F455993

General Info

Members Datasets Scaffolds Average Seq Length
503 314 1006 453

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1012186|Ga0079104_10121862
Length 494
Sequence MRGGEGFSAASAIGYNARLPGIFMTPNMQSQPLSRITKPAAATTISGAAPKVGFVSLGCPKALVDSEQILTQLRAEGYETAKSYDGADLVIVNTCGFIDAAVQESLDAIGEALAENGKVIVTGCLGAKKDAAGDDIIMKVHPKVLAVTGPHALAEVMDSVHFHLPKPHEPFIDLLPPQGIKLTPKHYAYLKISEGCNHRCSFCIIPSMRGDLVSRPIGELLLEAENLFKSGVKELLVISQDTSAYGVDVKFRTGFWNGRPIKTHMTQLMEALGELAKSHGAWVRMHYVYPYPHVDQVIPMMGEHVLPYLDIPMQHAHPDVLKRMKRPASGEKNLDRILAWRKMNPDLTIRSTFIAGFPGETEEEFQYLLDFLKEAQIDRLGCFAYSPVEGATANELANPVPEEVREERRGRVMLLQEEISKNRLKAKVGKTVRVLIDEVNRTGGVGRSAADAPEIDGVVYVKPPYEPHKKLVVGQFVDVRITTSDAHDLWGEAQ

