bacteria 1119
419 Ga0495652_0218475 3300046529 Bacteria 1434
420 Ga0495654_0001451 3300046530 Bacteria 16278
421 Ga0495640_0811714 3300046533 Bacteria 557
422 Ga0495597_0000516 3300046542 Bacteria 31996
423 Ga0495668_0077028 3300046616 Bacteria 1831
424 Ga0495646_0266913 3300046680 Bacteria 913
425 Ga0495658_0009588 3300046683 Bacteria 4827
426 Ga0495649_0000524 3300046694 Bacteria 32600
427 Ga0495589_0004395 3300046794 Bacteria 7510
428 Ga0495680_0119830 3300047322 Bacteria 1944
429 Ga0495683_0193841 3300047323 Bacteria 920
430 Ga0496101_0176637 3300048904 Bacteria 1643
431 Ga0496108_0025181 3300048911 Bacteria 4903
432 Ga0496108_0519294 3300048911 Bacteria 1040
433 Ga0496109_0089695 3300048912 Bacteria 2843
434 Ga0496111_0133104 3300048914 Bacteria 1841
435 Ga0496114_0403199 3300048917 Bacteria 1211
436 Ga0496121_0059066 3300048924 Bacteria 3164
437 Ga0496122_0081118 3300048925 Bacteria 2259
438 Ga0496124_0085621 3300048927 Bacteria 2582
439 Ga0496124_0386637 3300048927 Bacteria 976
440 Ga0496125_0001638 3300048928 Bacteria 31567
441 Ga0496125_0017398 3300048928 Bacteria 6855
442 Ga0496125_0038527 3300048928 Bacteria 4134
443 Ga0496125_0064333 3300048928 Bacteria 2915
444 Ga0496126_0178471 3300048929 Bacteria 1805
445 Ga0496126_0194914 3300048929 Bacteria 1714
446 Ga0501309_030902 3300049129 Bacteria 790
447 Ga0501307_021617 3300049162 Bacteria 841
448 Ga0501314_004583 3300049530 Bacteria 1151
449 Ga0501315_004764 3300049531 Bacteria 1436
450 Ga0501031_0012636 3300049568 Bacteria 5514
451 Ga0501227_230908 3300049665 Bacteria 527
452 Ga0501242_043376 3300049674 Bacteria 642
453 Ga0501263_008212 3300049760 Bacteria 1241
454 Ga0501267_000369 3300049764 Bacteria 3408
455 Ga0501268_050472 3300049765 Bacteria 804
456 nmdc:mga03683_34759_c1 3300050489 Bacteria 1333
457 nmdc:mga03n38_164238_c1 3300050490 Bacteria 1126
458 nmdc:mga00v17_250165_c1 3300050491 Bacteria 1149
459 nmdc:mga0k408_12508_c2 3300050493 Bacteria 3792
460 nmdc:mga0k408_359836_c1 3300050493 Bacteria 867
461 nmdc:mga0k408_386282_c1 3300050493 Bacteria 834
462 nmdc:mga0k408_39206_c1 3300050493 Bacteria 2721
463 nmdc:mga07m45_378181_c1 3300050496 Bacteria 822
464 nmdc:mga07m45_522_c1 3300050496 Bacteria 13513
465 Ga0495601_0011961 3300053077 Bacteria 5202
466 Ga0500635_0000030 3300053080 Bacteria 99936
467 Ga0500635_0071638 3300053080 Bacteria 1230
468 Ga0495595_0081825 3300053084 Bacteria 1539
469 Ga0500578_0158515 3300053086 Bacteria 1406
470 Ga0500572_090926 3300053111 Bacteria 967
471 Ga0500608_013000 3300053122 Bacteria 3676
472 Ga0500559_0018963 3300053136 Bacteria 2907
473 Ga0500568_0003789 3300053139 Bacteria 8276
474 Ga0500636_0007280 3300053177 Bacteria 6397
475 Ga0500661_012159 3300055283 Bacteria 1555
476 Ga0587084_029192 3300059477 Bacteria 878
477 Ga0587083_0064109 3300059505 Bacteria 836
478 Ga0587088_004019 3300059508 Bacteria 1830
479 Ga0587091_082352 3300059511 Bacteria 724
480 Ga0587098_006795 3300059604 Bacteria 1172
481 Ga0587106_029154 3300059605 Bacteria 875
482 Ga0587128_021903 3300059630 Bacteria 989
