F456014

General Info

Members Datasets Scaffolds Average Seq Length
503 260 1008 392

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10135819|Ga0157370_101358192
Length 426
Sequence MHLSFYFHIKYSFILLRSSNLYIFIDNFAELIMQVFHTKSKVIITCNKRLSPYLQEEVKALNYDIVRDFPTGVELNITLTECIKLNLNLRCASQILYCLKNFSANTPDELYGELSEMPWEELIDFSGYFSVTSNVDNPNITTPLFANLKVKDAIVDRIKAKKGMRPNSGPDANKAVVHLYWKDSEAAIFLDTSGETLAKHGYRKIPGKAPMLEALAASVVMATKWDQKSPFVNPMCGSGTLAIEAALIATNRRPGLFRMNYGFMHIMGYDEQVFFAERRILKDQVIKTAELQIIATDLSEDAVEVSRKNAKTAGVDTLITFEVCDFADTTVPDTGKGVVVFNPEYGERLGVHSKLEATYKRMGDFMKQHCKGYFGYIFTGNPDLAKKIGLKADRKVEFYNGKLDCRMLEYELYDGSRRPDEERPKR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
201 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
202 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
217 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
218 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
219 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
220 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
221 2738541278 Niastella sp. CF465 Isolate Unclassified
222 2738541283 Pedobacter sp. OK701 Isolate Unclassified
223 2738541284 Pedobacter sp. YR016 Isolate Unclassified
224 2738541302 Pedobacter sp. CF074 Isolate Unclassified
225 2738543023 Pedobacter sp. OK628 Isolate Unclassified
226 2739367651 Pedobacter sp. OK291 Isolate Unclassified
227 2739367656 Pedobacter sp. CF523 Isolate Unclassified
228 2739367663 Pedobacter sp. YR510 Isolate Unclassified
229 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
230 2818991437 Pedobacter terrae 518 Isolate Unclassified
231 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
232 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
233 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
234 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
235 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
236 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
237 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
238 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
239 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
240 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
241 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
242 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
243 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
244 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
245 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
246 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
247 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
248 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
249 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
250 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
251 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
252 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
253 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
254 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
255 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
256 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
257 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
258 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
259 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
260 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 0
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.94
Nodule 0
Rhizoplane 0.6
Rhizosphere 78.13
Stem 0
Stem Tuber 0
Unclassified 2.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10135819 3300013104 Bacteria 2292
2 SwRhRL2b_contig_2879104 2162886007 Bacteria 104588
3 SwRhRL2b_contig_346326 2162886007 Bacteria 2294
4 JGI24736J21556_1001881 3300001904 Bacteria 3739
5 JGI24739J22299_10020993 3300001989 Bacteria 2329
6 JGI24739J22299_10034033 3300001989 Bacteria 1738
7 JGI24737J22298_10000303 3300001990 Bacteria 16452
8 JGI24737J22298_10006616 3300001990 Bacteria 3948
9 JGI24735J21928_10000007 3300002067 Bacteria 333510
10 JGI24735J21928_10011780 3300002067 Bacteria 2769
11 JGI25162J39368_1000008 3300002737 Bacteria 397212
12 JGI25162J39368_1005851 3300002737 Bacteria 2273
13 JGI25164J39214_1002882 3300002772 Bacteria 2380
14 JGI25152J39213_1000043 3300002773 Bacteria 87508
15 JGI25150J39212_1000023 3300002774 Bacteria 130663
16 JGI25151J46595_10000082 3300003187 Bacteria 130832
17 JGI25165J46597_1001633 3300003214 Bacteria 10496
18 JGI25153J46596_10000060 3300003215 Bacteria 131744
19 rootH1_10129909 3300003316 Bacteria 7521
20 rootH2_10003159 3300003320 Bacteria 36032
21 rootH2_10003246 3300003320 Bacteria 168239
22 rootH2_10050267 3300003320 Bacteria 5544
23 rootH2_10063809 3300003320 Bacteria 5040
24 rootH2_10082426 3300003320 Bacteria 9566
25 rootL2_10006866 3300003322 Bacteria 7782
26 rootL2_10149567 3300003322 Bacteria 3571
27 rootH1_10001642 3300003323 Bacteria 53790
28 rootH1_10002599 3300003316 Bacteria 7117
29 rootH1_10002599 3300003323 Bacteria 52591
30 rootH1_10003164 3300003323 Bacteria 93415
31 rootH1_10003165 3300003323 Bacteria 7505
32 rootH1_10010242 3300003316 Bacteria 16207
33 rootH1_10010242 3300003323 Bacteria 4246
34 rootH1_10211847 3300003323 Bacteria 2902
35 Ga0055536_1000002 3300003781 Bacteria 605605
36 Ga0055530_10000739 3300003791 Bacteria 27214
37 Ga0055531_10000091 3300003794 Bacteria 99363
38 Ga0055531_10000388 3300003794 Bacteria 42434
39 Ga0065165_1000746 3300005262 Bacteria 44688
40 Ga0065714_10002923 3300005288 Bacteria 9650
41 Ga0065714_10004174 3300005288 Bacteria 5317
42 Ga0065714_10015491 3300005288 Bacteria 2000
43 Ga0065714_10064591 3300005288 Bacteria 30978