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
118 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
134 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
135 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
138 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
241 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
242 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
243 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
244 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
245 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
246 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
247 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
248 2547132512 Azospira oryzae 6a3 Isolate Unclassified
249 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
250 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
251 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
252 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
253 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
254 2643221638 Duganella sp. Root336D2 Isolate Unclassified
255 2643221645 Massilia sp. Root351 Isolate Unclassified
256 2643221664 Massilia sp. Root418 Isolate Unclassified
257 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
258 2738541280 Massilia sp. GV090 Isolate Unclassified
259 2738541297 Duganella sp. GV083 Isolate Unclassified
260 2738541300 Massilia sp. GV016 Isolate Unclassified
261 2738541357 Duganella sp. GV053 Isolate Unclassified
262 2738543003 Duganella sp. GV066 Isolate Unclassified
263 2738543018 Massilia sp. GV045 Isolate Unclassified
264 2738543026 Duganella sp. GV089 Isolate Unclassified
265 2738543029 Duganella sp. GV039 Isolate Unclassified
266 2738543030 Massilia sp. GV097 Isolate Unclassified
267 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
268 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
269 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
270 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
271 2818991436 Collimonas arenae 515 Isolate Unclassified
272 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
273 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
274 2821131069 Duganella sp. 1224 Isolate Unclassified
275 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
276 2842711865 Duganella sp. R-73148 Isolate Unclassified
277 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
278 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
279 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
280 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
281 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
282 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
283 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
284 2857553236 Duganella sp. R-74557 Isolate Unclassified
285 2857558681 Duganella sp. R-74565 Isolate Unclassified
286 2857564685 Duganella sp. R-74599 Isolate Unclassified
287 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
288 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
289 2876601092 Pantoea endophytica 596 Isolate Unclassified
290 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
291 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
292 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
293 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
294 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
295 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
296 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
297 2904424332 Duganella sp. 1411 Isolate Rhizosphere
298 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
299 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
300 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
301 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
302 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
303 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
304 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
305 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
306 2919476304 Duganella sp. 3397 Isolate Unclassified
307 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
308 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
309 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
310 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
311 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
312 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
313 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
314 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.69
Metatranscriptomes 0.6
Isolates 14.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.88
Nodule 1.39
Rhizoplane 1.19
Rhizosphere 59.44
Stem 0
Stem Tuber 0.99
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1012186 3300006946 Bacteria 2721
2 JGI25156J39149_1000892 3300002705 Bacteria 14717
3 JGI25162J39368_1000015 3300002737 Bacteria 316381
4 JGI25154J39366_1000326 3300002738 Bacteria 27616
5 JGI25154J39366_1000411 3300002738 Bacteria 23133
6 JGI25154J39366_1000643 3300002738 Bacteria 16415
7 JGI25157J39369_1000382 3300002741 Bacteria 30479
8 JGI25152J39213_1000215 3300002773 Bacteria 39286
9 JGI25150J39212_1000217 3300002774 Bacteria 31369
10 JGI25150J39212_1005926 3300002774 Bacteria 2569
11 JGI25159J45721_1001651 3300002987 Bacteria 9072
12 JGI25159J45721_1002121 3300002987 Bacteria 7768
13 JGI25165J46597_1000001 3300003214 Bacteria 1111887
14 JGI25153J46596_10004709 3300003215 Bacteria 7283
15 JGI25161J50226_1001110 3300003374 Bacteria 9072
16 Ga0007417J51691_1018264 3300003544 Bacteria 1469
17 Ga0055538_1000001 3300003751 Bacteria 1111887
18 Ga0055538_1000016 3300003751 Bacteria 305460
19 Ga0055539_1000001 3300003752 Bacteria 1111887
20 Ga0055539_1000021 3300003752 Bacteria 305460
21 Ga0055533_1000003 3300003756 Bacteria 1111887
22 Ga0055533_1000029 3300003756 Bacteria 305460
23 Ga0055532_1000050 3300003758 Bacteria 169240
24 Ga0055525_1000003 3300003759 Bacteria 962094
25 Ga0055525_1000033 3300003759 Bacteria 305460
26 Ga0055529_1000128 3300003763 Bacteria 108143
27 Ga0055526_1000013 3300003771 Bacteria 233580
28 Ga0055526_1000019 3300003771 Bacteria 189698
29 Ga0055526_1002048 3300003771 Bacteria 13854
30 Ga0055526_1002060 3300003771 Bacteria 13811
31 Ga0055526_1024791 3300003771 Bacteria 1947
32 Ga0055537_1000417 3300003773 Bacteria 27822
33 Ga0055524_1000152 3300003775 Bacteria 82221
34 Ga0055534_1000045 3300003784 Bacteria 98659
35 Ga0055528_1000414 3300003790 Bacteria 34502
36 Ga0055530_10001777 3300003791 Bacteria 14988