483 Ga0587067_000936 3300059640 Bacteria 2930
484 Ga0587068_009102 3300059641 Bacteria 1455
485 Ga0587072_008875 3300059643 Bacteria 1599
486 Ga0466962_0002224 3300061719 Bacteria 9174
487 2511244650 2511231002 Bacteria 5042903
488 2548499061 2547132374 Bacteria 5530232
489 2597031580 2596583598 Bacteria 5251611
490 2599448045 2599185178 Bacteria 5365746
491 2644062233 2643221609 Bacteria 6756331
492 2644071420 2643221611 Bacteria 6820941
493 2722881914 2721755523 Bacteria 6430384
494 2739058409 2738541337 Bacteria 6183410
495 2739245843 2738543012 Bacteria 7115078
496 2816470537 2816332133 Bacteria 7249298
497 2839144863 2839138175 Bacteria 6549354
498 2885269461 2885266251 Bacteria 4796748
499 2886850379 2886848708 Bacteria 5632523
500 2900580417 2900577576 Bacteria 5438534
501 2919707102 2919704043 Bacteria 5560311
502 2928063660 2928058823 Bacteria 5520022
503 2974320434 2974320154 Bacteria 4571377
504 Ga0068853_100631070
505 JGI24741J21665_1000028
506 JGI24740J21852_10001179
507 JGI24740J21852_10001926
508 JGI25155J39150_1000022
509 JGI25156J39149_1001747
510 JGI25156J39149_1010513
511 JGI25154J39366_1000782
512 JGI25154J39366_1001575
513 JGI25157J39369_1000267
514 JGI25150J39212_1005166
515 JGI25159J45721_1001655
516 JGI25159J45721_1005702
517 Ga0006778J45830_1034936
518 JGI25151J46595_10008108
519 JGI25151J46595_10080009
520 Ga0006777J48905_1039068
521 rootH1_10005761
522 rootH1_10005763
523 rootH2_10188057
524 rootL2_10000300
525 rootH1_10006628
526 rootH1_10037279
527 rootH1_10285916
528 Ga0006562J51391_1041993
529 Ga0006562J51391_1041996
530 Ga0055539_1000218
531 Ga0055539_1000629
532 Ga0055539_1001741
533 Ga0055533_1000045
534 Ga0055533_1002513
535 Ga0055532_1000066
536 Ga0055525_1000508
537 Ga0055525_1000681
538 Ga0055527_1003231
539 Ga0055535_1000046
540 Ga0055535_1000047
541 Ga0055542_1001269
542 Ga0055529_1000087
543 Ga0055529_1000148
544 Ga0055526_1005018
545 Ga0055526_1026899
546 Ga0055537_1000205
547 Ga0055524_1000073
548 Ga0055524_1003149
549 Ga0055524_1006310
550 Ga0055534_1003185
551 Ga0055534_1016112
552 Ga0055528_1000289
553 Ga0055530_10000848
554 Ga0055530_10023684
555 Ga0055540_1000037
556 Ga0055540_1008994
557 Ga0055540_1012084
558 Ga0055531_10006730
559 Ga0055531_10015923
560 Ga0055541_1000458
561 Ga0055541_1006040
562 Ga0055543_1003646
563 Ga0065165_1000177
564 Ga0065165_1028154
565 Ga0065704_10132575
566 Ga0070658_10131807
567 Ga0070658_10162913
568 Ga0070658_10195232
569 Ga0070658_10214041
570 Ga0070658_10231462
571 Ga0070683_101240214
572 Ga0070690_100011825
573 Ga0070670_100001787
574 Ga0070677_10057427
575 Ga0068869_100683689
576 Ga0068869_101146033
577 Ga0068868_100542785
578 Ga0070660_100746875
579 Ga0070689_101691704
580 Ga0070661_100000262
581 Ga0070661_100592101
582 Ga0070661_100728086
583 Ga0070675_100080667
584 Ga0070671_100302083
585 Ga0070674_100820015
586 Ga0070673_100090389
587 Ga0070673_100880911
588 Ga0070659_100010276
589 Ga0070667_100108445
590 Ga0070714_100408005
591 Ga0070663_100000023
592 Ga0070678_100077866
593 Ga0070681_10295848
594 Ga0068867_100530378
595 Ga0070707_100410982
