F456068

General Info

Members Datasets Scaffolds Average Seq Length
503 308 492 204

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0138054|Ga0495590_0138054_173_856
Length 227
Sequence MVLLSNDQAGFVCSSTYLKDMYMKLHWSPRSPFVRKVMVCAYETGIVDKFECVRSPVAMDKPNLGLLPDNPLSKLPTLVLDDGFALFDSSVICEYLDTLHASAHLFPGDGRERFVALQQQAFADGLLDVLLLWRQERNKPQSQQRPEWLAAFKVKSTASLDALEQLAPQLRLDAIQIGDIAIACVLSYYDFRLPDVQWRDGRPALAAWHALFAERDSMRRTEPSDGE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
6 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
7 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
8 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
9 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
10 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
11 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
12 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
184 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
296 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.96
Nodule 0.6
Rhizoplane 6.96
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4547141 2162886011 Unclassified 1176
2 JGI24740J21852_10039408 3300001979 Bacteria 1441
3 JGI24739J22299_10002704 3300001989 Bacteria 6824
4 JGI24749J21850_1005872 3300002076 Unclassified 1712
5 rootH2_10016083 3300003320 Bacteria 14720
6 rootL2_10232377 3300003322 Bacteria 1244
7 rootH1_10023986 3300003323 Bacteria 14436
8 rootH1_10120906 3300003323 Bacteria 1830
9 Ga0065712_10075800 3300005290 Bacteria 3768
10 Ga0065715_10108244 3300005293 Bacteria 2729
11 Ga0070676_10386173 3300005328 Unclassified 971
12 Ga0070670_100004947 3300005331 Bacteria 11213
13 Ga0070670_100053018 3300005331 Bacteria 3483
14 Ga0070677_10005176 3300005333 Bacteria 4287
15 Ga0070677_10058780 3300005333 Bacteria 1580
16 Ga0070677_10070844 3300005333 Bacteria 1466
17 Ga0070677_10123922 3300005333 Unclassified 1171
18 Ga0070677_10247006 3300005333 Bacteria 884
19 Ga0070677_10370602 3300005333 Bacteria 747
20 Ga0068869_100083655 3300005334 Bacteria 2387
21 Ga0068869_100526496 3300005334 Bacteria 990
22 Ga0070666_10005165 3300005335 Bacteria 7993
23 Ga0070666_10312389 3300005335 Unclassified 1120
24 Ga0070680_100355664 3300005336 Bacteria 1245
25 Ga0068868_100065298 3300005338 Bacteria 2891
26 Ga0070689_100022404 3300005340 Bacteria 4716
27 Ga0070661_100037878 3300005344 Bacteria 3509
28 Ga0070661_100105116 3300005344 Bacteria 2104
29 Ga0070661_100683124 3300005344 Bacteria 835
30 Ga0070668_100013114 3300005347 Bacteria 6176
31 Ga0070668_100082378 3300005347 Bacteria 2524
32 Ga0070669_100295765 3300005353 Unclassified 1301
33 Ga0070675_100013372 3300005354 Bacteria 6450
34 Ga0070675_100014247 3300005354 Bacteria 6269
35 Ga0070671_100150764 3300005355 Bacteria 1963
36 Ga0070671_100158850 3300005355 Bacteria 1911
37 Ga0070674_100026744 3300005356 Bacteria 3772
38 Ga0070673_100006122 3300005364 Bacteria 7796
39 Ga0070673_100070247 3300005364 Bacteria 2809
40 Ga0070673_100203267 3300005364 Bacteria 1707
41 Ga0070673_100355766 3300005364 Bacteria 1301
42 Ga0070673_100516552 3300005364 Bacteria 1082
43 Ga0070673_100854296 3300005364 Unclassified 842
44 Ga0070688_100013691 3300005365 Bacteria 4581
45 Ga0070659_100417752 3300005366 Bacteria 1134
46 Ga0070667_100015155 3300005367 Bacteria 6367
47 Ga0070667_100043169 3300005367 Bacteria 3784
48 Ga0070667_100162799 3300005367 Bacteria 1966
49 Ga0070667_100230334 3300005367 Bacteria 1652
50 Ga0070667_100341196 3300005367 Bacteria 1355
51 Ga0070705_100325713 3300005440 Unclassified 1111
52 Ga0070700_100226398 3300005441 Unclassified 1328
53 Ga0070694_100028027 3300005444 Bacteria 3661
54 Ga0070694_100546192 3300005444 Bacteria 927
55 Ga0070708_100670360 3300005445 Unclassified 977
56 Ga0070678_100015783 3300005456 Bacteria 4810
57 Ga0070678_100035289 3300005456 Bacteria 3490
58 Ga0070678_100128207 3300005456 Bacteria 2012
59 Ga0070678_100138707 3300005456 Bacteria 1943
60 Ga0070678_100256389 3300005456 Bacteria 1469
61 Ga0070662_100132419 3300005457 Bacteria 1924
62 Ga0068867_100030905 3300005459 Bacteria 3865
63 Ga0068867_100261591 3300005459 Bacteria 1411
64 Ga0068867_100477166 3300005459 Unclassified 1068
65 Ga0070699_100521997 3300005518 Unclassified 1080
66 Ga0068853_100273506 3300005539 Bacteria 1556
67 Ga0070672_100005007 3300005543 Bacteria 8732
68 Ga0070672_100027413 3300005543 Bacteria 4248
69 Ga0070672_100302532 3300005543 Bacteria 1356
70 Ga0070695_100020724 3300005545 Bacteria 4016
71 Ga0070696_100083263 3300005546 Bacteria 2269
72 Ga0070696_100964014 3300005546 Unclassified 711
73 Ga0070665_100039775 3300005548 Bacteria 4726
74 Ga0070665_100068145 3300005548 Bacteria 3568
75 Ga0070665_100208238 3300005548 Bacteria 1956
76 Ga0070665_100571348 3300005548 Bacteria 1143
77 Ga0070704_100027188 3300005549 Bacteria 3790
78 Ga0068855_100198770 3300005563 Bacteria 2258
79 Ga0070664_100017168 3300005564 Bacteria 5941
80 Ga0070664_100029481 3300005564 Bacteria 4575
81 Ga0070664_100355337 3300005564 Bacteria 1334
82 Ga0068857_100623761 3300005577 Bacteria 1020
83 Ga0068852_100512302 3300005616 Bacteria 1196
84 Ga0068859_100084543 3300005617 Bacteria 3218
85 Ga0068859_100314725 3300005617 Bacteria 1659
86 Ga0068864_100004769 3300005618 Bacteria 11111
87 Ga0068864_100184734 3300005618 Bacteria 1908
88 Ga0068866_10237130 3300005718 Bacteria 1109
89 Ga0068861_100226223 3300005719 Bacteria 1584
90 Ga0068851_10038923 3300005834 Bacteria 2387
91 Ga0068863_100105708 3300005841 Bacteria 2678
92 Ga0068863_100133165 3300005841 Bacteria 2374
93 Ga0068858_100103556 3300005842 Bacteria 2655
94 Ga0068860_100017491 3300005843 Bacteria 6985
95 Ga0068862_100043323 3300005844 Bacteria 3837
96 Ga0068862_100678889 3300005844 Bacteria 996
97 Ga0081455_10008501 3300005937 Bacteria 10665
98 Ga0081540_1117917 3300005983 Bacteria 1108
99 Ga0081539_10012056 3300005985 Bacteria 6723
100 Ga0075368_10026315 3300006042 Bacteria 2237
101 Ga0075368_10157189 3300006042 Bacteria 951