37 Ga0055531_10020122 3300003794 Bacteria 2659
38 Ga0055541_1000001 3300003841 Bacteria 1111887
39 Ga0055541_1000045 3300003841 Bacteria 148620
40 Ga0058692_1005373 3300003856 Bacteria 3654
41 Ga0055543_1001517 3300004625 Bacteria 9110
42 Ga0065165_1000005 3300005262 Bacteria 370361
43 Ga0065165_1004234 3300005262 Bacteria 9110
44 Ga0065714_10066282 3300005288 Bacteria 7208
45 Ga0070682_100016365 3300005337 Bacteria 4311
46 Ga0068868_100100915 3300005338 Bacteria 2335
47 Ga0070661_100005485 3300005344 Bacteria 8747
48 Ga0070659_100015122 3300005366 Bacteria 5773
49 Ga0070705_100016350 3300005440 Bacteria 3854
50 Ga0068855_100004974 3300005563 Bacteria 16215
51 Ga0068857_100160514 3300005577 Bacteria 2040
52 Ga0068854_100003581 3300005578 Bacteria 9709
53 Ga0070717_10141670 3300006028 Bacteria 2074
54 Ga0075364_10015144 3300006051 Bacteria 4775
55 Ga0075366_10025791 3300006195 Bacteria 3437
56 Ga0068865_100034475 3300006881 Bacteria 3396
57 Ga0099826_10000001 3300006948 Bacteria 1155201
58 Ga0105244_10002333 3300009036 Bacteria 14434
59 Ga0105250_10010117 3300009092 Bacteria 3938
60 Ga0105240_10003428 3300009093 Bacteria 24641
61 Ga0105240_10021627 3300009093 Bacteria 8555
62 Ga0105237_10002683 3300009545 Bacteria 21815
63 Ga0105238_10000469 3300009551 Bacteria 42413
64 Ga0105239_10201988 3300010375 Bacteria 2227
65 Ga0105246_10013303 3300011119 Bacteria 5157
66 Ga0105246_10142880 3300011119 Bacteria 1802
67 Ga0157373_10000468 3300013100 Bacteria 32134
68 Ga0157371_10000353 3300013102 Bacteria 58606
69 Ga0157371_10003483 3300013102 Bacteria 14237
70 Ga0182008_10001162 3300014497 Bacteria 18138
71 Ga0182008_10056179 3300014497 Bacteria 1946
72 Ga0182006_1000042 3300015261 Bacteria 202969
73 Ga0182006_1000052 3300015261 Bacteria 182886
74 Ga0182006_1005429 3300015261 Bacteria 6081
75 Ga0182006_1013848 3300015261 Bacteria 3488
76 Ga0182006_1021851 3300015261 Bacteria 2664
77 Ga0182005_1000002 3300015265 Bacteria 908499
78 Ga0182005_1000008 3300015265 Bacteria 471394
79 Ga0182005_1004259 3300015265 Bacteria 4663
80 Ga0163161_10086892 3300017792 Bacteria 2309
81 Ga0213872_10000019 3300021361 Bacteria 172803
82 Ga0213872_10000264 3300021361 Bacteria 45420
83 Ga0213872_10002218 3300021361 Bacteria 11622
84 Ga0209435_100029 3300025206 Bacteria 176358
85 Ga0209436_101380 3300025208 Bacteria 8576
86 Ga0209436_103410 3300025208 Bacteria 4242
87 Ga0209784_100004 3300025224 Bacteria 1378156
88 Ga0209784_100033 3300025224 Bacteria 305649
89 Ga0209566_100004 3300025225 Bacteria 1531866
90 Ga0209566_100037 3300025225 Bacteria 305649
91 Ga0209674_100006 3300025226 Bacteria 1531866
92 Ga0209674_100055 3300025226 Bacteria 305649
93 Ga0209672_103565 3300025228 Bacteria 3166
94 Ga0209147_100004 3300025229 Bacteria 1371850
95 Ga0209563_100009 3300025230 Bacteria 1378156
96 Ga0209563_100056 3300025230 Bacteria 305649
97 Ga0207427_100238 3300025231 Bacteria 44888
98 Ga0209437_100004 3300025233 Bacteria 1378156
99 Ga0209437_100053 3300025233 Bacteria 375580
100 Ga0209437_104064 3300025233 Bacteria 2594
101 Ga0209258_100720 3300025242 Bacteria 22119
102 Ga0207425_1000001 3300025245 Bacteria 2525432
103 Ga0207425_1000056 3300025245 Bacteria 151802
104 Ga0207425_1000178 3300025245 Bacteria 52247
105 Ga0209646_1000007 3300025246 Bacteria 670994
106 Ga0209646_1000073 3300025246 Bacteria 224301
107 Ga0209646_1000109 3300025246 Bacteria 158348
108 Ga0209026_1000467 3300025250 Bacteria 31163
109 Ga0209026_1004099 3300025250 Bacteria 4488
110 Ga0209026_1004249 3300025250 Bacteria 4344
111 Ga0209677_100005 3300025253 Bacteria 1378156
112 Ga0209677_100034 3300025253 Bacteria 305649
113 Ga0209759_1000064 3300025256 Bacteria 193120
114 Ga0209759_1000698 3300025256 Bacteria 30092
115 Ga0209129_1000003 3300025258 Bacteria 903689
116 Ga0209129_1006539 3300025258 Bacteria 3733
117 Ga0209233_1000005 3300025261 Bacteria 1531866
118 Ga0209565_1000003 3300025263 Bacteria 1099648
119 Ga0209565_1000900 3300025263 Bacteria 16075
120 Ga0209565_1001280 3300025263 Bacteria 11665
121 Ga0209565_1004563 3300025263 Bacteria 4186
122 Ga0209455_1000026 3300025272 Bacteria 653778
123 Ga0209673_1000003 3300025273 Bacteria 980859
124 Ga0209130_1000046 3300025284 Bacteria 236658
125 Ga0209130_1001741 3300025284 Bacteria 12990
126 Ga0209130_1011557 3300025284 Bacteria 2359
127 Ga0209675_1000003 3300025291 Bacteria 1003982
128 Ga0209675_1009239 3300025291 Bacteria 3501
129 Ga0209025_1002173 3300025294 Bacteria 21804
130 Ga0209025_1005843 3300025294 Bacteria 9850
131 Ga0209564_1000002 3300025295 Bacteria 1636803
132 Ga0209564_1000007 3300025295 Bacteria 1028582
133 Ga0209564_1000012 3300025295 Bacteria 792078
134 Ga0209564_1000272 3300025295 Bacteria 108384
135 Ga0209564_1005898 3300025295 Bacteria 6792
136 Ga0209758_1000041 3300025297 Bacteria 410328
137 Ga0209758_1000475 3300025297 Bacteria 66207
138 Ga0209050_1000011 3300025298 Bacteria 914037
139 Ga0209050_1000089 3300025298 Bacteria 256212
140 Ga0209050_1000470 3300025298 Bacteria 71502
141 Ga0209256_1000007 3300025299 Bacteria 1136599
142 Ga0209256_1000068 3300025299 Bacteria 246064
143 Ga0209256_1000112 3300025299 Bacteria 178432
144 Ga0209256_1001080 3300025299 Bacteria 31504
145 Ga0209256_1007418 3300025299 Bacteria 5412
146 Ga0207426_1001589 3300025302 Bacteria 18204
147 Ga0209257_1000003 3300025304 Bacteria 1702593
148 Ga0207696_1000867 3300025711 Bacteria 18953
149 Ga0207713_1011442 3300025735 Bacteria 4823
150 Ga0207695_10007561 3300025913 Bacteria 13776
151 Ga0207695_10009889 3300025913 Bacteria 11720
152 Ga0207695_10059896 3300025913 Bacteria 3945
153 Ga0207671_10003909 3300025914 Bacteria 14522
154 Ga0207649_10006511 3300025920 Bacteria 6345
155 Ga0207694_10001679 3300025924 Bacteria 18564
156 Ga0207700_10012311 3300025928 Bacteria 5509
157 Ga0207664_10010718 3300025929 Bacteria 6482
158 Ga0207664_10130017 3300025929 Bacteria 2119
159 Ga0207690_10006002 3300025932 Bacteria 7197
160 Ga0207690_10115650 3300025932 Bacteria 1939
161 Ga0207679_10004729 3300025945 Bacteria 8475
162 Ga0207679_10158834 3300025945 Bacteria 1849
163 Ga0207667_10000073 3300025949 Bacteria 174391
164 Ga0207667_10000076 3300025949 Bacteria 166704
165 Ga0207667_10000147 3300025949 Bacteria 106918
166 Ga0207667_10000166 3300025949 Bacteria 97376
167 Ga0207667_10010225 3300025949 Bacteria 10986
168 Ga0207667_10085215 3300025949 Bacteria 3271
169 Ga0207640_10033305 3300025981 Bacteria 3204
170 Ga0207677_10147134 3300026023 Bacteria 1812
171 Ga0209281_1007318 3300027111 Bacteria 2780
172 Ga0209371_1000695 3300027312 Bacteria 28605