44 Ga0065714_10073623 3300005288 Bacteria 3157
45 Ga0065704_10000464 3300005289 Bacteria 35359
46 Ga0065704_10070133 3300005289 Bacteria 1266035
47 Ga0065704_10102766 3300005289 Bacteria 2194
48 Ga0070658_10000008 3300005327 Bacteria 319912
49 Ga0070658_10026576 3300005327 Bacteria 4644
50 Ga0070658_10074289 3300005327 Bacteria 2788
51 Ga0070676_10003387 3300005328 Bacteria 8302
52 Ga0070676_10137394 3300005328 Bacteria 1552
53 Ga0070690_100036495 3300005330 Bacteria 3089
54 Ga0068869_100167639 3300005334 Bacteria 1714
55 Ga0070680_100001722 3300005336 Bacteria 16058
56 Ga0070680_100059251 3300005336 Bacteria 3131
57 Ga0070682_100000005 3300005337 Bacteria 386439
58 Ga0068868_100094127 3300005338 Bacteria 2417
59 Ga0070660_100000216 3300005339 Bacteria 38364
60 Ga0070660_100014795 3300005339 Bacteria 5630
61 Ga0070660_100098457 3300005339 Bacteria 2315
62 Ga0070660_100109951 3300005339 Unclassified 2192
63 Ga0070675_100224115 3300005354 Bacteria 1638
64 Ga0070675_100266162 3300005354 Bacteria 1503
65 Ga0070671_100009686 3300005355 Bacteria 7740
66 Ga0070671_100187980 3300005355 Bacteria 1750
67 Ga0070674_100207364 3300005356 Bacteria 1517
68 Ga0070673_100065994 3300005364 Bacteria 2889
69 Ga0070659_100000610 3300005366 Bacteria 26229
70 Ga0070659_100002836 3300005366 Bacteria 12337
71 Ga0070663_100004973 3300005455 Bacteria 7848
72 Ga0070678_100041132 3300005456 Bacteria 3275
73 Ga0070662_100000033 3300005457 Bacteria 78191
74 Ga0070681_10027865 3300005458 Bacteria 5680
75 Ga0068867_100065585 3300005459 Bacteria 2702
76 Ga0068867_100075072 3300005459 Bacteria 2535
77 Ga0070698_100006230 3300005471 Bacteria 12981
78 Ga0070679_100000442 3300005530 Bacteria 35233
79 Ga0070679_100018504 3300005530 Bacteria 6762
80 Ga0070679_100043524 3300005530 Bacteria 4472
81 Ga0070679_100061202 3300005530 Bacteria 3752
82 Ga0068853_100027661 3300005539 Bacteria 4765
83 Ga0068853_100038390 3300005539 Bacteria 4079
84 Ga0068853_100039291 3300005539 Bacteria 4036
85 Ga0070665_100000017 3300005548 Bacteria 448013
86 Ga0070665_100002768 3300005548 Bacteria 19006
87 Ga0070665_100324083 3300005548 Bacteria 1545
88 Ga0068855_100000021 3300005563 Bacteria 195708
89 Ga0068855_100000967 3300005563 Bacteria 35748
90 Ga0068855_100010184 3300005563 Bacteria 11331
91 Ga0068855_100077251 3300005563 Bacteria 3863
92 Ga0068855_100147796 3300005563 Bacteria 2674
93 Ga0068855_100246752 3300005563 Bacteria 1993
94 Ga0068855_100372053 3300005563 Bacteria 1570
95 Ga0068854_100147775 3300005578 Bacteria 1810
96 Ga0068856_100004360 3300005614 Bacteria 14098
97 Ga0068856_100004648 3300005614 Bacteria 13637
98 Ga0068856_100004729 3300005614 Bacteria 13519
99 Ga0068856_100269922 3300005614 Bacteria 1717
100 Ga0068852_100002150 3300005616 Bacteria 13529
101 Ga0068852_100003482 3300005616 Bacteria 11007
102 Ga0068852_100031479 3300005616 Bacteria 4378
103 Ga0068852_100097814 3300005616 Bacteria 2641
104 Ga0068859_100000522 3300005617 Bacteria 38186
105 Ga0068864_100187070 3300005618 Bacteria 1896
106 Ga0068866_10009946 3300005718 Unclassified 4059
107 Ga0068851_10005956 3300005834 Bacteria 5551
108 Ga0068863_100036278 3300005841 Unclassified 4697
109 Ga0068858_100144939 3300005842 Bacteria 2230
110 Ga0068860_100011729 3300005843 Bacteria 8637
111 Ga0068862_100008833 3300005844 Bacteria 8343
112 Ga0075366_10000019 3300006195 Bacteria 59333
113 Ga0075366_10004640 3300006195 Bacteria 7382
114 Ga0075366_10071637 3300006195 Bacteria 2065
115 Ga0075366_10094011 3300006195 Bacteria 1797
116 Ga0097621_100000478 3300006237 Bacteria 28105
117 Ga0068871_100000353 3300006358 Bacteria 31920
118 Ga0068871_100003813 3300006358 Bacteria 10392
119 Ga0068865_100000865 3300006881 Bacteria 17150
120 Ga0097620_100000522 3300006931 Bacteria 38186
121 Ga0105244_10021045 3300009036 Bacteria 3615
122 Ga0105240_10000037 3300009093 Bacteria 270462
123 Ga0105240_10000185 3300009093 Bacteria 126364
124 Ga0105240_10003566 3300009093 Bacteria 24139
125 Ga0105240_10014660 3300009093 Bacteria 10696
126 Ga0105240_10212398 3300009093 Bacteria 2260
127 Ga0105240_10324175 3300009093 Bacteria 1755
128 Ga0105245_10214263 3300009098 Bacteria 1855
129 Ga0114129_10004428 3300009147 Bacteria 19824
130 Ga0105243_10000003 3300009148 Bacteria 712931
131 Ga0105241_10000928 3300009174 Bacteria 22189
132 Ga0105241_10060485 3300009174 Bacteria 2914
133 Ga0105241_10089810 3300009174 Bacteria 2422
134 Ga0105241_10242034 3300009174 Bacteria 1526
135 Ga0105241_10279708 3300009174 Bacteria 1425
136 Ga0105242_10125309 3300009176 Bacteria 2210
137 Ga0105237_10000753 3300009545 Bacteria 44372
138 Ga0105237_10000887 3300009545 Bacteria 40325
139 Ga0105237_10002120 3300009545 Bacteria 25043
140 Ga0105237_10003933 3300009545 Bacteria 17402
141 Ga0105237_10017829 3300009545 Bacteria 7360
142 Ga0105237_10112177 3300009545 Bacteria 2719
143 Ga0105238_10015917 3300009551 Bacteria 7608
144 Ga0105239_10000069 3300010375 Bacteria 144493
145 Ga0105239_10000142 3300010375 Bacteria 101628
146 Ga0105239_10000606 3300010375 Bacteria 51062
147 Ga0105239_10000912 3300010375 Bacteria 41956
148 Ga0105239_10001468 3300010375 Bacteria 31351
149 Ga0105239_10008402 3300010375 Bacteria 11757
150 Ga0105239_10062599 3300010375 Bacteria 4084
151 Ga0105239_10081589 3300010375 Bacteria 3560
152 Ga0105239_10090246 3300010375 Bacteria 3381
153 Ga0105239_10094828 3300010375 Bacteria 3296
154 Ga0105239_10146009 3300010375 Bacteria 2638
155 Ga0105239_10201830 3300010375 Bacteria 2228
156 Ga0157373_10000262 3300013100 Bacteria 42799
157 Ga0157373_10000303 3300013100 Bacteria 39933