596 Ga0070699_100297848
597 Ga0070679_100041543
598 Ga0068853_100764927
599 Ga0070672_100036721
600 Ga0068855_100006806
601 Ga0068855_100008847
602 Ga0070664_100000018
603 Ga0068857_100013055
604 Ga0068854_100000172
605 Ga0068854_100060333
606 Ga0068856_100000070
607 Ga0068856_100001716
608 Ga0068856_100184807
609 Ga0068856_100994231
610 Ga0070702_100666645
611 Ga0068852_100064160
612 Ga0068852_100295795
613 Ga0068852_100523313
614 Ga0068864_100013594
615 Ga0068861_100053942
616 Ga0068858_100386328
617 Ga0075365_10041054
618 Ga0075364_10280407
619 Ga0075432_10005352
620 Ga0075362_10089716
621 Ga0075362_10232635
622 Ga0075366_10013052
623 Ga0075366_10101384
624 Ga0075366_10252601
625 Ga0097621_101128027
626 Ga0075370_10009322
627 Ga0075370_10013610
628 Ga0075370_10448060
629 Ga0068871_100071350
630 Ga0099823_1000139
631 Ga0105240_10008945
632 Ga0105240_10187562
633 Ga0105240_10305376
634 Ga0105240_10335499
635 Ga0105240_12510791
636 Ga0105245_10123990
637 Ga0114129_11090694
638 Ga0105241_10185778
639 Ga0105242_10001936
640 Ga0105237_10922694
641 Ga0105238_10005849
642 Ga0105238_10035826
643 Ga0105239_10241713
644 Ga0105246_10140899
645 Ga0157319_1000008
646 Ga0157326_1001164
647 Ga0157373_10031842
648 Ga0157371_10000275
649 Ga0157371_11287482
650 Ga0157370_10000237
651 Ga0157369_10014161
652 Ga0157369_10075100
653 Ga0157374_10330368
654 Ga0157378_10116216
655 Ga0163162_10963971
656 Ga0157372_10003200
657 Ga0157372_10238484
658 Ga0157375_10858386
659 Ga0163163_10280743
660 Ga0182008_10015684
661 Ga0157379_10557773
662 Ga0157376_10047410
663 Ga0157376_10314695
664 Ga0157376_10572452
665 Ga0182006_1000649
666 Ga0182007_10023578
667 Ga0182007_10043506
668 Ga0163161_10461803
669 Ga0197907_11174022
670 Ga0206356_10395674
671 Ga0206351_10335588
672 Ga0206352_11359209
673 Ga0206350_10996245
674 Ga0154015_1075080
675 Ga0224712_10054633
676 Ga0209435_100002
677 Ga0209784_100052
678 Ga0209566_100068
679 Ga0209566_100235
680 Ga0209566_101594
681 Ga0209674_100073
682 Ga0209674_100087
683 Ga0209674_100189
684 Ga0209672_100308
685 Ga0209672_104105
686 Ga0209147_100090
687 Ga0209563_100061
688 Ga0209563_100108
689 Ga0207427_101037
690 Ga0209258_100072
691 Ga0209258_100130
692 Ga0209258_101087
693 Ga0207425_1003534
694 Ga0207425_1008573
695 Ga0209646_1000001
696 Ga0209646_1000076
697 Ga0209646_1000119
698 Ga0209026_1000001
699 Ga0209026_1000011
700 Ga0209026_1005478
701 Ga0209026_1009263
702 Ga0209026_1040838
703 Ga0209677_100043
704 Ga0209677_100070
705 Ga0209677_100751
706 Ga0209677_102144
707 Ga0209677_103667
708 Ga0209148_1000451
709 Ga0209148_1005580
710 Ga0209759_1000001
711 Ga0209759_1000034
712 Ga0209759_1001263
713 Ga0209759_1001427
714 Ga0209759_1001696
715 Ga0209759_1001850
716 Ga0209759_1010380
717 Ga0209759_1028439
718 Ga0209565_1000128
719 Ga0209565_1000574
720 Ga0209455_1000053
721 Ga0209455_1000119
722 Ga0209673_1000008
723 Ga0209673_1002844
724 Ga0209673_1015129
725 Ga0209130_1000338
726 Ga0209675_1000099
727 Ga0209675_1002753
728 Ga0209676_1000023
729 Ga0209025_1017583
730 Ga0209025_1053449
731 Ga0209025_1092482