173 Ga0209282_1000001 3300027666 Bacteria 2450367
174 Ga0265334_10000021 3300028573 Bacteria 132223
175 Ga0265338_10005703 3300028800 Bacteria 16106
176 Ga0314311_1258383 3300030733 Bacteria 1605
177 Ga0265316_10128999 3300031344 Bacteria 1906
178 Ga0307509_10000079 3300031507 Bacteria 135772
179 Ga0307509_10180080 3300031507 Bacteria 1980
180 Ga0307408_100000903 3300031548 Bacteria 23332
181 Ga0307408_100022032 3300031548 Bacteria 4322
182 Ga0265313_10000275 3300031595 Bacteria 56249
183 Ga0265313_10006074 3300031595 Bacteria 8709
184 Ga0316575_10000866 3300031665 Bacteria 9296
185 Ga0316579_10017553 3300031691 Bacteria 3138
186 Ga0316579_10063257 3300031691 Bacteria 1744
187 Ga0265314_10015022 3300031711 Bacteria 6164
188 Ga0316578_10017025 3300031728 Bacteria 3947
189 Ga0316577_10015402 3300031733 Bacteria 4207
190 Ga0307414_10010455 3300032004 Bacteria 5385
191 Ga0316585_10001860 3300032137 Bacteria 5636
192 Ga0316593_10000946 3300032168 Bacteria 5979
193 Ga0316593_10009601 3300032168 Bacteria 2741
194 Ga0373944_0016385 3300035089 Bacteria 2089
195 Ga0373946_0017883 3300035171 Bacteria 2715
196 Ga0316574_0012880 3300035398 Bacteria 4794
197 Ga0316574_0060472 3300035398 Bacteria 2378
198 Ga0316574_0086342 3300035398 Bacteria 1997
199 Ga0373924_0013437 3300035410 Bacteria 3077
200 Ga0373927_0000001 3300035695 Bacteria 1082160
201 Ga0373927_0020022 3300035695 Bacteria 4387
202 Ga0373933_0093899 3300035724 Bacteria 1855
203 Ga0373937_0052208 3300036401 Bacteria 3748
204 Ga0316582_0007148 3300036647 Bacteria 5933
205 Ga0316582_0020677 3300036647 Bacteria 3875
206 Ga0316582_0023997 3300036647 Bacteria 3642
207 Ga0316584_0004910 3300036712 Bacteria 8898
208 Ga0316584_0011597 3300036712 Bacteria 6198
209 Ga0316584_0024664 3300036712 Bacteria 4404
210 Ga0395899_0001574 3300037312 Bacteria 19187
211 Ga0395899_0001610 3300037312 Bacteria 18879
212 Ga0395900_0043594 3300037418 Bacteria 4624
213 Ga0395900_0059334 3300037418 Bacteria 3938
214 Ga0395905_0002252 3300037471 Bacteria 21683
215 Ga0395905_0002305 3300037471 Bacteria 21378
216 Ga0395905_0020485 3300037471 Bacteria 6266
217 Ga0316581_0000832 3300037588 Bacteria 6458
218 Ga0316581_0022623 3300037588 Bacteria 1854
219 Ga0395901_0069482 3300038443 Bacteria 3668
220 Ga0395901_0107480 3300038443 Bacteria 2929
221 Ga0400490_15415 3300038726 Bacteria 9869
222 Ga0400490_15512 3300038726 Bacteria 21851
223 Ga0400490_42399 3300038726 Bacteria 3870
224 Ga0400490_43208 3300038726 Bacteria 40847
225 Ga0400488_62806 3300038741 Bacteria 6745
226 Ga0400486_15667 3300038742 Bacteria 16408
227 Ga0400483_196187 3300039062 Bacteria 25625
228 Ga0400483_225203 3300039062 Bacteria 6113
229 Ga0400489_22278 3300039093 Unclassified 4060
230 Ga0400489_57664 3300039093 Bacteria 35187
231 Ga0400489_74893 3300039093 Bacteria 1208
232 Ga0400487_21768 3300039110 Bacteria 3571
233 Ga0400487_43094 3300039110 Bacteria 17442
234 Ga0436361_0565150 3300039447 Bacteria 81523
235 Ga0436361_0589877 3300039447 Bacteria 17717
236 Ga0436361_0793274 3300039447 Bacteria 2623
237 Ga0439438_000001 3300041405 Bacteria 1263568
238 Ga0439432_003713 3300042006 Bacteria 5648
239 Ga0466972_0000005 3300044658 Bacteria 289640
240 Ga0466972_0008997 3300044658 Bacteria 5013
241 Ga0466977_0030594 3300044666 Bacteria 3437
242 Ga0453683_0022973 3300044673 Bacteria 3975
243 Ga0466965_0048283 3300044683 Bacteria 2109
244 Ga0453684_0010310 3300044712 Bacteria 16003
245 Ga0453684_0046690 3300044712 Bacteria 5756
246 Ga0453684_0053624 3300044712 Bacteria 5261
247 Ga0453684_0054976 3300044712 Bacteria 5179
248 Ga0453684_0061399 3300044712 Bacteria 4824
249 Ga0453684_0148447 3300044712 Bacteria 2789
250 Ga0453684_0173345 3300044712 Unclassified 2540
251 Ga0466959_0044872 3300045049 Bacteria 3256
252 Ga0451576_0001867 3300045051 Bacteria 34008
253 Ga0451576_0003867 3300045051 Bacteria 20079
254 Ga0451576_0019998 3300045051 Bacteria 7298
255 Ga0451576_0069565 3300045051 Bacteria 3663
256 Ga0451576_0262288 3300045051 Unclassified 1806
257 Ga0495617_000072 3300046452 Bacteria 80951
258 Ga0495627_000001 3300046453 Bacteria 1104709
259 Ga0495590_0000005 3300046457 Bacteria 384276
260 Ga0495591_000014 3300046458 Bacteria 254281
261 Ga0495638_0000349 3300046460 Bacteria 57958
262 Ga0495651_0010041 3300046462 Bacteria 7277
263 Ga0495653_0000040 3300046463 Bacteria 119794
264 Ga0495650_0000032 3300046471 Bacteria 425389
265 Ga0495650_0000044 3300046471 Bacteria 355139
266 Ga0495650_0000066 3300046471 Bacteria 272883
267 Ga0495650_0000490 3300046471 Bacteria 60177
268 Ga0495650_0000517 3300046471 Bacteria 57394
269 Ga0495580_0010521 3300046472 Bacteria 7202
270 Ga0495605_0000038 3300046474 Bacteria 197063
271 Ga0495639_0010588 3300046475 Bacteria 3971
272 Ga0495584_0000338 3300046491 Bacteria 32518
273 Ga0495584_0004194 3300046491 Bacteria 7777
274 Ga0495584_0035290 3300046491 Bacteria 2528
275 Ga0495585_0002199 3300046492 Bacteria 14166
276 Ga0495596_0002938 3300046500 Bacteria 8845
277 Ga0495596_0015658 3300046500 Bacteria 3169
278 Ga0495607_0002978 3300046501 Bacteria 13280
279 Ga0495607_0010211 3300046501 Bacteria 6316
280 Ga0495607_0042409 3300046501 Bacteria 2697
281 Ga0495583_0000100 3300046506 Bacteria 145745
282 Ga0495583_0000117 3300046506 Bacteria 135061
283 Ga0495583_0001088 3300046506 Bacteria 30090
284 Ga0495606_0000053 3300046507 Bacteria 200818
285 Ga0495606_0000087 3300046507 Bacteria 156407
286 Ga0495606_0000202 3300046507 Bacteria 103924
287 Ga0495606_0002790 3300046507 Bacteria 19512
288 Ga0495606_0003035 3300046507 Bacteria 18341
289 Ga0495606_0003994 3300046507 Bacteria 15071
290 Ga0495606_0076125 3300046507 Bacteria 2098
291 Ga0495608_0026925 3300046511 Bacteria 3916
292 Ga0495610_0000008 3300046512 Bacteria 622732
293 Ga0495610_0003853 3300046512 Bacteria 11404
294 Ga0495610_0017089 3300046512 Bacteria 4147
295 Ga0495616_0021191 3300046513 Bacteria 3523
296 Ga0495628_0003181 3300046516 Bacteria 14713
297 Ga0495630_0034675 3300046517 Bacteria 3769
298 Ga0495637_0001097 3300046520 Bacteria 16706
299 Ga0495643_0000195 3300046522 Bacteria 96110
300 Ga0495644_0001383 3300046523 Bacteria 9917
301 Ga0495644_0010790 3300046523 Bacteria 3520
302 Ga0495648_0000002 3300046524 Bacteria 593972
303 Ga0495648_0002469 3300046524 Bacteria 16985
304 Ga0495648_0003036 3300046524 Bacteria 15025
305 Ga0495648_0009628 3300046524 Bacteria 7454
306 Ga0495648_0026349 3300046524 Bacteria 3915
307 Ga0495666_0004702 3300046526 Bacteria 6904
308 Ga0495642_0001181 3300046528 Bacteria 11993
309 Ga0495642_0008038 3300046528 Bacteria 4035
310 Ga0495652_0021718 3300046529 Bacteria 5705