102 Ga0075363_100034755 3300006048 Bacteria 2633
103 Ga0075364_10340394 3300006051 Bacteria 1022
104 Ga0075362_10084864 3300006177 Bacteria 1463
105 Ga0075366_10001675 3300006195 Bacteria 11121
106 Ga0075366_10067941 3300006195 Bacteria 2121
107 Ga0097621_100001599 3300006237 Bacteria 15496
108 Ga0097621_100023567 3300006237 Bacteria 4794
109 Ga0097621_100860540 3300006237 Bacteria 843
110 Ga0075370_10050011 3300006353 Bacteria 2370
111 Ga0075370_10214321 3300006353 Bacteria 1137
112 Ga0068871_100034473 3300006358 Bacteria 4017
113 Ga0068871_100064624 3300006358 Bacteria 2996
114 Ga0075428_100000298 3300006844 Bacteria 48579
115 Ga0075433_10163551 3300006852 Bacteria 1981
116 Ga0075433_10837072 3300006852 Bacteria 803
117 Ga0075434_100078967 3300006871 Bacteria 3287
118 Ga0075429_100943222 3300006880 Bacteria 755
119 Ga0097620_100084548 3300006931 Bacteria 3218
120 Ga0097620_100314700 3300006931 Bacteria 1659
121 Ga0099826_10332092 3300006948 Bacteria 763
122 Ga0075435_100180338 3300007076 Bacteria 1785
123 Ga0111539_10048008 3300009094 Bacteria 5099
124 Ga0111539_11217729 3300009094 Bacteria 874
125 Ga0114129_10004685 3300009147 Bacteria 19321
126 Ga0105243_10288159 3300009148 Bacteria 1482
127 Ga0105243_10929685 3300009148 Bacteria 867
128 Ga0105242_10055889 3300009176 Bacteria 3229
129 Ga0105242_11004883 3300009176 Bacteria 842
130 Ga0105248_10040395 3300009177 Bacteria 5229
131 Ga0105237_10037702 3300009545 Bacteria 4885
132 Ga0105237_10665503 3300009545 Unclassified 1048
133 Ga0105238_10158883 3300009551 Bacteria 2236
134 Ga0157369_10025811 3300013105 Bacteria 6517
135 Ga0157369_10042214 3300013105 Bacteria 4976
136 Ga0157374_10069219 3300013296 Bacteria 3323
137 Ga0157374_10080142 3300013296 Bacteria 3096
138 Ga0157378_10028412 3300013297 Bacteria 4935
139 Ga0157378_10459593 3300013297 Bacteria 1265
140 Ga0163162_10015195 3300013306 Bacteria 7520
141 Ga0163162_10097496 3300013306 Bacteria 3028
142 Ga0163162_10144245 3300013306 Bacteria 2496
143 Ga0163162_10464511 3300013306 Bacteria 1397
144 Ga0157372_10024654 3300013307 Bacteria 6538
145 Ga0157375_10029456 3300013308 Bacteria 5163
146 Ga0157375_10078703 3300013308 Bacteria 3331
147 Ga0157375_10521422 3300013308 Bacteria 1351
148 Ga0163163_10040723 3300014325 Bacteria 4538
149 Ga0163163_10111077 3300014325 Bacteria 2770
150 Ga0157380_10091965 3300014326 Bacteria 2506
151 Ga0157380_10559647 3300014326 Bacteria 1123
152 Ga0157380_10870107 3300014326 Bacteria 925
153 Ga0182008_10000401 3300014497 Bacteria 33522
154 Ga0182008_10001541 3300014497 Bacteria 15334
155 Ga0157377_10454290 3300014745 Unclassified 885
156 Ga0157379_10286716 3300014968 Bacteria 1499
157 Ga0157379_10384348 3300014968 Bacteria 1288
158 Ga0157379_10484902 3300014968 Bacteria 1144
159 Ga0157376_10002063 3300014969 Bacteria 13483
160 Ga0157376_10721992 3300014969 Unclassified 1003
161 Ga0182006_1068365 3300015261 Bacteria 1323
162 Ga0182006_1135185 3300015261 Bacteria 846
163 Ga0182007_10006257 3300015262 Bacteria 5121
164 Ga0183361_10003 3300016635 Bacteria 577277
165 Ga0163161_10074011 3300017792 Unclassified 2497
166 Ga0207656_10024672 3300025321 Bacteria 2434
167 Ga0207656_10180690 3300025321 Bacteria 1013
168 Ga0207682_10007274 3300025893 Bacteria 4420
169 Ga0207682_10027715 3300025893 Bacteria 2257
170 Ga0207682_10053519 3300025893 Bacteria 1674
171 Ga0207682_10071010 3300025893 Bacteria 1475
172 Ga0207680_10001613 3300025903 Bacteria 10657
173 Ga0207645_10522916 3300025907 Unclassified 804
174 Ga0207643_10006084 3300025908 Bacteria 6449
175 Ga0207695_10800820 3300025913 Bacteria 822
176 Ga0207660_10165778 3300025917 Unclassified 1707
177 Ga0207657_10513783 3300025919 Unclassified 938
178 Ga0207649_10107622 3300025920 Bacteria 1857
179 Ga0207694_10132236 3300025924 Bacteria 2001
180 Ga0207650_10007575 3300025925 Bacteria 7400
181 Ga0207650_10051663 3300025925 Bacteria 3042
182 Ga0207659_10004406 3300025926 Bacteria 8509
183 Ga0207659_10008459 3300025926 Bacteria 6389
184 Ga0207659_10736007 3300025926 Bacteria 845
185 Ga0207644_10054153 3300025931 Bacteria 2888
186 Ga0207644_10131464 3300025931 Bacteria 1916
187 Ga0207644_10132462 3300025931 Bacteria 1910
188 Ga0207706_10040542 3300025933 Bacteria 4127
189 Ga0207706_10551634 3300025933 Bacteria 992
190 Ga0207709_10822395 3300025935 Bacteria 751
191 Ga0207670_10023518 3300025936 Bacteria 3837
192 Ga0207669_10406793 3300025937 Bacteria 1067
193 Ga0207704_10719391 3300025938 Unclassified 828
194 Ga0207691_10005475 3300025940 Bacteria 12259
195 Ga0207691_10045917 3300025940 Bacteria 4016
196 Ga0207691_10113683 3300025940 Bacteria 2406
197 Ga0207711_10028440 3300025941 Bacteria 4704
198 Ga0207711_10057540 3300025941 Bacteria 3342
199 Ga0207689_10128126 3300025942 Bacteria 2088
200 Ga0207689_10133558 3300025942 Bacteria 2043
201 Ga0207661_10023055 3300025944 Bacteria 4700
202 Ga0207679_10016046 3300025945 Bacteria 4965
203 Ga0207679_10277809 3300025945 Bacteria 1435
204 Ga0207667_10124774 3300025949 Bacteria 2652
205 Ga0207651_10007067 3300025960 Bacteria 5956
206 Ga0207651_10040604 3300025960 Bacteria 3080
207 Ga0207651_10152635 3300025960 Bacteria 1800
208 Ga0207651_10197292 3300025960 Bacteria 1610
209 Ga0207668_10034413 3300025972 Bacteria 3365
210 Ga0207658_10135419 3300025986 Bacteria 1985
211 Ga0207658_10199189 3300025986 Unclassified 1670
212 Ga0207658_10212765 3300025986 Bacteria 1621
213 Ga0207677_10005306 3300026023 Bacteria 6987
214 Ga0207677_11192243 3300026023 Unclassified 697
215 Ga0207703_10105362 3300026035 Bacteria 2397
216 Ga0207703_10587300 3300026035 Bacteria 1053
217 Ga0207678_10169196 3300026067 Bacteria 1866
218 Ga0207708_10485912 3300026075 Unclassified 1033
219 Ga0207641_10024027 3300026088 Bacteria 5022
220 Ga0207641_10123411 3300026088 Bacteria 2315
221 Ga0207641_10392472 3300026088 Bacteria 1331
222 Ga0207648_10014523 3300026089 Bacteria 7272
223 Ga0207648_10468921 3300026089 Unclassified 1149