158 Ga0157373_10002107 3300013100 Bacteria 15059
159 Ga0157373_10022773 3300013100 Bacteria 4544
160 Ga0157373_10030867 3300013100 Bacteria 3856
161 Ga0157373_10046940 3300013100 Bacteria 3081
162 Ga0157371_10000151 3300013102 Bacteria 101401
163 Ga0157371_10000912 3300013102 Bacteria 33281
164 Ga0157371_10002662 3300013102 Bacteria 16888
165 Ga0157371_10012836 3300013102 Bacteria 6381
166 Ga0157371_10026472 3300013102 Bacteria 4215
167 Ga0157371_10027892 3300013102 Bacteria 4092
168 Ga0157371_10040504 3300013102 Bacteria 3327
169 Ga0157371_10044456 3300013102 Bacteria 3162
170 Ga0157371_10044512 3300013102 Bacteria 3160
171 Ga0157371_10067702 3300013102 Bacteria 2527
172 Ga0157371_10079402 3300013102 Bacteria 2324
173 Ga0157370_10012044 3300013104 Bacteria 9002
174 Ga0157370_10012828 3300013104 Bacteria 8664
175 Ga0157370_10015713 3300013104 Bacteria 7687
176 Ga0157370_10065999 3300013104 Bacteria 3423
177 Ga0157370_10086365 3300013104 Unclassified 2947
178 Ga0157370_10086975 3300013104 Bacteria 2936
179 Ga0157370_10172037 3300013104 Bacteria 2013
180 Ga0157370_10231436 3300013104 Bacteria 1710
181 Ga0157370_10238088 3300013104 Bacteria 1684
182 Ga0157370_10306831 3300013104 Bacteria 1465
183 Ga0157370_10330837 3300013104 Bacteria 1405
184 Ga0157369_10000050 3300013105 Bacteria 167294
185 Ga0157369_10000101 3300013105 Bacteria 118683
186 Ga0157369_10017093 3300013105 Bacteria 8151
187 Ga0157369_10366463 3300013105 Unclassified 1496
188 Ga0157374_10000180 3300013296 Bacteria 58547
189 Ga0157374_10007400 3300013296 Bacteria 9365
190 Ga0157374_10008508 3300013296 Bacteria 8778
191 Ga0157374_10072295 3300013296 Bacteria 3254
192 Ga0157374_10080214 3300013296 Bacteria 3094
193 Ga0157374_10183110 3300013296 Bacteria 2047
194 Ga0157378_10004991 3300013297 Bacteria 11640
195 Ga0163162_10000011 3300013306 Bacteria 299877
196 Ga0163162_10000051 3300013306 Bacteria 117695
197 Ga0163162_10000459 3300013306 Bacteria 37749
198 Ga0163162_10010324 3300013306 Bacteria 9077
199 Ga0163162_10047136 3300013306 Bacteria 4320
200 Ga0157372_10000041 3300013307 Bacteria 158494
201 Ga0157372_10000199 3300013307 Bacteria 66101
202 Ga0157372_10001502 3300013307 Bacteria 25355
203 Ga0157372_10002344 3300013307 Bacteria 20484
204 Ga0157372_10022572 3300013307 Bacteria 6810
205 Ga0157372_10056130 3300013307 Bacteria 4401
206 Ga0157372_10076349 3300013307 Bacteria 3783
207 Ga0157372_10088769 3300013307 Bacteria 3511
208 Ga0157372_10119344 3300013307 Bacteria 3027
209 Ga0157372_10205098 3300013307 Unclassified 2284
210 Ga0157375_10005995 3300013308 Bacteria 10599
211 Ga0163163_10218411 3300014325 Bacteria 1955
212 Ga0182008_10000002 3300014497 Bacteria 480216
213 Ga0182008_10000294 3300014497 Bacteria 39204
214 Ga0182008_10000342 3300014497 Bacteria 36331
215 Ga0182008_10048304 3300014497 Bacteria 2113
216 Ga0182006_1000349 3300015261 Bacteria 38806
217 Ga0182006_1000415 3300015261 Bacteria 34242
218 Ga0182006_1000423 3300015261 Bacteria 33847
219 Ga0182006_1001068 3300015261 Bacteria 17627
220 Ga0182006_1001278 3300015261 Bacteria 15510
221 Ga0182007_10000008 3300015262 Bacteria 332953
222 Ga0183373_1002 3300015682 Bacteria 990153
223 Ga0163161_10000152 3300017792 Bacteria 63649
224 Ga0163161_10000984 3300017792 Bacteria 21818
225 Ga0163161_10006795 3300017792 Bacteria 7907
226 Ga0163161_10010597 3300017792 Bacteria 6382
227 Ga0163161_10195656 3300017792 Bacteria 1556
228 Ga0209563_109321 3300025230 Bacteria 1489
229 Ga0207427_100043 3300025231 Bacteria 249595
230 Ga0209437_100030 3300025233 Bacteria 532466
231 Ga0209437_100170 3300025233 Bacteria 142489
232 Ga0207425_1000051 3300025245 Bacteria 166795
233 Ga0209026_1000251 3300025250 Bacteria 67956
234 Ga0209026_1002730 3300025250 Bacteria 6332
235 Ga0209026_1007347 3300025250 Bacteria 2501
236 Ga0209129_1000121 3300025258 Bacteria 135404
237 Ga0209233_1000266 3300025261 Bacteria 76176
238 Ga0209233_1001831 3300025261 Bacteria 8163
239 Ga0209455_1004042 3300025272 Bacteria 4958
240 Ga0209676_1000022 3300025292 Bacteria 605659
241 Ga0209025_1000160 3300025294 Bacteria 166795
242 Ga0209758_1000147 3300025297 Bacteria 166795
243 Ga0209050_1000020 3300025298 Bacteria 605671
244 Ga0209257_1000006 3300025304 Bacteria 1570111
245 Ga0207656_10010171 3300025321 Bacteria 3514
246 Ga0207655_1024142 3300025728 Bacteria 2988
247 Ga0207647_10000103 3300025904 Bacteria 65792
248 Ga0207647_10003496 3300025904 Bacteria 11781
249 Ga0207647_10003947 3300025904 Bacteria 11071
250 Ga0207647_10072867 3300025904 Unclassified 2071
251 Ga0207647_10104567 3300025904 Bacteria 1678
252 Ga0207647_10145326 3300025904 Bacteria 1388
253 Ga0207645_10001062 3300025907 Bacteria 22737
254 Ga0207645_10078939 3300025907 Bacteria 2109
255 Ga0207705_10000026 3300025909 Bacteria 256051
256 Ga0207705_10025319 3300025909 Bacteria 4238
257 Ga0207705_10027902 3300025909 Bacteria 4026
258 Ga0207705_10049005 3300025909 Unclassified 3040
259 Ga0207705_10051262 3300025909 Bacteria 2971
260 Ga0207705_10114769 3300025909 Unclassified 1993
261 Ga0207654_10028784 3300025911 Bacteria 3033
262 Ga0207707_10044246 3300025912 Bacteria 3882
263 Ga0207695_10000092 3300025913 Bacteria 270514
264 Ga0207695_10000117 3300025913 Bacteria 237982
265 Ga0207695_10007355 3300025913 Bacteria 14052
266 Ga0207695_10021013 3300025913 Bacteria 7456
267 Ga0207695_10037954 3300025913 Bacteria 5193
268 Ga0207695_10039928 3300025913 Bacteria 5039
269 Ga0207671_10000466 3300025914 Bacteria 55435
270 Ga0207671_10000831 3300025914 Bacteria 39212
271 Ga0207671_10001916 3300025914 Bacteria 23094