311 Ga0495654_0000002 3300046530 Bacteria 1021205
312 Ga0495654_0000049 3300046530 Bacteria 147151
313 Ga0495654_0000790 3300046530 Bacteria 24379
314 Ga0495586_0004296 3300046535 Bacteria 7613
315 Ga0495609_0000176 3300046538 Bacteria 64707
316 Ga0495609_0000177 3300046538 Bacteria 64469
317 Ga0495609_0003489 3300046538 Bacteria 8987
318 Ga0495609_0020021 3300046538 Bacteria 3092
319 Ga0495597_0000055 3300046542 Bacteria 95175
320 Ga0495645_0017184 3300046543 Bacteria 5182
321 Ga0495622_0000009 3300046557 Bacteria 224622
322 Ga0495622_0000586 3300046557 Bacteria 21427
323 Ga0495622_0039785 3300046557 Bacteria 2189
324 Ga0495633_0000024 3300046558 Bacteria 225077
325 Ga0495633_0002266 3300046558 Bacteria 13757
326 Ga0495633_0003312 3300046558 Bacteria 10827
327 Ga0495668_0000006 3300046616 Bacteria 553404
328 Ga0495668_0001072 3300046616 Bacteria 28855
329 Ga0495668_0002756 3300046616 Bacteria 14045
330 Ga0495668_0007812 3300046616 Bacteria 6777
331 Ga0495625_0000124 3300046660 Bacteria 120849
332 Ga0495625_0000779 3300046660 Bacteria 44278
333 Ga0495625_0002364 3300046660 Bacteria 20536
334 Ga0495625_0005633 3300046660 Bacteria 11356
335 Ga0495625_0025805 3300046660 Bacteria 4449
336 Ga0495659_0000001 3300046664 Bacteria 325846
337 Ga0495659_0000141 3300046664 Bacteria 31709
338 Ga0495661_0004752 3300046665 Bacteria 9748
339 Ga0495599_0007071 3300046678 Bacteria 6793
340 Ga0495623_0045749 3300046679 Bacteria 2779
341 Ga0495646_0009535 3300046680 Bacteria 6162
342 Ga0495647_0000474 3300046681 Bacteria 11658
343 Ga0495670_0030404 3300046691 Bacteria 2682
344 Ga0495671_0000002 3300046692 Bacteria 1136189
345 Ga0495671_0000445 3300046692 Bacteria 32757
346 Ga0495600_0004091 3300046809 Bacteria 8680
347 Ga0495660_0000038 3300046810 Bacteria 188167
348 Ga0495660_0000086 3300046810 Bacteria 100316
349 Ga0495660_0000489 3300046810 Bacteria 32927
350 Ga0495660_0006529 3300046810 Bacteria 6890
351 Ga0495604_0066630 3300047317 Bacteria 2738
352 Ga0495636_0000523 3300047318 Bacteria 14138
353 Ga0495636_0003256 3300047318 Bacteria 6291
354 Ga0495636_0032750 3300047318 Bacteria 2133
355 Ga0495672_0000004 3300047320 Bacteria 631810
356 Ga0495672_0000219 3300047320 Bacteria 81635
357 Ga0495672_0000605 3300047320 Bacteria 40392
358 Ga0495672_0026170 3300047320 Bacteria 3724
359 Ga0495672_0046541 3300047320 Bacteria 2586
360 Ga0495676_0162631 3300047321 Bacteria 1578
361 Ga0495683_0001736 3300047323 Bacteria 13785
362 Ga0495683_0002953 3300047323 Bacteria 10060
363 Ga0495683_0036740 3300047323 Bacteria 2485
364 Ga0495687_000191 3300047443 Bacteria 88251
365 Ga0495687_002010 3300047443 Bacteria 17245
366 Ga0495687_002207 3300047443 Bacteria 16097
367 Ga0495687_017349 3300047443 Bacteria 3594
368 Ga0495687_062516 3300047443 Bacteria 1527
369 Ga0495685_000033 3300047447 Bacteria 57157
370 Ga0495673_0000005 3300047469 Bacteria 943364
371 Ga0495673_0000067 3300047469 Bacteria 219908
372 Ga0495673_0000095 3300047469 Bacteria 183429
373 Ga0495673_0000199 3300047469 Bacteria 93637
374 Ga0495681_0026528 3300047470 Bacteria 3012
375 Ga0495686_0000231 3300047472 Bacteria 102239
376 Ga0495686_0000526 3300047472 Bacteria 55119
377 Ga0495686_0006302 3300047472 Bacteria 9116
378 Ga0495686_0014078 3300047472 Bacteria 5522
379 Ga0495686_0060960 3300047472 Bacteria 2344
380 Ga0495602_0037073 3300048088 Bacteria 4530
381 Ga0496101_0000076 3300048904 Bacteria 111590
382 Ga0496102_0000101 3300048905 Bacteria 123198
383 Ga0496102_0265116 3300048905 Bacteria 1619
384 Ga0496111_0153557 3300048914 Bacteria 1708
385 Ga0496116_0023508 3300048919 Bacteria 4587
386 Ga0496117_0000001 3300048920 Bacteria 2526244
387 Ga0496118_0000002 3300048921 Bacteria 1690764
388 Ga0496120_0000680 3300048923 Bacteria 49946
389 Ga0496121_0003561 3300048924 Bacteria 22036
390 Ga0496121_0014532 3300048924 Bacteria 8347
391 Ga0496122_0001831 3300048925 Bacteria 32402
392 Ga0496123_0002340 3300048926 Bacteria 23785
393 Ga0496123_0006319 3300048926 Bacteria 11512
394 Ga0496123_0006703 3300048926 Bacteria 11092
395 Ga0496125_0002187 3300048928 Bacteria 26101
396 Ga0496125_0009347 3300048928 Bacteria 10100
397 Ga0496126_0011924 3300048929 Bacteria 8938
398 Ga0496126_0023512 3300048929 Bacteria 5971
399 Ga0495678_000002 3300049459 Bacteria 999613
400 Ga0495678_000071 3300049459 Bacteria 128709
401 Ga0495678_000360 3300049459 Bacteria 46626
402 Ga0495682_0000015 3300049460 Bacteria 235048
403 Ga0495682_0000761 3300049460 Bacteria 20689
404 Ga0501032_0002852 3300049569 Bacteria 13440
405 Ga0501032_0022570 3300049569 Bacteria 4361
406 Ga0501034_0103272 3300049571 Bacteria 2844
407 Ga0501036_0003894 3300049572 Bacteria 11979
408 Ga0501038_0009406 3300049574 Bacteria 8968
409 Ga0501039_0126171 3300049575 Bacteria 2007
410 Ga0501043_0021184 3300049579 Bacteria 5096
411 Ga0501043_0031540 3300049579 Bacteria 4165
412 Ga0501046_0002556 3300049580 Bacteria 17026
413 Ga0501249_009907 3300049679 Bacteria 1985
414 Ga0501083_0059480 3300049744 Bacteria 2556
415 Ga0501269_000270 3300049766 Bacteria 14632
416 Ga0501035_0000158 3300049822 Bacteria 82890
417 Ga0501035_0017274 3300049822 Bacteria 6652
418 Ga0501035_0213283 3300049822 Bacteria 1651
419 Ga0501044_0000103 3300049823 Bacteria 103893
420 Ga0501044_0026380 3300049823 Bacteria 6149
421 nmdc:mga00v17_14443_c1 3300050491 Bacteria 4406
422 nmdc:mga0k408_6904_c1 3300050493 Bacteria 6058
423 Ga0495601_0008364 3300053077 Bacteria 6113
424 Ga0500618_000857 3300053125 Bacteria 16351
425 Ga0500618_002590 3300053125 Bacteria 6689
426 Ga0500618_008681 3300053125 Bacteria 2820
427 Ga0500621_000001 3300053126 Bacteria 1049698
428 Ga0500636_0002439 3300053177 Bacteria 10304
429 Ga0500625_009635 3300053729 Bacteria 4315
430 2511248064 2511231003 Bacteria 5606035
431 2511378682 2511231025 Bacteria 5324661
432 2511384882 2511231026 Bacteria 5225445
433 2511434226 2511231035 Bacteria 5341610
434 2521558876 2521172590 Bacteria 5047645
435 2526210629 2526164512 Bacteria 4025691
436 2538424226 2537561728 Bacteria 5149301
437 2548849080 2547132512 Bacteria 3416496
438 2550693307 2548876994 Bacteria 4904866
439 2553003672 2551306416 Bacteria 6152985
440 2601668035 2600255292 Bacteria 6300551
441 2643792271 2643221554 Bacteria 6603920
442 2644030724 2643221603 Bacteria 6147767
443 2644212238 2643221638 Bacteria 6579467
444 2644251090 2643221645 Bacteria 7207331
445 2644354735 2643221664 Bacteria 7272945
446 2707101823 2706794495 Bacteria 4536932
447 2738739806 2738541280 Bacteria 6630198
448 2738828034 2738541297 Bacteria 6549566