224 Ga0207648_10510988 3300026089 Unclassified 1100
225 Ga0207676_10007231 3300026095 Bacteria 7861
226 Ga0207676_10144956 3300026095 Unclassified 2038
227 Ga0207676_10500506 3300026095 Bacteria 1154
228 Ga0207674_10224331 3300026116 Bacteria 1828
229 Ga0207674_10636225 3300026116 Bacteria 1030
230 Ga0207675_100257735 3300026118 Bacteria 1689
231 Ga0207675_100487956 3300026118 Unclassified 1225
232 Ga0207683_10022196 3300026121 Bacteria 5447
233 Ga0207683_10059857 3300026121 Bacteria 3346
234 Ga0207683_10090815 3300026121 Unclassified 2720
235 Ga0207683_10315952 3300026121 Bacteria 1430
236 Ga0207683_10347308 3300026121 Bacteria 1361
237 Ga0207683_10401347 3300026121 Bacteria 1261
238 Ga0209371_1018251 3300027312 Bacteria 1789
239 Ga0209813_10085891 3300027866 Bacteria 1048
240 Ga0207428_10264498 3300027907 Bacteria 1280
241 Ga0268266_10028030 3300028379 Bacteria 4788
242 Ga0268266_10126720 3300028379 Bacteria 2279
243 Ga0268266_10425431 3300028379 Bacteria 1259
244 Ga0268266_10588749 3300028379 Bacteria 1068
245 Ga0268265_10102289 3300028380 Bacteria 2317
246 Ga0268264_10015685 3300028381 Bacteria 6205
247 Ga0268264_10037091 3300028381 Bacteria 4017
248 Ga0307515_10000014 3300028794 Bacteria 562358
249 Ga0307515_10000041 3300028794 Bacteria 319110
250 Ga0307515_10088749 3300028794 Bacteria 3903
251 Ga0307515_10219208 3300028794 Bacteria 1725
252 Ga0268256_1011464 3300030500 Bacteria 2802
253 Ga0307511_10013341 3300030521 Bacteria 8032
254 Ga0265327_10003391 3300031251 Bacteria 15307
255 Ga0265327_10053532 3300031251 Unclassified 2094
256 Ga0307513_10000104 3300031456 Bacteria 119239
257 Ga0307513_10006716 3300031456 Bacteria 15015
258 Ga0307513_10031605 3300031456 Bacteria 5992
259 Ga0307513_10069403 3300031456 Bacteria 3688
260 Ga0307513_10134145 3300031456 Bacteria 2414
261 Ga0307513_10561254 3300031456 Bacteria 853
262 Ga0307509_10102024 3300031507 Bacteria 2902
263 Ga0307408_100000664 3300031548 Bacteria 28671
264 Ga0307408_100014845 3300031548 Bacteria 5179
265 Ga0307514_10003284 3300031649 Bacteria 15735
266 Ga0265342_10001756 3300031712 Bacteria 19792
267 Ga0307516_10122617 3300031730 Bacteria 2386
268 Ga0307405_10173513 3300031731 Bacteria 1540
269 Ga0307413_10675354 3300031824 Bacteria 855
270 Ga0307406_10000050 3300031901 Bacteria 66438
271 Ga0307412_10171231 3300031911 Bacteria 1624
272 Ga0307416_100221144 3300032002 Bacteria 1816
273 Ga0307414_10611646 3300032004 Bacteria 978
274 Ga0307411_10862765 3300032005 Bacteria 802
275 Ga0307510_10000001 3300033180 Bacteria 1172244
276 Ga0307510_10029283 3300033180 Bacteria 6271
277 Ga0373944_0120599 3300035089 Bacteria 903
278 Ga0373923_0094127 3300035111 Bacteria 1314
279 Ga0373953_0391016 3300035117 Bacteria 612
280 Ga0373935_0100569 3300035692 Bacteria 1905
281 Ga0373935_0213502 3300035692 Bacteria 1338
282 Ga0373947_0010131 3300035725 Bacteria 5411
283 Ga0373947_0370711 3300035725 Unclassified 963
284 Ga0373937_0016771 3300036401 Bacteria 6511
285 Ga0373937_0067145 3300036401 Bacteria 3304
286 Ga0373937_0444994 3300036401 Bacteria 1230
287 Ga0373925_0025710 3300037068 Bacteria 4305
288 Ga0373925_0049776 3300037068 Bacteria 3124
289 Ga0373925_0282188 3300037068 Unclassified 1338
290 Ga0395899_0242767 3300037312 Bacteria 1239
291 Ga0395900_0113794 3300037418 Bacteria 2777
292 Ga0395900_0139675 3300037418 Bacteria 2481
293 Ga0395898_0155500 3300037466 Bacteria 2187
294 Ga0395905_0024323 3300037471 Bacteria 5717
295 Ga0395905_0200831 3300037471 Bacteria 1869
296 Ga0395905_0444619 3300037471 Bacteria 1194
297 Ga0395905_0459140 3300037471 Bacteria 1172
298 Ga0395905_0733039 3300037471 Bacteria 891
299 Ga0439466_0246070 3300041411 Bacteria 542
300 Ga0451793_0569139 3300041452 Bacteria 1064
301 Ga0451853_4014362 3300041512 Bacteria 698
302 Ga0439431_0014115 3300041997 Bacteria 1849
303 Ga0439441_034948 3300042001 Bacteria 989
304 Ga0439441_050531 3300042001 Bacteria 855
305 Ga0450888_008711 3300042126 Bacteria 1148
306 Ga0450890_054121 3300042127 Bacteria 617
307 Ga0450906_000306 3300042145 Bacteria 9857
308 Ga0439446_0068998 3300042156 Bacteria 1079
309 Ga0439434_0122103 3300042435 Bacteria 850
310 Ga0439434_0226018 3300042435 Bacteria 636
311 Ga0439464_0021261 3300042439 Bacteria 1781
312 Ga0450918_000552 3300042531 Bacteria 7990
313 Ga0453684_0316720 3300044712 Bacteria 1768
314 Ga0466957_0371619 3300044842 Bacteria 973
315 Ga0495590_0044311 3300046457 Unclassified 1551
316 Ga0495590_0070541 3300046457 Bacteria 1225
317 Ga0495590_0138054 3300046457 Unclassified 879
318 Ga0495629_0014856 3300046459 Bacteria 5601
319 Ga0495629_0025852 3300046459 Bacteria 4172
320 Ga0495629_0043493 3300046459 Bacteria 3153
321 Ga0495651_0064816 3300046462 Bacteria 2792
322 Ga0495653_0000283 3300046463 Bacteria 41260
323 Ga0495650_0003261 3300046471 Bacteria 12028
324 Ga0495650_0057270 3300046471 Bacteria 1578
325 Ga0495664_0002027 3300046477 Bacteria 10822
326 Ga0495596_0007730 3300046500 Bacteria 4831
327 Ga0495606_0013396 3300046507 Bacteria 6478
328 Ga0495606_0063250 3300046507 Bacteria 2359
329 Ga0495606_0083659 3300046507 Unclassified 1978
330 Ga0495610_0008455 3300046512 Bacteria 6668
331 Ga0495628_0003075 3300046516 Bacteria 14949
332 Ga0495628_0040667 3300046516 Bacteria 3713
333 Ga0495630_0001008 3300046517 Bacteria 19512
334 Ga0495642_0133436 3300046528 Bacteria 1069
335 Ga0495652_0005427 3300046529 Bacteria 12012
336 Ga0495652_0132844 3300046529 Bacteria 1968
337 Ga0495665_0000067 3300046531 Bacteria 43494
338 Ga0495640_0367768 3300046533 Bacteria 886
339 Ga0495586_0025345 3300046535 Bacteria 3173
340 Ga0495586_0569095 3300046535 Bacteria 654
341 Ga0495597_0010258 3300046542 Bacteria 4586
342 Ga0495645_0132296 3300046543 Unclassified 1747
343 Ga0495633_0001732 3300046558 Bacteria 16309
344 Ga0495633_0259046 3300046558 Bacteria 793
345 Ga0495667_0113878 3300046559 Bacteria 1748
346 Ga0495656_0000878 3300046615 Bacteria 9722
347 Ga0495656_0148718 3300046615 Bacteria 1129