732 Ga0209564_1004187
733 Ga0209564_1004612
734 Ga0209758_1034227
735 Ga0209050_1000022
736 Ga0209050_1003036
737 Ga0209256_1000001
738 Ga0209256_1001514
739 Ga0209256_1001861
740 Ga0209256_1009421
741 Ga0207426_1006673
742 Ga0209051_1000013
743 Ga0209051_1000904
744 Ga0209051_1001714
745 Ga0209257_1000042
746 Ga0209257_1002401
747 Ga0209257_1003376
748 Ga0207656_10268405
749 Ga0207682_10057400
750 Ga0207645_10270211
751 Ga0207705_10058109
752 Ga0207705_10164385
753 Ga0207705_10287975
754 Ga0207705_10288564
755 Ga0207705_10329956
756 Ga0207654_10295144
757 Ga0207707_10122443
758 Ga0207695_10003341
759 Ga0207695_10049643
760 Ga0207695_10196497
761 Ga0207695_10342398
762 Ga0207671_10114797
763 Ga0207657_10046458
764 Ga0207657_10160485
765 Ga0207657_10545874
766 Ga0207649_10000269
767 Ga0207649_10016552
768 Ga0207652_10048380
769 Ga0207694_10009970
770 Ga0207694_10585165
771 Ga0207650_10064948
772 Ga0207659_10024900
773 Ga0207687_10075631
774 Ga0207664_10497498
775 Ga0207644_10153013
776 Ga0207690_10146006
777 Ga0207690_10411637
778 Ga0207690_10595258
779 Ga0207686_10000954
780 Ga0207686_10061479
781 Ga0207709_10000111
782 Ga0207669_10717534
783 Ga0207691_10004404
784 Ga0207689_10142038
785 Ga0207679_10000032
786 Ga0207679_10117450
787 Ga0207667_10007788
788 Ga0207667_10044142
789 Ga0207667_10110652
790 Ga0207667_10267144
791 Ga0207667_10613497
792 Ga0207651_10001608
793 Ga0207651_10013837
794 Ga0207640_10000166
795 Ga0207640_10219832
796 Ga0207658_10043142
797 Ga0207677_10092121
798 Ga0207677_10445752
799 Ga0207677_10701818
800 Ga0207639_10558999
801 Ga0207678_10000024
802 Ga0207678_10896147
803 Ga0207702_10000615
804 Ga0207702_10001565
805 Ga0207702_10484416
806 Ga0207676_10002741
807 Ga0207674_10002639
808 Ga0207674_10005653
809 Ga0207675_100023249
810 Ga0207698_10017878
811 Ga0209281_1000017
812 Ga0209973_1039673
813 Ga0209389_1009996
814 Ga0209371_1022923
815 Ga0209970_1000036
816 Ga0209974_10004079
817 Ga0207428_10200482
818 Ga0265334_10045164
819 Ga0265318_10258469
820 Ga0265336_10000036
821 Ga0307515_10000084
822 Ga0307515_10038318
823 Ga0265338_10003131
824 Ga0265338_10694058
825 Ga0265324_10000136
826 Ga0265330_10000156
827 Ga0265332_10000157
828 Ga0265320_10072161
829 Ga0265325_10200630
830 Ga0265340_10022607
831 Ga0307513_10231184
832 Ga0307513_10261928
833 Ga0307509_10643061
834 Ga0307509_10740281
835 Ga0307408_100004302
836 Ga0307408_100518879
837 Ga0307408_101426479
838 Ga0265314_10000446
839 Ga0307516_10021203
840 Ga0307405_10280798
841 Ga0307405_10831055
842 Ga0307412_10262107
843 Ga0307416_102507400
844 Ga0373957_0023394
845 Ga0373924_0066829
846 Ga0373931_0016210
847 Ga0373937_0189006
848 Ga0373937_0831009
849 Ga0373925_0426654
850 Ga0395899_0151568
851 Ga0395900_0014922
852 Ga0395900_0539913
853 Ga0395900_1379416
854 Ga0395898_0369082
855 Ga0395905_0531096
856 Ga0395901_0003179
857 Ga0395901_0885197
858 Ga0436361_0381336
859 Ga0436361_0388134
860 Ga0436361_0549273
861 Ga0439461_0015911
862 Ga0451791_1346074
863 Ga0451793_1030503
864 Ga0451798_0731237
865 Ga0451807_0036747
866 Ga0439433_0179655