449 2738842324 2738541300 Bacteria 6675882
450 2739151830 2738541357 Bacteria 6549408
451 2739194149 2738543003 Bacteria 6549560
452 2739274025 2738543018 Bacteria 6718814
453 2739320226 2738543026 Bacteria 6549408
454 2739338866 2738543029 Bacteria 6549249
455 2739343069 2738543030 Bacteria 6719714
456 2765570034 2765235838 Bacteria 5445269
457 2808981677 2808606386 Bacteria 4471946
458 2809131307 2808606415 Bacteria 4576710
459 2809150929 2808606419 Bacteria 4576925
460 2819540849 2818991436 Bacteria 5376622
461 2819593475 2818991445 Bacteria 4955017
462 2819615403 2818991449 Bacteria 5518009
463 2821132687 2821131069 Bacteria 6108407
464 2839097026 2839094727 Bacteria 5534556
465 2842716445 2842711865 Bacteria 7155354
466 2846037782 2846033681 Bacteria 4377894
467 2846040368 2846037992 Bacteria 4526407
468 2852107554 2852103415 Bacteria 5193810
469 2852622793 2852618963 Bacteria 4577824
470 2854602433 2854601825 Bacteria 4797592
471 2855196865 2855195626 Bacteria 4927512
472 2857549923 2857547612 Bacteria 6179999
473 2857557373 2857553236 Bacteria 6166726
474 2857560053 2857558681 Bacteria 6617694
475 2857566756 2857564685 Bacteria 6290584
476 2871274204 2871272651 Bacteria 5042015
477 2871285326 2871282230 Bacteria 4917173
478 2876602177 2876601092 Bacteria 5114497
479 2884814812 2884811622 Bacteria 5552861
480 2884840007 2884836552 Bacteria 5219991
481 2884857225 2884852848 Bacteria 5221161
482 2885081202 2885080285 Bacteria 6355622
483 2891634661 2891633521 Bacteria 4602265
484 2896157812 2896154374 Bacteria 5221518
485 2900052367 2900051742 Bacteria 4985156
486 2904426756 2904424332 Bacteria 7633521
487 2904437573 2904434214 Bacteria 6230908
488 2904444694 2904439833 Bacteria 5931679
489 2904534658 2904530477 Bacteria 5876334
490 2904584545 2904584206 Bacteria 6028872
491 2904591012 2904589729 Bacteria 6113573
492 2904605365 2904601388 Bacteria 5884906
493 2919047464 2919046199 Bacteria 5567169
494 2919080950 2919079590 Bacteria 5946433
495 2919478017 2919476304 Bacteria 5888696
496 2919499737 2919497567 Bacteria 4408621
497 2928132557 2928130867 Bacteria 5467269
498 2932411740 2932410948 Bacteria 6312192
499 2932418693 2932416698 Bacteria 6315112
500 2939602731 2939602548 Bacteria 4950493
501 2989396127 2989392574 Bacteria 4554005
502 8016736557 8016733728 Bacteria 5274317
503 8019501795 8019499862 Bacteria 5169538
504 Ga0079104_1012186
505 JGI25156J39149_1000892
506 JGI25162J39368_1000015
507 JGI25154J39366_1000326
508 JGI25154J39366_1000411
509 JGI25154J39366_1000643
510 JGI25157J39369_1000382
511 JGI25152J39213_1000215
512 JGI25150J39212_1000217
513 JGI25150J39212_1005926
514 JGI25159J45721_1001651
515 JGI25159J45721_1002121
516 JGI25165J46597_1000001
517 JGI25153J46596_10004709
518 JGI25161J50226_1001110
519 Ga0007417J51691_1018264
520 Ga0055538_1000001
521 Ga0055538_1000016
522 Ga0055539_1000001
523 Ga0055539_1000021
524 Ga0055533_1000003
525 Ga0055533_1000029
526 Ga0055532_1000050
527 Ga0055525_1000003
528 Ga0055525_1000033
529 Ga0055529_1000128
530 Ga0055526_1000013
531 Ga0055526_1000019
532 Ga0055526_1002048
533 Ga0055526_1002060
534 Ga0055526_1024791
535 Ga0055537_1000417
536 Ga0055524_1000152
537 Ga0055534_1000045
538 Ga0055528_1000414
539 Ga0055530_10001777
540 Ga0055531_10020122
541 Ga0055541_1000001
542 Ga0055541_1000045
543 Ga0058692_1005373
544 Ga0055543_1001517
545 Ga0065165_1000005
546 Ga0065165_1004234
547 Ga0065714_10066282
548 Ga0070682_100016365
549 Ga0068868_100100915
550 Ga0070661_100005485
551 Ga0070659_100015122
552 Ga0070705_100016350
553 Ga0068855_100004974
554 Ga0068857_100160514
555 Ga0068854_100003581
556 Ga0070717_10141670
557 Ga0075364_10015144
558 Ga0075366_10025791
559 Ga0068865_100034475
560 Ga0099826_10000001
561 Ga0105244_10002333
562 Ga0105250_10010117
563 Ga0105240_10003428
564 Ga0105240_10021627
565 Ga0105237_10002683
566 Ga0105238_10000469
567 Ga0105239_10201988
568 Ga0105246_10013303
569 Ga0105246_10142880
570 Ga0157373_10000468
571 Ga0157371_10000353
572 Ga0157371_10003483
573 Ga0182008_10001162
574 Ga0182008_10056179
575 Ga0182006_1000042
576 Ga0182006_1000052
577 Ga0182006_1005429
578 Ga0182006_1013848
579 Ga0182006_1021851
580 Ga0182005_1000002
581 Ga0182005_1000008
582 Ga0182005_1004259
583 Ga0163161_10086892
584 Ga0213872_10000019
585 Ga0213872_10000264
586 Ga0213872_10002218
587 Ga0209435_100029
588 Ga0209436_101380
589 Ga0209436_103410
590 Ga0209784_100004
591 Ga0209784_100033
592 Ga0209566_100004
593 Ga0209566_100037
594 Ga0209674_100006
595 Ga0209674_100055
596 Ga0209672_103565
597 Ga0209147_100004
598 Ga0209563_100009
599 Ga0209563_100056
600 Ga0207427_100238
601 Ga0209437_100004
602 Ga0209437_100053
603 Ga0209437_104064
604 Ga0209258_100720
605 Ga0207425_1000001
606 Ga0207425_1000056
607 Ga0207425_1000178
608 Ga0209646_1000007
609 Ga0209646_1000073
610 Ga0209646_1000109
611 Ga0209026_1000467
612 Ga0209026_1004099
613 Ga0209026_1004249
614 Ga0209677_100005
615 Ga0209677_100034
616 Ga0209759_1000064
617 Ga0209759_1000698
618 Ga0209129_1000003
619 Ga0209129_1006539
620 Ga0209233_1000005
621 Ga0209565_1000003
622 Ga0209565_1000900
623 Ga0209565_1001280
624 Ga0209565_1004563
625 Ga0209455_1000026
626 Ga0209673_1000003
627 Ga0209130_1000046
628 Ga0209130_1001741
629 Ga0209130_1011557
630 Ga0209675_1000003
631 Ga0209675_1009239
632 Ga0209025_1002173
633 Ga0209025_1005843
634 Ga0209564_1000002
635 Ga0209564_1000007
636 Ga0209564_1000012
637 Ga0209564_1000272
638 Ga0209564_1005898
639 Ga0209758_1000041
640 Ga0209758_1000475
641 Ga0209050_1000011
642 Ga0209050_1000089
643 Ga0209050_1000470
644 Ga0209256_1000007
645 Ga0209256_1000068
646 Ga0209256_1000112
647 Ga0209256_1001080
648 Ga0209256_1007418
649 Ga0207426_1001589
650 Ga0209257_1000003
651 Ga0207696_1000867
652 Ga0207713_1011442
653 Ga0207695_10007561
654 Ga0207695_10009889
655 Ga0207695_10059896
656 Ga0207671_10003909
657 Ga0207649_10006511
658 Ga0207694_10001679
659 Ga0207700_10012311
660 Ga0207664_10010718
661 Ga0207664_10130017
662 Ga0207690_10006002
663 Ga0207690_10115650
664 Ga0207679_10004729
665 Ga0207679_10158834
666 Ga0207667_10000073
667 Ga0207667_10000076
668 Ga0207667_10000147
669 Ga0207667_10000166
670 Ga0207667_10010225
671 Ga0207667_10085215
672 Ga0207640_10033305
673 Ga0207677_10147134
674 Ga0209281_1007318
675 Ga0209371_1000695
676 Ga0209282_1000001
677 Ga0265334_10000021
678 Ga0265338_10005703
679 Ga0314311_1258383
680 Ga0265316_10128999
681 Ga0307509_10000079
682 Ga0307509_10180080
683 Ga0307408_100000903
684 Ga0307408_100022032
685 Ga0265313_10000275
686 Ga0265313_10006074
687 Ga0316575_10000866