348 Ga0495635_0003175 3300046663 Bacteria 11325
349 Ga0495588_0102503 3300046674 Bacteria 1504
350 Ga0495588_0188474 3300046674 Bacteria 1089
351 Ga0495657_0062692 3300046675 Bacteria 2455
352 Ga0495599_0167011 3300046678 Bacteria 1359
353 Ga0495623_0001735 3300046679 Bacteria 14643
354 Ga0495646_0000220 3300046680 Bacteria 28302
355 Ga0495658_0011839 3300046683 Bacteria 4399
356 Ga0495658_0024730 3300046683 Bacteria 3202
357 Ga0495658_0144325 3300046683 Bacteria 1458
358 Ga0495658_0617786 3300046683 Unclassified 694
359 Ga0495613_0018936 3300046689 Bacteria 5128
360 Ga0495624_0000356 3300046690 Bacteria 36264
361 Ga0495624_0425029 3300046690 Bacteria 797
362 Ga0495670_0099452 3300046691 Bacteria 1497
363 Ga0495649_0005285 3300046694 Bacteria 8249
364 Ga0495600_0125839 3300046809 Bacteria 1667
365 Ga0495600_0135230 3300046809 Bacteria 1602
366 Ga0495600_0213778 3300046809 Unclassified 1235
367 Ga0495600_0460483 3300046809 Bacteria 785
368 Ga0495660_0015397 3300046810 Bacteria 4419
369 Ga0495581_0048851 3300047315 Bacteria 2443
370 Ga0495581_0126967 3300047315 Bacteria 1485
371 Ga0495581_0270686 3300047315 Bacteria 993
372 Ga0495604_0013832 3300047317 Bacteria 6437
373 Ga0495674_0194815 3300047319 Bacteria 1683
374 Ga0495680_0001377 3300047322 Bacteria 26282
375 Ga0495680_0177509 3300047322 Bacteria 1539
376 Ga0495680_0309126 3300047322 Bacteria 1108
377 Ga0495683_0001926 3300047323 Bacteria 12951
378 Ga0495683_0034934 3300047323 Bacteria 2555
379 Ga0495687_009962 3300047443 Bacteria 5256
380 Ga0495687_012463 3300047443 Bacteria 4494
381 Ga0495675_0019376 3300047444 Bacteria 4323
382 Ga0495684_0037638 3300047471 Bacteria 3711
383 Ga0495593_0000220 3300047673 Bacteria 30381
384 Ga0495593_0075386 3300047673 Bacteria 1749
385 Ga0495602_0005016 3300048088 Bacteria 13868
386 Ga0495602_0027203 3300048088 Bacteria 5502
387 Ga0495615_0174388 3300048090 Unclassified 652
388 Ga0496100_0002134 3300048903 Bacteria 9952
389 Ga0496100_0099003 3300048903 Bacteria 2005
390 Ga0496100_0125506 3300048903 Bacteria 1801
391 Ga0496101_0005093 3300048904 Bacteria 8357
392 Ga0496102_0008651 3300048905 Bacteria 8737
393 Ga0496102_0023444 3300048905 Bacteria 5482
394 Ga0496102_0140998 3300048905 Unclassified 2260
395 Ga0496103_0034724 3300048906 Bacteria 3085
396 Ga0496103_0411690 3300048906 Unclassified 868
397 Ga0496104_0000312 3300048907 Bacteria 43264
398 Ga0496104_0000359 3300048907 Bacteria 40640
399 Ga0496104_0009065 3300048907 Bacteria 8845
400 Ga0496104_0174521 3300048907 Bacteria 2060
401 Ga0496105_0003237 3300048908 Bacteria 12000
402 Ga0496105_0009520 3300048908 Bacteria 7602
403 Ga0496105_0052679 3300048908 Bacteria 3361
404 Ga0496105_0210724 3300048908 Bacteria 1584
405 Ga0496106_0122805 3300048909 Unclassified 2031
406 Ga0496106_0334419 3300048909 Bacteria 1216
407 Ga0496106_0810142 3300048909 Unclassified 742
408 Ga0496108_0004276 3300048911 Bacteria 11498
409 Ga0496108_0651943 3300048911 Bacteria 915
410 Ga0496109_0014141 3300048912 Bacteria 6938
411 Ga0496109_0036211 3300048912 Bacteria 4454
412 Ga0496110_0000578 3300048913 Bacteria 25127
413 Ga0496110_0021238 3300048913 Bacteria 5493
414 Ga0496110_0127972 3300048913 Unclassified 2292
415 Ga0496111_0043051 3300048914 Bacteria 3244
416 Ga0496111_0574128 3300048914 Unclassified 827
417 Ga0496112_0091109 3300048915 Bacteria 3018
418 Ga0496113_0043140 3300048916 Bacteria 3336
419 Ga0496113_0170879 3300048916 Bacteria 1721
420 Ga0496114_0034447 3300048917 Bacteria 4178
421 Ga0496114_0091143 3300048917 Bacteria 2589
422 Ga0496117_0014336 3300048920 Bacteria 6837
423 Ga0496118_0004700 3300048921 Bacteria 16004
424 Ga0496119_0037411 3300048922 Bacteria 3152
425 Ga0496121_0021582 3300048924 Bacteria 6300
426 Ga0496122_0111098 3300048925 Unclassified 1799
427 Ga0496122_0181588 3300048925 Unclassified 1254
428 Ga0496124_0000006 3300048927 Bacteria 904259
429 Ga0496125_0052477 3300048928 Bacteria 3353
430 Ga0496126_0053950 3300048929 Bacteria 3644
431 Ga0501034_0024121 3300049571 Bacteria 6187
432 Ga0501036_0097579 3300049572 Bacteria 2484
433 Ga0501039_0042681 3300049575 Bacteria 3503
434 Ga0501041_0008060 3300049577 Bacteria 6199
435 Ga0501043_0000386 3300049579 Bacteria 39806
436 Ga0501043_0045932 3300049579 Bacteria 3434
437 Ga0501046_0000491 3300049580 Bacteria 39431
438 Ga0501046_0100809 3300049580 Bacteria 2215
439 Ga0501047_0000021 3300049581 Bacteria 254841
440 Ga0501048_0009095 3300049582 Bacteria 7477
441 Ga0501071_0015902 3300049587 Bacteria 5168
442 Ga0501072_0015687 3300049588 Bacteria 5807
443 Ga0501073_0441849 3300049589 Bacteria 899
444 Ga0501075_0004861 3300049591 Bacteria 9151
445 Ga0501076_0062822 3300049592 Bacteria 2958
446 Ga0501076_0254519 3300049592 Bacteria 1437
447 Ga0501077_0111826 3300049593 Bacteria 1731
448 Ga0501079_0043439 3300049741 Bacteria 3469
449 Ga0501080_0064368 3300049742 Bacteria 3411
450 Ga0501081_0053993 3300049743 Bacteria 2775
451 Ga0501081_0395265 3300049743 Bacteria 1023
452 Ga0501035_0045866 3300049822 Bacteria 3932
453 Ga0501045_0080313 3300049824 Bacteria 2404
454 nmdc:mga03683_109532_c1 3300050489 Bacteria 1220
455 nmdc:mga03683_36813_c1 3300050489 Bacteria 1992
456 nmdc:mga03n38_87704_c1 3300050490 Bacteria 1475
457 nmdc:mga00v17_52403_c1 3300050491 Bacteria 2483
458 nmdc:mga00v17_59881_c1 3300050491 Bacteria 2338
459 nmdc:mga0k408_1030_c1 3300050493 Bacteria 11150
460 nmdc:mga0k408_134151_c1 3300050493 Bacteria 1471
461 nmdc:mga0k408_616957_c1 3300050493 Bacteria 639
462 nmdc:mga0k408_80450_c1 3300050493 Bacteria 1907
463 nmdc:mga0k408_8609_c1 3300050493 Bacteria 5481
464 nmdc:mga04h51_139646_c1 3300050495 Bacteria 918
465 nmdc:mga07m45_40319_c1 3300050496 Bacteria 2613
466 nmdc:mga05p37_370326_c1 3300050507 Bacteria 1681
467 nmdc:mga05p37_991_c1 3300050507 Bacteria 32378
468 nmdc:mga09592_950151_c1 3300050508 Unclassified 720
469 nmdc:mga06r32_1121588_c1 3300050510 Unclassified 735
470 nmdc:mga08y16_38942_c1 3300050511 Bacteria 4989