272 Ga0207671_10005252 3300025914 Bacteria 12026
273 Ga0207671_10014272 3300025914 Bacteria 6285
274 Ga0207671_10068781 3300025914 Bacteria 2639
275 Ga0207671_10098226 3300025914 Bacteria 2215
276 Ga0207660_10016385 3300025917 Bacteria 4905
277 Ga0207657_10000852 3300025919 Bacteria 32202
278 Ga0207657_10117635 3300025919 Bacteria 2189
279 Ga0207657_10149359 3300025919 Bacteria 1904
280 Ga0207652_10000101 3300025921 Bacteria 93033
281 Ga0207652_10002817 3300025921 Bacteria 14595
282 Ga0207652_10003845 3300025921 Bacteria 12308
283 Ga0207659_10204207 3300025926 Bacteria 1580
284 Ga0207644_10122079 3300025931 Bacteria 1984
285 Ga0207690_10000123 3300025932 Bacteria 64409
286 Ga0207690_10010431 3300025932 Bacteria 5521
287 Ga0207690_10116192 3300025932 Bacteria 1935
288 Ga0207706_10003806 3300025933 Bacteria 14379
289 Ga0207709_10000008 3300025935 Bacteria 713099
290 Ga0207669_10173242 3300025937 Bacteria 1538
291 Ga0207704_10000685 3300025938 Bacteria 14998
292 Ga0207667_10000014 3300025949 Bacteria 421261
293 Ga0207667_10001021 3300025949 Bacteria 35701
294 Ga0207667_10007350 3300025949 Bacteria 13260
295 Ga0207667_10012651 3300025949 Bacteria 9698
296 Ga0207667_10031546 3300025949 Bacteria 5720
297 Ga0207667_10054129 3300025949 Bacteria 4221
298 Ga0207667_10092422 3300025949 Bacteria 3125
299 Ga0207667_10167139 3300025949 Bacteria 2261
300 Ga0207667_10259321 3300025949 Bacteria 1778
301 Ga0207667_10315449 3300025949 Bacteria 1597
302 Ga0207658_10111145 3300025986 Bacteria 2167
303 Ga0207677_10073521 3300026023 Bacteria 2421
304 Ga0207703_10236877 3300026035 Bacteria 1639
305 Ga0207639_10004859 3300026041 Bacteria 9050
306 Ga0207639_10163602 3300026041 Bacteria 1877
307 Ga0207639_10308689 3300026041 Bacteria 1401
308 Ga0207639_10332218 3300026041 Bacteria 1353
309 Ga0207678_10087416 3300026067 Bacteria 2664
310 Ga0207678_10091096 3300026067 Bacteria 2606
311 Ga0207702_10001665 3300026078 Bacteria 21956
312 Ga0207702_10128312 3300026078 Bacteria 2279
313 Ga0207702_10239894 3300026078 Bacteria 1698
314 Ga0207641_10081379 3300026088 Bacteria 2812
315 Ga0207648_10001664 3300026089 Bacteria 24356
316 Ga0207648_10015165 3300026089 Bacteria 7093
317 Ga0207683_10069845 3300026121 Bacteria 3102
318 Ga0207698_10000907 3300026142 Bacteria 17255
319 Ga0207698_10061118 3300026142 Bacteria 2934
320 Ga0268266_10000037 3300028379 Bacteria 342368
321 Ga0268266_10004391 3300028379 Bacteria 13518
322 Ga0307517_10000212 3300028786 Bacteria 99215
323 Ga0307515_10000010 3300028794 Bacteria 651586
324 Ga0307515_10000077 3300028794 Bacteria 228162
325 Ga0307515_10000345 3300028794 Bacteria 114943
326 Ga0307515_10025102 3300028794 Bacteria 10334
327 Ga0307515_10036772 3300028794 Bacteria 7905
328 Ga0307515_10079899 3300028794 Bacteria 4275
329 Ga0307515_10137271 3300028794 Bacteria 2649
330 Ga0265338_10021504 3300028800 Bacteria 6724
331 Ga0316177_1127916 3300030731 Bacteria 11558
332 Ga0316183_1100732 3300030742 Bacteria 40906
333 Ga0265327_10000239 3300031251 Bacteria 109804
334 Ga0265327_10022871 3300031251 Bacteria 3720
335 Ga0307513_10130749 3300031456 Bacteria 2457
336 Ga0307509_10049196 3300031507 Bacteria 4522
337 Ga0307408_100000389 3300031548 Bacteria 40047
338 Ga0307514_10027561 3300031649 Unclassified 4589
339 Ga0307405_10000017 3300031731 Bacteria 195149
340 Ga0307407_10000002 3300031903 Bacteria 323084
341 Ga0307412_10000050 3300031911 Bacteria 151527
342 Ga0307412_10001795 3300031911 Bacteria 11874
343 Ga0307416_100000005 3300032002 Bacteria 477728
344 Ga0307414_10000293 3300032004 Bacteria 29252
345 Ga0307414_10000357 3300032004 Bacteria 25424
346 Ga0307414_10052017 3300032004 Bacteria 2848
347 Ga0307414_10065772 3300032004 Bacteria 2588
348 Ga0307414_10084347 3300032004 Bacteria 2336
349 Ga0307414_10087961 3300032004 Bacteria 2298
350 Ga0307411_10155168 3300032005 Unclassified 1707
351 Ga0307507_10003999 3300033179 Bacteria 27071
352 Ga0307510_10000231 3300033180 Bacteria 50152
353 Ga0373927_0044538 3300035695 Bacteria 2871
354 Ga0395899_0000011 3300037312 Bacteria 521331
355 Ga0395899_0000024 3300037312 Bacteria 357402
356 Ga0395899_0025579 3300037312 Bacteria 4455
357 Ga0395900_0000140 3300037418 Bacteria 121917
358 Ga0395900_0003575 3300037418 Bacteria 16707
359 Ga0395900_0008075 3300037418 Bacteria 10834
360 Ga0395900_0308806 3300037418 Unclassified 1565
361 Ga0395898_0004401 3300037466 Bacteria 15408
362 Ga0395898_0024145 3300037466 Bacteria 6135
363 Ga0395905_0001502 3300037471 Bacteria 27915
364 Ga0395901_0001833 3300038443 Bacteria 21962
365 Ga0395901_0057582 3300038443 Bacteria 4042
366 Ga0395901_0147964 3300038443 Unclassified 2468
367 Ga0436361_0370261 3300039447 Bacteria 21370
368 Ga0439442_005210 3300042002 Bacteria 2607
369 Ga0439457_026580 3300042014 Bacteria 1281
370 Ga0439434_0007042 3300042435 Bacteria 3286
371 Ga0451577_0014304 3300042876 Bacteria 7398
372 Ga0451577_0069145 3300042876 Bacteria 3149
373 Ga0451577_0081696 3300042876 Unclassified 2883
374 Ga0451577_0092296 3300042876 Bacteria 2703
375 Ga0466969_0027996 3300044656 Bacteria 2883
376 Ga0453683_0032018 3300044673 Bacteria 3320
377 Ga0453684_0006260 3300044712 Bacteria 22796
378 Ga0453684_0122887 3300044712 Bacteria 3131
379 Ga0453684_0211272 3300044712 Bacteria 2255
380 Ga0466970_0009855 3300044765 Bacteria 4839
381 Ga0466959_0054693 3300045049 Bacteria 2916
382 Ga0451576_0005137 3300045051 Bacteria 16587
383 Ga0495651_0064733 3300046462 Bacteria 2794
384 Ga0495651_0121847 3300046462 Bacteria 1915
385 Ga0495650_0000050 3300046471 Bacteria 318894
386 Ga0495585_0000248 3300046492 Bacteria 56018