688 Ga0316579_10017553
689 Ga0316579_10063257
690 Ga0265314_10015022
691 Ga0316578_10017025
692 Ga0316577_10015402
693 Ga0307414_10010455
694 Ga0316585_10001860
695 Ga0316593_10000946
696 Ga0316593_10009601
697 Ga0373944_0016385
698 Ga0373946_0017883
699 Ga0316574_0012880
700 Ga0316574_0060472
701 Ga0316574_0086342
702 Ga0373924_0013437
703 Ga0373927_0000001
704 Ga0373927_0020022
705 Ga0373933_0093899
706 Ga0373937_0052208
707 Ga0316582_0007148
708 Ga0316582_0020677
709 Ga0316582_0023997
710 Ga0316584_0004910
711 Ga0316584_0011597
712 Ga0316584_0024664
713 Ga0395899_0001574
714 Ga0395899_0001610
715 Ga0395900_0043594
716 Ga0395900_0059334
717 Ga0395905_0002252
718 Ga0395905_0002305
719 Ga0395905_0020485
720 Ga0316581_0000832
721 Ga0316581_0022623
722 Ga0395901_0069482
723 Ga0395901_0107480
724 Ga0400490_15415
725 Ga0400490_15512
726 Ga0400490_42399
727 Ga0400490_43208
728 Ga0400488_62806
729 Ga0400486_15667
730 Ga0400483_196187
731 Ga0400483_225203
732 Ga0400489_22278
733 Ga0400489_57664
734 Ga0400489_74893
735 Ga0400487_21768
736 Ga0400487_43094
737 Ga0436361_0565150
738 Ga0436361_0589877
739 Ga0436361_0793274
740 Ga0439438_000001
741 Ga0439432_003713
742 Ga0466972_0000005
743 Ga0466972_0008997
744 Ga0466977_0030594
745 Ga0453683_0022973
746 Ga0466965_0048283
747 Ga0453684_0010310
748 Ga0453684_0046690
749 Ga0453684_0053624
750 Ga0453684_0054976
751 Ga0453684_0061399
752 Ga0453684_0148447
753 Ga0453684_0173345
754 Ga0466959_0044872
755 Ga0451576_0001867
756 Ga0451576_0003867
757 Ga0451576_0019998
758 Ga0451576_0069565
759 Ga0451576_0262288
760 Ga0495617_000072
761 Ga0495627_000001
762 Ga0495590_0000005
763 Ga0495591_000014
764 Ga0495638_0000349
765 Ga0495651_0010041
766 Ga0495653_0000040
767 Ga0495650_0000032
768 Ga0495650_0000044
769 Ga0495650_0000066
770 Ga0495650_0000490
771 Ga0495650_0000517
772 Ga0495580_0010521
773 Ga0495605_0000038
774 Ga0495639_0010588
775 Ga0495584_0000338
776 Ga0495584_0004194
777 Ga0495584_0035290
778 Ga0495585_0002199
779 Ga0495596_0002938
780 Ga0495596_0015658
781 Ga0495607_0002978
782 Ga0495607_0010211
783 Ga0495607_0042409
784 Ga0495583_0000100
785 Ga0495583_0000117
786 Ga0495583_0001088
787 Ga0495606_0000053
788 Ga0495606_0000087
789 Ga0495606_0000202
790 Ga0495606_0002790
791 Ga0495606_0003035
792 Ga0495606_0003994
793 Ga0495606_0076125
794 Ga0495608_0026925
795 Ga0495610_0000008
796 Ga0495610_0003853
797 Ga0495610_0017089
798 Ga0495616_0021191
799 Ga0495628_0003181
800 Ga0495630_0034675
801 Ga0495637_0001097
802 Ga0495643_0000195
803 Ga0495644_0001383
804 Ga0495644_0010790
805 Ga0495648_0000002
806 Ga0495648_0002469
807 Ga0495648_0003036
808 Ga0495648_0009628
809 Ga0495648_0026349
810 Ga0495666_0004702
811 Ga0495642_0001181
812 Ga0495642_0008038
813 Ga0495652_0021718
814 Ga0495654_0000002
815 Ga0495654_0000049
816 Ga0495654_0000790
817 Ga0495586_0004296
818 Ga0495609_0000176
819 Ga0495609_0000177
820 Ga0495609_0003489
821 Ga0495609_0020021
822 Ga0495597_0000055
823 Ga0495645_0017184
824 Ga0495622_0000009
825 Ga0495622_0000586
826 Ga0495622_0039785
827 Ga0495633_0000024
828 Ga0495633_0002266
829 Ga0495633_0003312
830 Ga0495668_0000006
831 Ga0495668_0001072
832 Ga0495668_0002756
833 Ga0495668_0007812
834 Ga0495625_0000124
835 Ga0495625_0000779
836 Ga0495625_0002364
837 Ga0495625_0005633
838 Ga0495625_0025805
839 Ga0495659_0000001
840 Ga0495659_0000141
841 Ga0495661_0004752
842 Ga0495599_0007071
843 Ga0495623_0045749
844 Ga0495646_0009535
845 Ga0495647_0000474
846 Ga0495670_0030404
847 Ga0495671_0000002
848 Ga0495671_0000445
849 Ga0495600_0004091
850 Ga0495660_0000038
851 Ga0495660_0000086
852 Ga0495660_0000489
853 Ga0495660_0006529
854 Ga0495604_0066630
855 Ga0495636_0000523
856 Ga0495636_0003256
857 Ga0495636_0032750
858 Ga0495672_0000004
859 Ga0495672_0000219
860 Ga0495672_0000605
861 Ga0495672_0026170
862 Ga0495672_0046541
863 Ga0495676_0162631
864 Ga0495683_0001736
865 Ga0495683_0002953
866 Ga0495683_0036740
867 Ga0495687_000191
868 Ga0495687_002010
869 Ga0495687_002207
870 Ga0495687_017349
871 Ga0495687_062516
872 Ga0495685_000033
873 Ga0495673_0000005
874 Ga0495673_0000067
875 Ga0495673_0000095
876 Ga0495673_0000199
877 Ga0495681_0026528
878 Ga0495686_0000231
879 Ga0495686_0000526
880 Ga0495686_0006302
881 Ga0495686_0014078
882 Ga0495686_0060960
883 Ga0495602_0037073
884 Ga0496101_0000076
885 Ga0496102_0000101
886 Ga0496102_0265116
887 Ga0496111_0153557
888 Ga0496116_0023508
889 Ga0496117_0000001
890 Ga0496118_0000002
891 Ga0496120_0000680
892 Ga0496121_0003561
893 Ga0496121_0014532
894 Ga0496122_0001831
895 Ga0496123_0002340
896 Ga0496123_0006319
897 Ga0496123_0006703
898 Ga0496125_0002187
899 Ga0496125_0009347
900 Ga0496126_0011924
901 Ga0496126_0023512
902 Ga0495678_000002
903 Ga0495678_000071
904 Ga0495678_000360
905 Ga0495682_0000015
906 Ga0495682_0000761
907 Ga0501032_0002852
908 Ga0501032_0022570
909 Ga0501034_0103272
910 Ga0501036_0003894
911 Ga0501038_0009406
912 Ga0501039_0126171
913 Ga0501043_0021184
914 Ga0501043_0031540
915 Ga0501046_0002556
916 Ga0501249_009907
917 Ga0501083_0059480
918 Ga0501269_000270
919 Ga0501035_0000158
920 Ga0501035_0017274
921 Ga0501035_0213283
922 Ga0501044_0000103
923 Ga0501044_0026380
924 nmdc:mga00v17_14443_c1
925 nmdc:mga0k408_6904_c1
926 Ga0495601_0008364
927 Ga0500618_000857
928 Ga0500618_002590
929 Ga0500618_008681
930 Ga0500621_000001
931 Ga0500636_0002439
932 Ga0500625_009635
933 2511248064
934 2511378682
935 2511384882
936 2511434226
937 2521558876
938 2526210629
939 2538424226
940 2548849080
941 2550693307
942 2553003672
943 2601668035
944 2643792271
945 2644030724
946 2644212238
947 2644251090
948 2644354735
949 2707101823
950 2738739806
951 2738828034
952 2738842324
953 2739151830
954 2739194149
955 2739274025
956 2739320226
957 2739338866
958 2739343069
959 2765570034
960 2808981677
961 2809131307
962 2809150929
963 2819540849
964 2819593475
965 2819615403
966 2821132687
967 2839097026
968 2842716445
969 2846037782
970 2846040368
971 2852107554
972 2852622793
973 2854602433
974 2855196865
975 2857549923
976 2857557373
977 2857560053
978 2857566756
979 2871274204
980 2871285326
981 2876602177
982 2884814812
983 2884840007
984 2884857225
985 2885081202
986 2891634661
987 2896157812
988 2900052367
989 2904426756
990 2904437573
991 2904444694
992 2904534658
993 2904584545
994 2904591012
995 2904605365
996 2919047464
997 2919080950
998 2919478017
999 2919499737
1000 2928132557
1001 2932411740
1002 2932418693
1003 2939602731
1004 2989396127
1005 8016736557
1006 8019501795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18693