471 nmdc:mga0a205_115633_c1 3300050515 Bacteria 2581
472 Ga0495601_0270775 3300053077 Bacteria 1108
473 Ga0495612_0054326 3300053078 Bacteria 1650
474 Ga0495595_0030048 3300053084 Bacteria 2435
475 Ga0495619_0003354 3300053085 Bacteria 10356
476 Ga0500644_0009439 3300053088 Bacteria 2609
477 Ga0500644_0043338 3300053088 Bacteria 1505
478 Ga0500646_0009637 3300053090 Bacteria 2471
479 Ga0500555_103724 3300053103 Bacteria 720
480 Ga0500562_013158 3300053108 Bacteria 2109
481 Ga0500628_015633 3300053129 Bacteria 1454
482 Ga0500642_0000850 3300053130 Bacteria 8902
483 Ga0500568_0088900 3300053139 Bacteria 1167
484 Ga0500586_059719 3300053145 Bacteria 1325
485 Ga0500590_032714 3300053148 Bacteria 2697
486 Ga0500616_0128392 3300053153 Bacteria 1201
487 Ga0500622_0000011 3300053156 Bacteria 386096
488 Ga0500645_123594 3300053730 Bacteria 721
489 Ga0501084_0028977 3300054114 Bacteria 4629
490 Ga0501082_0004564 3300060353 Bacteria 12092
491 Ga0501082_1060893 3300060353 Bacteria 708
492 Ga0530510_0073620 3300061734 Bacteria 2480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041411 Ga0439466_0246070 Ga0439466_0246070_16_513 165
2 3300042435 Ga0439434_0226018 Ga0439434_0226018_129_626 165
3 3300050489 nmdc:mga03683_109532_c1 nmdc:mga03683_109532_c1_13_519 165
4 3300050493 nmdc:mga0k408_616957_c1 nmdc:mga0k408_616957_c1_114_611 165
5 3300048914 Ga0496111_0574128 Ga0496111_0574128_263_763 166
6 3300025933 Ga0207706_10551634 Ga0207706_105516342 169
7 3300006852 Ga0075433_10163551 Ga0075433_101635512 186
8 3300035117 Ga0373953_0391016 Ga0373953_0391016_17_577 186
9 3300037471 Ga0395905_0444619 Ga0395905_0444619_23_583 186
10 3300046558 Ga0495633_0259046 Ga0495633_0259046_34_594 186
11 3300048928 Ga0496125_0052477 Ga0496125_0052477_2402_2962 186
12 3300050515 nmdc:mga0a205_115633_c1 nmdc:mga0a205_115633_c1_582_1157 186
13 3300042127 Ga0450890_054121 Ga0450890_054121_29_601 190
14 3300042156 Ga0439446_0068998 Ga0439446_0068998_94_666 190
15 3300042435 Ga0439434_0122103 Ga0439434_0122103_256_828 190
16 3300050493 nmdc:mga0k408_1030_c1 nmdc:mga0k408_1030_c1_2390_2962 190
17 3300014326 Ga0157380_10870107 Ga0157380_108701072 191
18 3300009094 Ga0111539_10048008 Ga0111539_100480082 192
19 3300027907 Ga0207428_10264498 Ga0207428_102644982 192
20 3300031456 Ga0307513_10134145 Ga0307513_101341452 192
21 3300050511 nmdc:mga08y16_38942_c1 nmdc:mga08y16_38942_c1_1940_2554 192
22 iso_pu_bacteria 2903748898 2903758641 192
23 3300033180 Ga0307510_10000001 Ga0307510_100000011084 194
24 3300033180 Ga0307510_10029283 Ga0307510_100292833 194
25 3300048916 Ga0496113_0170879 Ga0496113_0170879_660_1265 194
26 3300053156 Ga0500622_0000011 Ga0500622_0000011_360496_361101 194
27 3300005344 Ga0070661_100105116 Ga0070661_1001051162 195
28 3300005563 Ga0068855_100198770 Ga0068855_1001987702 195
29 3300005564 Ga0070664_100029481 Ga0070664_1000294812 195
30 3300005577 Ga0068857_100623761 Ga0068857_1006237612 195
31 3300005985 Ga0081539_10012056 Ga0081539_100120563 195
32 3300009176 Ga0105242_10055889 Ga0105242_100558893 195
33 3300013307 Ga0157372_10024654 Ga0157372_100246546 195
34 3300025945 Ga0207679_10277809 Ga0207679_102778092 195
35 3300025949 Ga0207667_10124774 Ga0207667_101247742 195
36 3300026116 Ga0207674_10636225 Ga0207674_106362252 195
37 3300031251 Ga0265327_10053532 Ga0265327_100535321 195
38 3300005445 Ga0070708_100670360 Ga0070708_1006703602 196
39 3300005518 Ga0070699_100521997 Ga0070699_1005219972 196
40 3300031251 Ga0265327_10003391 Ga0265327_100033912 196
41 iso_pu_bacteria 2842780639 2842782348 196
42 3300005440 Ga0070705_100325713 Ga0070705_1003257132 197
43 3300005546 Ga0070696_100964014 Ga0070696_1009640141 197
44 3300005937 Ga0081455_10008501 Ga0081455_100085018 197
45 3300005983 Ga0081540_1117917 Ga0081540_11179172 197
46 3300006844 Ga0075428_100000298 Ga0075428_10000029839 197
47 3300006871 Ga0075434_100078967 Ga0075434_1000789673 197
48 3300006880 Ga0075429_100943222 Ga0075429_1009432221 197
49 3300007076 Ga0075435_100180338 Ga0075435_1001803382 197
50 3300009094 Ga0111539_11217729 Ga0111539_112177291 197
51 3300009147 Ga0114129_10004685 Ga0114129_1000468513 197
52 3300014497 Ga0182008_10000401 Ga0182008_100004013 197
53 3300031712 Ga0265342_10001756 Ga0265342_1000175613 197
54 3300035089 Ga0373944_0120599 Ga0373944_0120599_166_789 197
55 3300035692 Ga0373935_0213502 Ga0373935_0213502_309_932 197
56 3300035725 Ga0373947_0010131 Ga0373947_0010131_1248_1871 197
57 3300035725 Ga0373947_0370711 Ga0373947_0370711_287_937 197
58 3300036401 Ga0373937_0444994 Ga0373937_0444994_516_1139 197
59 3300037068 Ga0373925_0025710 Ga0373925_0025710_2179_2802 197
60 3300046459 Ga0495629_0025852 Ga0495629_0025852_1182_1805 197
61 3300046615 Ga0495656_0148718 Ga0495656_0148718_305_913 197
62 3300046683 Ga0495658_0024730 Ga0495658_0024730_792_1415 197
63 3300046683 Ga0495658_0617786 Ga0495658_0617786_23_646 197
64 3300046689 Ga0495613_0018936 Ga0495613_0018936_3525_4148 197
65 3300047315 Ga0495581_0048851 Ga0495581_0048851_1126_1752 197
66 3300047315 Ga0495581_0270686 Ga0495581_0270686_83_709 197
67 3300047322 Ga0495680_0177509 Ga0495680_0177509_396_1019 197
68 3300047471 Ga0495684_0037638 Ga0495684_0037638_490_1116 197
69 3300047673 Ga0495593_0075386 Ga0495593_0075386_649_1272 197
70 3300048907 Ga0496104_0000312 Ga0496104_0000312_33419_34039 197
71 3300048908 Ga0496105_0009520 Ga0496105_0009520_4239_4859 197
72 3300048911 Ga0496108_0004276 Ga0496108_0004276_6772_7392 197
73 3300048912 Ga0496109_0014141 Ga0496109_0014141_2507_3127 197
74 3300048913 Ga0496110_0000578 Ga0496110_0000578_4242_4862 197
75 3300048915 Ga0496112_0091109 Ga0496112_0091109_2213_2833 197
76 3300048916 Ga0496113_0043140 Ga0496113_0043140_178_798 197
77 3300050507 nmdc:mga05p37_991_c1 nmdc:mga05p37_991_c1_13384_14010 197
78 3300050508 nmdc:mga09592_950151_c1 nmdc:mga09592_950151_c1_89_697 197
79 3300050510 nmdc:mga06r32_1121588_c1 nmdc:mga06r32_1121588_c1_27_653 197