387 Ga0495585_0001069 3300046492 Bacteria 22592
388 Ga0495583_0024123 3300046506 Bacteria 3063
389 Ga0495606_0000036 3300046507 Bacteria 234596
390 Ga0495606_0003826 3300046507 Bacteria 15590
391 Ga0495606_0006803 3300046507 Bacteria 10441
392 Ga0495606_0034399 3300046507 Bacteria 3480
393 Ga0495610_0000054 3300046512 Bacteria 140031
394 Ga0495610_0000292 3300046512 Bacteria 52555
395 Ga0495610_0001572 3300046512 Bacteria 20100
396 Ga0495616_0000271 3300046513 Bacteria 42005
397 Ga0495616_0001648 3300046513 Bacteria 15299
398 Ga0495631_0003997 3300046518 Bacteria 7947
399 Ga0495632_0095786 3300046519 Bacteria 1402
400 Ga0495643_0017040 3300046522 Bacteria 4257
401 Ga0495654_0025254 3300046530 Bacteria 3062
402 Ga0495609_0008052 3300046538 Bacteria 5196
403 Ga0495633_0000004 3300046558 Bacteria 370781
404 Ga0495633_0140027 3300046558 Bacteria 1119
405 Ga0495668_0000055 3300046616 Bacteria 199412
406 Ga0495668_0000301 3300046616 Bacteria 68097
407 Ga0495668_0000624 3300046616 Bacteria 42812
408 Ga0495668_0008797 3300046616 Bacteria 6259
409 Ga0495625_0000105 3300046660 Bacteria 126078
410 Ga0495625_0009668 3300046660 Bacteria 8039
411 Ga0495625_0012985 3300046660 Bacteria 6720
412 Ga0495625_0023163 3300046660 Bacteria 4746
413 Ga0495625_0122455 3300046660 Bacteria 1768
414 Ga0495661_0061118 3300046665 Bacteria 2237
415 Ga0495671_0052469 3300046692 Bacteria 2027
416 Ga0495649_0000011 3300046694 Bacteria 416695
417 Ga0495589_0034294 3300046794 Bacteria 2549
418 Ga0495660_0031473 3300046810 Bacteria 2982
419 Ga0495636_0000038 3300047318 Bacteria 56537
420 Ga0495683_0004476 3300047323 Bacteria 7927
421 Ga0495687_002867 3300047443 Bacteria 13196
422 Ga0495687_032785 3300047443 Bacteria 2366
423 Ga0495673_0015245 3300047469 Bacteria 3965
424 Ga0495686_0001664 3300047472 Bacteria 23127
425 Ga0495686_0002015 3300047472 Bacteria 20080
426 Ga0495686_0006693 3300047472 Bacteria 8772
427 Ga0495686_0034347 3300047472 Bacteria 3267
428 Ga0496115_0004238 3300048918 Bacteria 10368
429 Ga0496115_0046623 3300048918 Bacteria 3465
430 Ga0496116_0015352 3300048919 Bacteria 6057
431 Ga0496117_0010726 3300048920 Bacteria 8285
432 Ga0496118_0057718 3300048921 Bacteria 2907
433 Ga0496122_0001655 3300048925 Bacteria 34602
434 Ga0496122_0143140 3300048925 Bacteria 1491
435 Ga0496123_0008277 3300048926 Bacteria 9580
436 Ga0496123_0013729 3300048926 Bacteria 6772
437 Ga0496125_0028533 3300048928 Bacteria 5038
438 Ga0495682_0024498 3300049460 Bacteria 2249
439 Ga0501033_0079708 3300049570 Bacteria 2403
440 Ga0501240_001183 3300049673 Bacteria 2470
441 Ga0501241_005588 3300049758 Bacteria 2340
442 Ga0501269_005119 3300049766 Bacteria 1577
443 nmdc:mga0k408_44_c2 3300050493 Bacteria 32487
444 nmdc:mga0k408_574_c3 3300050493 Bacteria 6199
445 nmdc:mga05p37_29860_c1 3300050507 Bacteria 6652
446 Ga0500635_0000943 3300053080 Bacteria 7025
447 Ga0500644_0000110 3300053088 Bacteria 52203
448 Ga0500583_0000317 3300053092 Bacteria 16510
449 Ga0500651_0000146 3300053093 Bacteria 44767
450 Ga0500556_0030848 3300053104 Bacteria 1819
451 Ga0500572_019556 3300053111 Bacteria 1770
452 Ga0500608_001334 3300053122 Bacteria 8820
453 Ga0500608_006901 3300053122 Bacteria 4660
454 Ga0500618_000006 3300053125 Bacteria 239188
455 Ga0500618_011277 3300053125 Bacteria 2374
456 Ga0500652_014810 3300053131 Bacteria 2799
457 Ga0500616_0001380 3300053153 Bacteria 23509
458 Ga0500622_0000291 3300053156 Bacteria 51275
459 Ga0500622_0002142 3300053156 Bacteria 14668
460 Ga0500622_0002270 3300053156 Bacteria 14116
461 Ga0500624_000481 3300053157 Bacteria 11801
462 Ga0500636_0047661 3300053177 Bacteria 2524
463 2586206420 2585427687 Bacteria 5544917
464 2599479818 2599185184 Bacteria 6430550
465 2722730832 2721755487 Bacteria 6357185
466 2738730788 2738541278 Bacteria 9755573
467 2738759112 2738541283 Bacteria 7222293
468 2738761779 2738541284 Bacteria 5199923
469 2738852870 2738541302 Bacteria 5944758
470 2739302314 2738543023 Bacteria 6767879
471 2739586814 2739367651 Bacteria 6359826
472 2739615130 2739367656 Bacteria 5152243
473 2739645732 2739367663 Bacteria 5040914
474 2776615576 2775506987 Bacteria 5373360
475 2819547236 2818991437 Bacteria 5805520
476 2842726995 2842722452 Bacteria 6263924
477 2842905055 2842903701 Bacteria 6986368
478 2842911003 2842909656 Bacteria 6185908
479 2849283863 2849281842 Bacteria 6065644
480 2852625634 2852623160 Bacteria 4376875
481 2852627834 2852627209 Bacteria 5896285
482 2857627935 2857627736 Bacteria 5625397
483 2884934633 2884933994 Bacteria 4535041
484 2890739068 2890737413 Bacteria 4269751
485 2895503626 2895498888 Bacteria 5283788
486 2896320993 2896317667 Bacteria 4606601
487 2896344270 2896344016 Bacteria 3811746
488 2898713773 2898713307 Bacteria 4110805
489 2902052073 2902048731 Bacteria 4976191
490 2904447716 2904445276 Bacteria 5310396
491 2904783179 2904780799 Bacteria 5840761
492 2919180787 2919177583 Bacteria 5641607
493 2919190769 2919186247 Bacteria 6244071
494 2919439839 2919437846 Bacteria 6199444
495 2919695797 2919692658 Bacteria 5943958
496 2928080949 2928078545 Bacteria 6534839
497 2928152632 2928147474 Bacteria 6512076
498 2929243884 2929239360 Bacteria 7745570
499 2932086958 2932082852 Bacteria 6563563
500 2939669021 2939664404 Bacteria 6364494
501 2945997882 2945997725 Bacteria 6404843
502 2954020365 2954016120 Bacteria 6446024
503 2977234735 2977232053 Bacteria 5485925
504 3003234939 3003233435 Bacteria 4458031
505 8055590254 8055588893 Bacteria 3619545
506 Ga0157370_10135819
507 SwRhRL2b_contig_2879104
508 SwRhRL2b_contig_346326
509 JGI24736J21556_1001881
510 JGI24739J22299_10020993