TRAM_2

TRAM domain

428

493

0.95

PF04055

Radical_SAM

Radical SAM superfamily

190

372

0.94

PF00919

UPF0004

Uncharacterized protein family UPF0004

51

149

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9452 150 458
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9401 150 458
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9316 150 458
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9235 150 458
8b47-assembly1.cif.gz_B-2 crystal structure of nad kinase 1 from listeria monocytogenes in complex with a cyclic di-adenosine derivative 0.7244 14 85
ID Description Score Start End Superfamily
af_P0AEI4_138_379_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9762 147 392 3.80.30.20
af_P0AEI4_138_379_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9723 147 392 3.80.30.20
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.965 272 384 3.30.750.200
af_P0AEI4_9_125_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9512 15 134 3.40.50.12160
2qgqA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9419 393 458 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5C7SML8-F1-model_v4 Radical SAM protein 0.9714 260 458 GO:0005829
GO:0035599
GO:0046872
GO:0051539
AF-A0A529X549-F1-model_v4 deleted 0.9703 206 394
AF-A0A527ZP11-F1-model_v4 Radical SAM protein 0.9696 233 458 GO:0005829
GO:0035599
GO:0046872
GO:0051539
AF-A0A357Z0K4-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9663 309 458 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539
AF-A0A527ZP11-F1-model_v4 Radical SAM protein 0.9652 233 458 GO:0005829
GO:0035599
GO:0046872
GO:0051539

Map