80 3300053084 Ga0495595_0030048 Ga0495595_0030048_908_1531 197
81 3300053085 Ga0495619_0003354 Ga0495619_0003354_9282_9905 197
82 3300026023 Ga0207677_11192243 Ga0207677_111922431 198
83 iso_pu_bacteria 2501025502 2501082881 198
84 iso_pu_bacteria 2510917013 2511091129 198
85 iso_pu_bacteria 2513237094 2513641350 198
86 iso_pu_bacteria 2643221547 2643755687 198
87 iso_pu_bacteria 2900634093 2900642189 198
88 iso_pu_bacteria 2990703756 2990710078 198
89 3300005444 Ga0070694_100028027 Ga0070694_1000280272 199
90 3300005545 Ga0070695_100020724 Ga0070695_1000207242 199
91 3300032005 Ga0307411_10862765 Ga0307411_108627651 199
92 3300044712 Ga0453684_0316720 Ga0453684_0316720_805_1434 199
93 3300048090 Ga0495615_0174388 Ga0495615_0174388_23_628 199
94 3300050507 nmdc:mga05p37_370326_c1 nmdc:mga05p37_370326_c1_836_1465 199
95 3300060353 Ga0501082_1060893 Ga0501082_1060893_64_693 199
96 3300003323 rootH1_10120906 rootH1_101209062 200
97 3300006051 Ga0075364_10340394 Ga0075364_103403941 200
98 3300035111 Ga0373923_0094127 Ga0373923_0094127_459_1073 200
99 3300035692 Ga0373935_0100569 Ga0373935_0100569_679_1293 200
100 3300037068 Ga0373925_0049776 Ga0373925_0049776_2190_2804 200
101 3300048927 Ga0496124_0000006 Ga0496124_0000006_615379_615981 200
102 3300050493 nmdc:mga0k408_8609_c1 nmdc:mga0k408_8609_c1_131_745 200
103 3300053153 Ga0500616_0128392 Ga0500616_0128392_127_741 200
104 3300003320 rootH2_10016083 rootH2_1001608314 201
105 3300003322 rootL2_10232377 rootL2_102323772 201
106 3300003323 rootH1_10023986 rootH1_100239867 201
107 3300005331 Ga0070670_100004947 Ga0070670_10000494713 201
108 3300005333 Ga0070677_10005176 Ga0070677_100051763 201
109 3300005333 Ga0070677_10058780 Ga0070677_100587802 201
110 3300005333 Ga0070677_10070844 Ga0070677_100708442 201
111 3300005333 Ga0070677_10247006 Ga0070677_102470062 201
112 3300005333 Ga0070677_10370602 Ga0070677_103706021 201
113 3300005334 Ga0068869_100526496 Ga0068869_1005264962 201
114 3300005336 Ga0070680_100355664 Ga0070680_1003556642 201
115 3300005354 Ga0070675_100013372 Ga0070675_1000133726 201
116 3300005355 Ga0070671_100158850 Ga0070671_1001588502 201
117 3300005356 Ga0070674_100026744 Ga0070674_1000267444 201
118 3300005364 Ga0070673_100070247 Ga0070673_1000702472 201
119 3300005364 Ga0070673_100203267 Ga0070673_1002032672 201
120 3300005364 Ga0070673_100355766 Ga0070673_1003557662 201
121 3300005364 Ga0070673_100516552 Ga0070673_1005165521 201
122 3300005367 Ga0070667_100043169 Ga0070667_1000431693 201
123 3300005367 Ga0070667_100341196 Ga0070667_1003411962 201
124 3300005444 Ga0070694_100546192 Ga0070694_1005461922 201
125 3300005456 Ga0070678_100015783 Ga0070678_1000157832 201
126 3300005456 Ga0070678_100035289 Ga0070678_1000352892 201
127 3300005456 Ga0070678_100138707 Ga0070678_1001387072 201
128 3300005456 Ga0070678_100256389 Ga0070678_1002563892 201
129 3300005459 Ga0068867_100030905 Ga0068867_1000309052 201
130 3300005459 Ga0068867_100261591 Ga0068867_1002615912 201
131 3300005543 Ga0070672_100005007 Ga0070672_1000050072 201
132 3300005543 Ga0070672_100302532 Ga0070672_1003025321 201
133 3300005548 Ga0070665_100068145 Ga0070665_1000681454 201
134 3300005548 Ga0070665_100208238 Ga0070665_1002082382 201
135 3300005548 Ga0070665_100571348 Ga0070665_1005713482 201
136 3300005549 Ga0070704_100027188 Ga0070704_1000271884 201
137 3300005564 Ga0070664_100355337 Ga0070664_1003553372 201
138 3300005616 Ga0068852_100512302 Ga0068852_1005123022 201
139 3300005618 Ga0068864_100004769 Ga0068864_10000476915 201
140 3300005718 Ga0068866_10237130 Ga0068866_102371302 201
141 3300005841 Ga0068863_100133165 Ga0068863_1001331652 201
142 3300005844 Ga0068862_100678889 Ga0068862_1006788892 201
143 3300006042 Ga0075368_10026315 Ga0075368_100263155 201
144 3300006177 Ga0075362_10084864 Ga0075362_100848642 201
145 3300006195 Ga0075366_10001675 Ga0075366_1000167510 201
146 3300006195 Ga0075366_10067941 Ga0075366_100679412 201
147 3300006237 Ga0097621_100001599 Ga0097621_1000015995 201
148 3300006237 Ga0097621_100860540 Ga0097621_1008605402 201
149 3300006353 Ga0075370_10050011 Ga0075370_100500114 201
150 3300006353 Ga0075370_10214321 Ga0075370_102143212 201
151 3300006358 Ga0068871_100034473 Ga0068871_1000344733 201
152 3300006948 Ga0099826_10332092 Ga0099826_103320921 201
153 3300009148 Ga0105243_10288159 Ga0105243_102881592 201
154 3300009148 Ga0105243_10929685 Ga0105243_109296852 201
155 3300009176 Ga0105242_11004883 Ga0105242_110048831 201
156 3300013296 Ga0157374_10069219 Ga0157374_100692193 201
157 3300013297 Ga0157378_10459593 Ga0157378_104595932 201
158 3300013306 Ga0163162_10144245 Ga0163162_101442452 201
159 3300013306 Ga0163162_10464511 Ga0163162_104645112 201
160 3300013308 Ga0157375_10029456 Ga0157375_100294564 201
161 3300013308 Ga0157375_10521422 Ga0157375_105214222 201
162 3300014325 Ga0163163_10111077 Ga0163163_101110773 201
163 3300014326 Ga0157380_10091965 Ga0157380_100919652 201
164 3300014326 Ga0157380_10559647 Ga0157380_105596472 201
165 3300014497 Ga0182008_10001541 Ga0182008_100015414 201
166 3300014968 Ga0157379_10286716 Ga0157379_102867162 201
167 3300014968 Ga0157379_10384348 Ga0157379_103843482 201
168 3300014969 Ga0157376_10002063 Ga0157376_1000206315 201
169 3300015261 Ga0182006_1068365 Ga0182006_10683652 201
170 3300015261 Ga0182006_1135185 Ga0182006_11351852 201
171 3300015262 Ga0182007_10006257 Ga0182007_100062573 201
172 3300025321 Ga0207656_10180690 Ga0207656_101806902 201
173 3300025893 Ga0207682_10007274 Ga0207682_100072742 201
174 3300025893 Ga0207682_10053519 Ga0207682_100535192 201
175 3300025893 Ga0207682_10071010 Ga0207682_100710102 201
176 3300025917 Ga0207660_10165778 Ga0207660_101657782 201
177 3300025925 Ga0207650_10007575 Ga0207650_100075755 201
178 3300025926 Ga0207659_10736007 Ga0207659_107360071 201
179 3300025931 Ga0207644_10132462 Ga0207644_101324622 201
180 3300025935 Ga0207709_10822395 Ga0207709_108223951 201
181 3300025937 Ga0207669_10406793 Ga0207669_104067932 201