511 JGI24739J22299_10034033
512 JGI24737J22298_10000303
513 JGI24737J22298_10006616
514 JGI24735J21928_10000007
515 JGI24735J21928_10011780
516 JGI25162J39368_1000008
517 JGI25162J39368_1005851
518 JGI25164J39214_1002882
519 JGI25152J39213_1000043
520 JGI25150J39212_1000023
521 JGI25151J46595_10000082
522 JGI25165J46597_1001633
523 JGI25153J46596_10000060
524 rootH1_10129909
525 rootH2_10003159
526 rootH2_10003246
527 rootH2_10050267
528 rootH2_10063809
529 rootH2_10082426
530 rootL2_10006866
531 rootL2_10149567
532 rootH1_10001642
533 rootH1_10002599
534 rootH1_10003164
535 rootH1_10003165
536 rootH1_10010242
537 rootH1_10211847
538 Ga0055536_1000002
539 Ga0055530_10000739
540 Ga0055531_10000091
541 Ga0055531_10000388
542 Ga0065165_1000746
543 Ga0065714_10002923
544 Ga0065714_10004174
545 Ga0065714_10015491
546 Ga0065714_10064591
547 Ga0065714_10073623
548 Ga0065704_10000464
549 Ga0065704_10070133
550 Ga0065704_10102766
551 Ga0070658_10000008
552 Ga0070658_10026576
553 Ga0070658_10074289
554 Ga0070676_10003387
555 Ga0070676_10137394
556 Ga0070690_100036495
557 Ga0068869_100167639
558 Ga0070680_100001722
559 Ga0070680_100059251
560 Ga0070682_100000005
561 Ga0068868_100094127
562 Ga0070660_100000216
563 Ga0070660_100014795
564 Ga0070660_100098457
565 Ga0070660_100109951
566 Ga0070675_100224115
567 Ga0070675_100266162
568 Ga0070671_100009686
569 Ga0070671_100187980
570 Ga0070674_100207364
571 Ga0070673_100065994
572 Ga0070659_100000610
573 Ga0070659_100002836
574 Ga0070663_100004973
575 Ga0070678_100041132
576 Ga0070662_100000033
577 Ga0070681_10027865
578 Ga0068867_100065585
579 Ga0068867_100075072
580 Ga0070698_100006230
581 Ga0070679_100000442
582 Ga0070679_100018504
583 Ga0070679_100043524
584 Ga0070679_100061202
585 Ga0068853_100027661
586 Ga0068853_100038390
587 Ga0068853_100039291
588 Ga0070665_100000017
589 Ga0070665_100002768
590 Ga0070665_100324083
591 Ga0068855_100000021
592 Ga0068855_100000967
593 Ga0068855_100010184
594 Ga0068855_100077251
595 Ga0068855_100147796
596 Ga0068855_100246752
597 Ga0068855_100372053
598 Ga0068854_100147775
599 Ga0068856_100004360
600 Ga0068856_100004648
601 Ga0068856_100004729
602 Ga0068856_100269922
603 Ga0068852_100002150
604 Ga0068852_100003482
605 Ga0068852_100031479
606 Ga0068852_100097814
607 Ga0068859_100000522
608 Ga0068864_100187070
609 Ga0068866_10009946
610 Ga0068851_10005956
611 Ga0068863_100036278
612 Ga0068858_100144939
613 Ga0068860_100011729
614 Ga0068862_100008833
615 Ga0075366_10000019
616 Ga0075366_10004640
617 Ga0075366_10071637
618 Ga0075366_10094011
619 Ga0097621_100000478
620 Ga0068871_100000353
621 Ga0068871_100003813
622 Ga0068865_100000865
623 Ga0097620_100000522
624 Ga0105244_10021045
625 Ga0105240_10000037
626 Ga0105240_10000185
627 Ga0105240_10003566
628 Ga0105240_10014660
629 Ga0105240_10212398
630 Ga0105240_10324175
631 Ga0105245_10214263
632 Ga0114129_10004428
633 Ga0105243_10000003
634 Ga0105241_10000928
635 Ga0105241_10060485
636 Ga0105241_10089810
637 Ga0105241_10242034
638 Ga0105241_10279708
639 Ga0105242_10125309
640 Ga0105237_10000753
641 Ga0105237_10000887
642 Ga0105237_10002120
643 Ga0105237_10003933
644 Ga0105237_10017829
645 Ga0105237_10112177
646 Ga0105238_10015917
647 Ga0105239_10000069
648 Ga0105239_10000142
649 Ga0105239_10000606
650 Ga0105239_10000912
651 Ga0105239_10001468
652 Ga0105239_10008402
653 Ga0105239_10062599
654 Ga0105239_10081589
655 Ga0105239_10090246
656 Ga0105239_10094828
657 Ga0105239_10146009
658 Ga0105239_10201830
659 Ga0157373_10000262
660 Ga0157373_10000303
661 Ga0157373_10002107
662 Ga0157373_10022773
663 Ga0157373_10030867
664 Ga0157373_10046940
665 Ga0157371_10000151
666 Ga0157371_10000912
667 Ga0157371_10002662
668 Ga0157371_10012836
669 Ga0157371_10026472
670 Ga0157371_10027892
671 Ga0157371_10040504
672 Ga0157371_10044456
673 Ga0157371_10044512
674 Ga0157371_10067702
675 Ga0157371_10079402
676 Ga0157370_10012044
677 Ga0157370_10012828
678 Ga0157370_10015713
679 Ga0157370_10065999
680 Ga0157370_10086365
681 Ga0157370_10086975
682 Ga0157370_10172037
683 Ga0157370_10231436
684 Ga0157370_10238088
685 Ga0157370_10306831
686 Ga0157370_10330837
687 Ga0157369_10000050
688 Ga0157369_10000101
689 Ga0157369_10017093
690 Ga0157369_10366463
691 Ga0157374_10000180
692 Ga0157374_10007400
693 Ga0157374_10008508
694 Ga0157374_10072295
695 Ga0157374_10080214
696 Ga0157374_10183110
697 Ga0157378_10004991
698 Ga0163162_10000011
699 Ga0163162_10000051
700 Ga0163162_10000459
701 Ga0163162_10010324
702 Ga0163162_10047136
703 Ga0157372_10000041
704 Ga0157372_10000199
705 Ga0157372_10001502
706 Ga0157372_10002344
707 Ga0157372_10022572
708 Ga0157372_10056130
709 Ga0157372_10076349
710 Ga0157372_10088769
711 Ga0157372_10119344
712 Ga0157372_10205098
713 Ga0157375_10005995
714 Ga0163163_10218411
715 Ga0182008_10000002
716 Ga0182008_10000294
717 Ga0182008_10000342
718 Ga0182008_10048304
719 Ga0182006_1000349
720 Ga0182006_1000415
721 Ga0182006_1000423
722 Ga0182006_1001068
723 Ga0182006_1001278
724 Ga0182007_10000008
725 Ga0183373_1002
726 Ga0163161_10000152
727 Ga0163161_10000984
728 Ga0163161_10006795
729 Ga0163161_10010597
730 Ga0163161_10195656
731 Ga0209563_109321
732 Ga0207427_100043
733 Ga0209437_100030
734 Ga0209437_100170
735 Ga0207425_1000051
736 Ga0209026_1000251
737 Ga0209026_1002730
738 Ga0209026_1007347
739 Ga0209129_1000121
740 Ga0209233_1000266
741 Ga0209233_1001831
742 Ga0209455_1004042
743 Ga0209676_1000022
744 Ga0209025_1000160
745 Ga0209758_1000147
746 Ga0209050_1000020
747 Ga0209257_1000006
748 Ga0207656_10010171
749 Ga0207655_1024142