867 Ga0439437_037087
868 Ga0439454_004776
869 Ga0439455_0174924
870 Ga0450912_003141
871 Ga0450913_001387
872 Ga0450917_000154
873 Ga0450888_000254
874 Ga0450890_001348
875 Ga0450891_001772
876 Ga0450892_001657
877 Ga0450889_001009
878 Ga0450916_008013
879 Ga0450916_034789
880 Ga0450893_0001444
881 Ga0450893_0007546
882 Ga0451577_0012078
883 Ga0466986_0029454
884 Ga0466969_0057947
885 Ga0466969_0067568
886 Ga0466972_0024076
887 Ga0466978_0083089
888 Ga0466965_0002178
889 Ga0466965_0015221
890 Ga0466961_0027354
891 Ga0466961_0068701
892 Ga0466963_0036295
893 Ga0466963_0324127
894 Ga0466963_0520848
895 Ga0466964_0001613
896 Ga0466964_0011423
897 Ga0453684_0029736
898 Ga0453684_0180425
899 Ga0453684_0724004
900 Ga0466971_0092621
901 Ga0466968_0013197
902 Ga0466970_0005112
903 Ga0466970_0056352
904 Ga0466957_0006987
905 Ga0466957_0309900
906 Ga0466959_0028132
907 Ga0466959_0037488
908 Ga0451576_0010377
909 Ga0451576_0598810
910 Ga0451576_1146200
911 Ga0466958_0006073
912 Ga0466967_0017789
913 Ga0466967_0052030
914 Ga0466967_1149848
915 Ga0495638_0218094
916 Ga0495639_0051806
917 Ga0495585_0004535
918 Ga0495585_0201497
919 Ga0495583_0000129
920 Ga0495606_0006415
921 Ga0495608_0245012
922 Ga0495652_0218475
923 Ga0495654_0001451
924 Ga0495640_0811714
925 Ga0495597_0000516
926 Ga0495668_0077028
927 Ga0495646_0266913
928 Ga0495658_0009588
929 Ga0495649_0000524
930 Ga0495589_0004395
931 Ga0495680_0119830
932 Ga0495683_0193841
933 Ga0496101_0176637
934 Ga0496108_0025181
935 Ga0496108_0519294
936 Ga0496109_0089695
937 Ga0496111_0133104
938 Ga0496114_0403199
939 Ga0496121_0059066
940 Ga0496122_0081118
941 Ga0496124_0085621
942 Ga0496124_0386637
943 Ga0496125_0001638
944 Ga0496125_0017398
945 Ga0496125_0038527
946 Ga0496125_0064333
947 Ga0496126_0178471
948 Ga0496126_0194914
949 Ga0501309_030902
950 Ga0501307_021617
951 Ga0501314_004583
952 Ga0501315_004764
953 Ga0501031_0012636
954 Ga0501227_230908
955 Ga0501242_043376
956 Ga0501263_008212
957 Ga0501267_000369
958 Ga0501268_050472
959 nmdc:mga03683_34759_c1
960 nmdc:mga03n38_164238_c1
961 nmdc:mga00v17_250165_c1
962 nmdc:mga0k408_12508_c2
963 nmdc:mga0k408_359836_c1
964 nmdc:mga0k408_386282_c1
965 nmdc:mga0k408_39206_c1
966 nmdc:mga07m45_378181_c1
967 nmdc:mga07m45_522_c1
968 Ga0495601_0011961
969 Ga0500635_0000030
970 Ga0500635_0071638
971 Ga0495595_0081825
972 Ga0500578_0158515
973 Ga0500572_090926
974 Ga0500608_013000
975 Ga0500559_0018963
976 Ga0500568_0003789
977 Ga0500636_0007280
978 Ga0500661_012159
979 Ga0587084_029192
980 Ga0587083_0064109
981 Ga0587088_004019
982 Ga0587091_082352
983 Ga0587098_006795
984 Ga0587106_029154
985 Ga0587128_021903
986 Ga0587067_000936
987 Ga0587068_009102
988 Ga0587072_008875
989 Ga0466962_0002224
990 2511244650
991 2548499061
992 2597031580
993 2599448045
994 2644062233
995 2644071420
996 2722881914
997 2739058409
998 2739245843
999 2816470537
1000 2839144863
1001 2885269461
1002 2886850379
1003 2900580417
1004 2919707102
1005 2928063660
1006 2974320434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

4

72

0.89

Map