182 3300025940 Ga0207691_10005475 Ga0207691_100054754 201
183 3300025940 Ga0207691_10113683 Ga0207691_101136833 201
184 3300025942 Ga0207689_10133558 Ga0207689_101335583 201
185 3300025960 Ga0207651_10152635 Ga0207651_101526352 201
186 3300025960 Ga0207651_10197292 Ga0207651_101972922 201
187 3300026035 Ga0207703_10587300 Ga0207703_105873002 201
188 3300026088 Ga0207641_10123411 Ga0207641_101234112 201
189 3300026089 Ga0207648_10014523 Ga0207648_100145234 201
190 3300026095 Ga0207676_10007231 Ga0207676_100072312 201
191 3300026116 Ga0207674_10224331 Ga0207674_102243312 201
192 3300026121 Ga0207683_10022196 Ga0207683_100221962 201
193 3300026121 Ga0207683_10059857 Ga0207683_100598574 201
194 3300026121 Ga0207683_10315952 Ga0207683_103159522 201
195 3300026121 Ga0207683_10347308 Ga0207683_103473082 201
196 3300026121 Ga0207683_10401347 Ga0207683_104013472 201
197 3300027866 Ga0209813_10085891 Ga0209813_100858911 201
198 3300028379 Ga0268266_10126720 Ga0268266_101267203 201
199 3300028379 Ga0268266_10425431 Ga0268266_104254312 201
200 3300028379 Ga0268266_10588749 Ga0268266_105887492 201
201 3300028794 Ga0307515_10000014 Ga0307515_10000014448 201
202 3300028794 Ga0307515_10000041 Ga0307515_10000041200 201
203 3300028794 Ga0307515_10088749 Ga0307515_100887494 201
204 3300028794 Ga0307515_10219208 Ga0307515_102192082 201
205 3300030521 Ga0307511_10013341 Ga0307511_100133416 201
206 3300031456 Ga0307513_10000104 Ga0307513_10000104102 201
207 3300031456 Ga0307513_10006716 Ga0307513_100067163 201
208 3300031456 Ga0307513_10031605 Ga0307513_100316053 201
209 3300031456 Ga0307513_10069403 Ga0307513_100694033 201
210 3300031456 Ga0307513_10561254 Ga0307513_105612542 201
211 3300031507 Ga0307509_10102024 Ga0307509_101020242 201
212 3300031548 Ga0307408_100000664 Ga0307408_1000006647 201
213 3300031548 Ga0307408_100014845 Ga0307408_1000148453 201
214 3300031649 Ga0307514_10003284 Ga0307514_100032843 201
215 3300031730 Ga0307516_10122617 Ga0307516_101226174 201
216 3300031731 Ga0307405_10173513 Ga0307405_101735132 201
217 3300031824 Ga0307413_10675354 Ga0307413_106753541 201
218 3300031901 Ga0307406_10000050 Ga0307406_1000005055 201
219 3300031911 Ga0307412_10171231 Ga0307412_101712312 201
220 3300032002 Ga0307416_100221144 Ga0307416_1002211441 201
221 3300032004 Ga0307414_10611646 Ga0307414_106116461 201
222 3300036401 Ga0373937_0067145 Ga0373937_0067145_138_749 201
223 3300037312 Ga0395899_0242767 Ga0395899_0242767_358_963 201
224 3300037418 Ga0395900_0113794 Ga0395900_0113794_272_877 201
225 3300037418 Ga0395900_0139675 Ga0395900_0139675_1057_1662 201
226 3300037466 Ga0395898_0155500 Ga0395898_0155500_1142_1747 201
227 3300037471 Ga0395905_0024323 Ga0395905_0024323_1704_2312 201
228 3300037471 Ga0395905_0200831 Ga0395905_0200831_29_637 201
229 3300037471 Ga0395905_0459140 Ga0395905_0459140_29_637 201
230 3300037471 Ga0395905_0733039 Ga0395905_0733039_181_789 201
231 3300041452 Ga0451793_0569139 Ga0451793_0569139_377_982 201
232 3300041512 Ga0451853_4014362 Ga0451853_4014362_52_657 201
233 3300041997 Ga0439431_0014115 Ga0439431_0014115_457_1062 201
234 3300042001 Ga0439441_034948 Ga0439441_034948_87_701 201
235 3300042001 Ga0439441_050531 Ga0439441_050531_191_808 201
236 3300042126 Ga0450888_008711 Ga0450888_008711_157_768 201
237 3300042145 Ga0450906_000306 Ga0450906_000306_7039_7644 201
238 3300042439 Ga0439464_0021261 Ga0439464_0021261_1100_1714 201
239 3300042531 Ga0450918_000552 Ga0450918_000552_3990_4595 201
240 3300044842 Ga0466957_0371619 Ga0466957_0371619_346_957 201
241 3300046457 Ga0495590_0070541 Ga0495590_0070541_67_675 201
242 3300046462 Ga0495651_0064816 Ga0495651_0064816_2003_2620 201
243 3300046471 Ga0495650_0003261 Ga0495650_0003261_2095_2709 201
244 3300046471 Ga0495650_0057270 Ga0495650_0057270_952_1557 201
245 3300046529 Ga0495652_0132844 Ga0495652_0132844_14_625 201
246 3300046533 Ga0495640_0367768 Ga0495640_0367768_39_650 201
247 3300046558 Ga0495633_0001732 Ga0495633_0001732_11973_12578 201
248 3300046559 Ga0495667_0113878 Ga0495667_0113878_694_1305 201
249 3300046615 Ga0495656_0000878 Ga0495656_0000878_2204_2857 201
250 3300046674 Ga0495588_0102503 Ga0495588_0102503_119_724 201
251 3300046674 Ga0495588_0188474 Ga0495588_0188474_304_921 201
252 3300046675 Ga0495657_0062692 Ga0495657_0062692_880_1497 201
253 3300046678 Ga0495599_0167011 Ga0495599_0167011_257_874 201
254 3300046683 Ga0495658_0011839 Ga0495658_0011839_3576_4187 201
255 3300046683 Ga0495658_0144325 Ga0495658_0144325_139_744 201
256 3300046690 Ga0495624_0425029 Ga0495624_0425029_70_681 201
257 3300046691 Ga0495670_0099452 Ga0495670_0099452_632_1249 201
258 3300046809 Ga0495600_0135230 Ga0495600_0135230_598_1215 201
259 3300046810 Ga0495660_0015397 Ga0495660_0015397_2927_3532 201
260 3300047319 Ga0495674_0194815 Ga0495674_0194815_326_937 201
261 3300047322 Ga0495680_0309126 Ga0495680_0309126_445_1056 201
262 3300048903 Ga0496100_0099003 Ga0496100_0099003_915_1532 201
263 3300048905 Ga0496102_0023444 Ga0496102_0023444_512_1129 201
264 3300048906 Ga0496103_0034724 Ga0496103_0034724_1979_2596 201
265 3300048907 Ga0496104_0009065 Ga0496104_0009065_5047_5664 201
266 3300048908 Ga0496105_0052679 Ga0496105_0052679_2670_3287 201
267 3300048909 Ga0496106_0334419 Ga0496106_0334419_412_1029 201
268 3300048911 Ga0496108_0651943 Ga0496108_0651943_212_823 201
269 3300048914 Ga0496111_0043051 Ga0496111_0043051_71_688 201
270 3300048917 Ga0496114_0034447 Ga0496114_0034447_1811_2428 201
271 3300048925 Ga0496122_0181588 Ga0496122_0181588_231_842 201
272 3300049571 Ga0501034_0024121 Ga0501034_0024121_5367_5981 201
273 3300049572 Ga0501036_0097579 Ga0501036_0097579_371_985 201
274 3300049575 Ga0501039_0042681 Ga0501039_0042681_1454_2068 201
275 3300049577 Ga0501041_0008060 Ga0501041_0008060_828_1442 201
276 3300049579 Ga0501043_0000386 Ga0501043_0000386_26974_27579 201
277 3300049579 Ga0501043_0045932 Ga0501043_0045932_2019_2633 201