750 Ga0207647_10000103
751 Ga0207647_10003496
752 Ga0207647_10003947
753 Ga0207647_10072867
754 Ga0207647_10104567
755 Ga0207647_10145326
756 Ga0207645_10001062
757 Ga0207645_10078939
758 Ga0207705_10000026
759 Ga0207705_10025319
760 Ga0207705_10027902
761 Ga0207705_10049005
762 Ga0207705_10051262
763 Ga0207705_10114769
764 Ga0207654_10028784
765 Ga0207707_10044246
766 Ga0207695_10000092
767 Ga0207695_10000117
768 Ga0207695_10007355
769 Ga0207695_10021013
770 Ga0207695_10037954
771 Ga0207695_10039928
772 Ga0207671_10000466
773 Ga0207671_10000831
774 Ga0207671_10001916
775 Ga0207671_10005252
776 Ga0207671_10014272
777 Ga0207671_10068781
778 Ga0207671_10098226
779 Ga0207660_10016385
780 Ga0207657_10000852
781 Ga0207657_10117635
782 Ga0207657_10149359
783 Ga0207652_10000101
784 Ga0207652_10002817
785 Ga0207652_10003845
786 Ga0207659_10204207
787 Ga0207644_10122079
788 Ga0207690_10000123
789 Ga0207690_10010431
790 Ga0207690_10116192
791 Ga0207706_10003806
792 Ga0207709_10000008
793 Ga0207669_10173242
794 Ga0207704_10000685
795 Ga0207667_10000014
796 Ga0207667_10001021
797 Ga0207667_10007350
798 Ga0207667_10012651
799 Ga0207667_10031546
800 Ga0207667_10054129
801 Ga0207667_10092422
802 Ga0207667_10167139
803 Ga0207667_10259321
804 Ga0207667_10315449
805 Ga0207658_10111145
806 Ga0207677_10073521
807 Ga0207703_10236877
808 Ga0207639_10004859
809 Ga0207639_10163602
810 Ga0207639_10308689
811 Ga0207639_10332218
812 Ga0207678_10087416
813 Ga0207678_10091096
814 Ga0207702_10001665
815 Ga0207702_10128312
816 Ga0207702_10239894
817 Ga0207641_10081379
818 Ga0207648_10001664
819 Ga0207648_10015165
820 Ga0207683_10069845
821 Ga0207698_10000907
822 Ga0207698_10061118
823 Ga0268266_10000037
824 Ga0268266_10004391
825 Ga0307517_10000212
826 Ga0307515_10000010
827 Ga0307515_10000077
828 Ga0307515_10000345
829 Ga0307515_10025102
830 Ga0307515_10036772
831 Ga0307515_10079899
832 Ga0307515_10137271
833 Ga0265338_10021504
834 Ga0316177_1127916
835 Ga0316183_1100732
836 Ga0265327_10000239
837 Ga0265327_10022871
838 Ga0307513_10130749
839 Ga0307509_10049196
840 Ga0307408_100000389
841 Ga0307514_10027561
842 Ga0307405_10000017
843 Ga0307407_10000002
844 Ga0307412_10000050
845 Ga0307412_10001795
846 Ga0307416_100000005
847 Ga0307414_10000293
848 Ga0307414_10000357
849 Ga0307414_10052017
850 Ga0307414_10065772
851 Ga0307414_10084347
852 Ga0307414_10087961
853 Ga0307411_10155168
854 Ga0307507_10003999
855 Ga0307510_10000231
856 Ga0373927_0044538
857 Ga0395899_0000011
858 Ga0395899_0000024
859 Ga0395899_0025579
860 Ga0395900_0000140
861 Ga0395900_0003575
862 Ga0395900_0008075
863 Ga0395900_0308806
864 Ga0395898_0004401
865 Ga0395898_0024145
866 Ga0395905_0001502
867 Ga0395901_0001833
868 Ga0395901_0057582
869 Ga0395901_0147964
870 Ga0436361_0370261
871 Ga0439442_005210
872 Ga0439457_026580
873 Ga0439434_0007042
874 Ga0451577_0014304
875 Ga0451577_0069145
876 Ga0451577_0081696
877 Ga0451577_0092296
878 Ga0466969_0027996
879 Ga0453683_0032018
880 Ga0453684_0006260
881 Ga0453684_0122887
882 Ga0453684_0211272
883 Ga0466970_0009855
884 Ga0466959_0054693
885 Ga0451576_0005137
886 Ga0495651_0064733
887 Ga0495651_0121847
888 Ga0495650_0000050
889 Ga0495585_0000248
890 Ga0495585_0001069
891 Ga0495583_0024123
892 Ga0495606_0000036
893 Ga0495606_0003826
894 Ga0495606_0006803
895 Ga0495606_0034399
896 Ga0495610_0000054
897 Ga0495610_0000292
898 Ga0495610_0001572
899 Ga0495616_0000271
900 Ga0495616_0001648
901 Ga0495631_0003997
902 Ga0495632_0095786
903 Ga0495643_0017040
904 Ga0495654_0025254
905 Ga0495609_0008052
906 Ga0495633_0000004
907 Ga0495633_0140027
908 Ga0495668_0000055
909 Ga0495668_0000301
910 Ga0495668_0000624
911 Ga0495668_0008797
912 Ga0495625_0000105
913 Ga0495625_0009668
914 Ga0495625_0012985
915 Ga0495625_0023163
916 Ga0495625_0122455
917 Ga0495661_0061118
918 Ga0495671_0052469
919 Ga0495649_0000011
920 Ga0495589_0034294
921 Ga0495660_0031473
922 Ga0495636_0000038
923 Ga0495683_0004476
924 Ga0495687_002867
925 Ga0495687_032785
926 Ga0495673_0015245
927 Ga0495686_0001664
928 Ga0495686_0002015
929 Ga0495686_0006693
930 Ga0495686_0034347
931 Ga0496115_0004238
932 Ga0496115_0046623
933 Ga0496116_0015352
934 Ga0496117_0010726
935 Ga0496118_0057718
936 Ga0496122_0001655
937 Ga0496122_0143140
938 Ga0496123_0008277
939 Ga0496123_0013729
940 Ga0496125_0028533
941 Ga0495682_0024498
942 Ga0501033_0079708
943 Ga0501240_001183
944 Ga0501241_005588
945 Ga0501269_005119
946 nmdc:mga0k408_44_c2
947 nmdc:mga0k408_574_c3
948 nmdc:mga05p37_29860_c1
949 Ga0500635_0000943
950 Ga0500644_0000110
951 Ga0500583_0000317
952 Ga0500651_0000146
953 Ga0500556_0030848
954 Ga0500572_019556
955 Ga0500608_001334
956 Ga0500608_006901
957 Ga0500618_000006
958 Ga0500618_011277
959 Ga0500652_014810
960 Ga0500616_0001380
961 Ga0500622_0000291
962 Ga0500622_0002142
963 Ga0500622_0002270
964 Ga0500624_000481
965 Ga0500636_0047661
966 2586206420
967 2599479818
968 2722730832
969 2738730788
970 2738759112
971 2738761779
972 2738852870
973 2739302314
974 2739586814
975 2739615130
976 2739645732
977 2776615576
978 2819547236
979 2842726995
980 2842905055
981 2842911003
982 2849283863
983 2852625634
984 2852627834
985 2857627935
986 2884934633
987 2890739068
988 2895503626
989 2896320993
990 2896344270
991 2898713773
992 2902052073
993 2904447716
994 2904783179
995 2919180787
996 2919190769
997 2919439839
998 2919695797
999 2928080949
1000 2928152632
1001 2929243884
1002 2932086958
1003 2939669021
1004 2945997882
1005 2954020365
1006 2977234735
1007 3003234939
1008 8055590254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22020

RlmL_1st

RlmL ferredoxin-like domain

41

96

0.97

PF01170

UPF0020

RMKL-like, methyltransferase domain

200

409

0.94

PF02926

THUMP

THUMP domain

104

191

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v97-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.9351 6 383
3v8v-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sam binding 0.928 8 385
3v97-assembly1.cif.gz_A crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.9049 6 383
3v97-assembly2.cif.gz_B crystal structure of bifunctional methyltransferase ycby (rlmlk) from escherichia coli, sah binding 0.9025 8 381
3k0b-assembly1.cif.gz_A crystal structure of a predicted n6-adenine-specific dna methylase from listeria monocytogenes str. 4b f2365 0.9014 6 379
ID Description Score Start End Superfamily
af_Q2FYI6_162_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9254 169 378 3.40.50.150
3v8vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9135 177 381 3.40.50.150
af_Q2FYI6_162_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9089 169 378 3.40.50.150
3v8vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9027 177 381 3.40.50.150
3lduA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8883 181 377 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q3F532-F1-model_v4 Class I SAM-dependent RNA methyltransferase 0.9883 1 288 GO:0003723
GO:0008990
GO:0070043
AF-A0A3D6CGK6-F1-model_v4 RNA methyltransferase 0.9842 1 224 GO:0003723
GO:0008990
GO:0070043
AF-A0A4Q3F532-F1-model_v4 Class I SAM-dependent RNA methyltransferase 0.9782 1 288 GO:0003723
GO:0008990
GO:0070043
AF-A0A0F9FXK9-F1-model_v4 THUMP domain-containing protein 0.977 4 194 GO:0003723
GO:0008990
GO:0070043
AF-A0A3D6CGK6-F1-model_v4 RNA methyltransferase 0.9756 1 224 GO:0003723
GO:0008990
GO:0070043

Map