278 3300049580 Ga0501046_0000491 Ga0501046_0000491_11881_12486 201
279 3300049580 Ga0501046_0100809 Ga0501046_0100809_957_1571 201
280 3300049581 Ga0501047_0000021 Ga0501047_0000021_227263_227868 201
281 3300049582 Ga0501048_0009095 Ga0501048_0009095_1927_2532 201
282 3300049587 Ga0501071_0015902 Ga0501071_0015902_1301_1915 201
283 3300049588 Ga0501072_0015687 Ga0501072_0015687_1468_2082 201
284 3300049589 Ga0501073_0441849 Ga0501073_0441849_255_869 201
285 3300049591 Ga0501075_0004861 Ga0501075_0004861_7076_7690 201
286 3300049592 Ga0501076_0062822 Ga0501076_0062822_1350_1964 201
287 3300049593 Ga0501077_0111826 Ga0501077_0111826_311_925 201
288 3300049741 Ga0501079_0043439 Ga0501079_0043439_504_1118 201
289 3300049742 Ga0501080_0064368 Ga0501080_0064368_808_1422 201
290 3300049743 Ga0501081_0053993 Ga0501081_0053993_723_1337 201
291 3300049822 Ga0501035_0045866 Ga0501035_0045866_2665_3279 201
292 3300049824 Ga0501045_0080313 Ga0501045_0080313_352_957 201
293 3300050489 nmdc:mga03683_36813_c1 nmdc:mga03683_36813_c1_595_1212 201
294 3300050491 nmdc:mga00v17_52403_c1 nmdc:mga00v17_52403_c1_1164_1781 201
295 3300050491 nmdc:mga00v17_59881_c1 nmdc:mga00v17_59881_c1_1482_2087 201
296 3300050493 nmdc:mga0k408_134151_c1 nmdc:mga0k408_134151_c1_732_1349 201
297 3300050493 nmdc:mga0k408_80450_c1 nmdc:mga0k408_80450_c1_1050_1667 201
298 3300050495 nmdc:mga04h51_139646_c1 nmdc:mga04h51_139646_c1_255_872 201
299 3300050496 nmdc:mga07m45_40319_c1 nmdc:mga07m45_40319_c1_583_1200 201
300 3300053077 Ga0495601_0270775 Ga0495601_0270775_56_667 201
301 3300053078 Ga0495612_0054326 Ga0495612_0054326_505_1116 201
302 3300053088 Ga0500644_0009439 Ga0500644_0009439_128_745 201
303 3300053088 Ga0500644_0043338 Ga0500644_0043338_869_1486 201
304 3300053090 Ga0500646_0009637 Ga0500646_0009637_49_666 201
305 3300053103 Ga0500555_103724 Ga0500555_103724_80_697 201
306 3300053108 Ga0500562_013158 Ga0500562_013158_1154_1771 201
307 3300053129 Ga0500628_015633 Ga0500628_015633_433_1050 201
308 3300053139 Ga0500568_0088900 Ga0500568_0088900_527_1144 201
309 3300053145 Ga0500586_059719 Ga0500586_059719_380_997 201
310 3300053148 Ga0500590_032714 Ga0500590_032714_1051_1662 201
311 3300053730 Ga0500645_123594 Ga0500645_123594_25_642 201
312 3300054114 Ga0501084_0028977 Ga0501084_0028977_1201_1815 201
313 3300060353 Ga0501082_0004564 Ga0501082_0004564_3967_4581 201
314 3300061734 Ga0530510_0073620 Ga0530510_0073620_1515_2129 201
315 iso_pu_bacteria 2904479285 2904482182 201
316 iso_pu_bacteria 2939631187 2939636157 201
317 iso_pu_bacteria 2945972063 2945972340 201
318 2162886011 MRS1b_contig_4547141 MRS1b_0058.00002620 202
319 3300001979 JGI24740J21852_10039408 JGI24740J21852_100394082 202
320 3300001989 JGI24739J22299_10002704 JGI24739J22299_100027042 202
321 3300002076 JGI24749J21850_1005872 JGI24749J21850_10058722 202
322 3300005290 Ga0065712_10075800 Ga0065712_100758002 202
323 3300005293 Ga0065715_10108244 Ga0065715_101082443 202
324 3300005328 Ga0070676_10386173 Ga0070676_103861731 202
325 3300005331 Ga0070670_100053018 Ga0070670_1000530182 202
326 3300005333 Ga0070677_10123922 Ga0070677_101239222 202
327 3300005334 Ga0068869_100083655 Ga0068869_1000836552 202
328 3300005335 Ga0070666_10005165 Ga0070666_100051653 202
329 3300005335 Ga0070666_10312389 Ga0070666_103123892 202
330 3300005338 Ga0068868_100065298 Ga0068868_1000652982 202
331 3300005340 Ga0070689_100022404 Ga0070689_1000224043 202
332 3300005344 Ga0070661_100037878 Ga0070661_1000378781 202
333 3300005344 Ga0070661_100683124 Ga0070661_1006831241 202
334 3300005347 Ga0070668_100013114 Ga0070668_1000131144 202
335 3300005347 Ga0070668_100082378 Ga0070668_1000823782 202
336 3300005353 Ga0070669_100295765 Ga0070669_1002957652 202
337 3300005354 Ga0070675_100014247 Ga0070675_1000142473 202
338 3300005355 Ga0070671_100150764 Ga0070671_1001507643 202
339 3300005364 Ga0070673_100006122 Ga0070673_1000061227 202
340 3300005364 Ga0070673_100854296 Ga0070673_1008542962 202
341 3300005365 Ga0070688_100013691 Ga0070688_1000136915 202
342 3300005366 Ga0070659_100417752 Ga0070659_1004177522 202
343 3300005367 Ga0070667_100015155 Ga0070667_1000151556 202
344 3300005367 Ga0070667_100162799 Ga0070667_1001627992 202
345 3300005367 Ga0070667_100230334 Ga0070667_1002303342 202
346 3300005441 Ga0070700_100226398 Ga0070700_1002263983 202
347 3300005456 Ga0070678_100128207 Ga0070678_1001282072 202
348 3300005457 Ga0070662_100132419 Ga0070662_1001324192 202
349 3300005459 Ga0068867_100477166 Ga0068867_1004771662 202
350 3300005539 Ga0068853_100273506 Ga0068853_1002735062 202
351 3300005543 Ga0070672_100027413 Ga0070672_1000274133 202
352 3300005546 Ga0070696_100083263 Ga0070696_1000832632 202
353 3300005548 Ga0070665_100039775 Ga0070665_1000397754 202
354 3300005564 Ga0070664_100017168 Ga0070664_1000171688 202
355 3300005617 Ga0068859_100084543 Ga0068859_1000845433 202
356 3300005617 Ga0068859_100314725 Ga0068859_1003147252 202
357 3300005618 Ga0068864_100184734 Ga0068864_1001847342 202
358 3300005719 Ga0068861_100226223 Ga0068861_1002262232 202
359 3300005834 Ga0068851_10038923 Ga0068851_100389232 202
360 3300005841 Ga0068863_100105708 Ga0068863_1001057084 202
361 3300005842 Ga0068858_100103556 Ga0068858_1001035563 202
362 3300005843 Ga0068860_100017491 Ga0068860_1000174912 202
363 3300005844 Ga0068862_100043323 Ga0068862_1000433232 202
364 3300006042 Ga0075368_10157189 Ga0075368_101571891 202
365 3300006048 Ga0075363_100034755 Ga0075363_1000347552 202
366 3300006237 Ga0097621_100023567 Ga0097621_1000235672 202
367 3300006358 Ga0068871_100064624 Ga0068871_1000646242 202
368 3300006852 Ga0075433_10837072 Ga0075433_108370721 202
369 3300006931 Ga0097620_100084548 Ga0097620_1000845483 202
370 3300006931 Ga0097620_100314700 Ga0097620_1003147002 202
371 3300009177 Ga0105248_10040395 Ga0105248_100403952 202
372 3300009545 Ga0105237_10037702 Ga0105237_100377023 202
373 3300009545 Ga0105237_10665503 Ga0105237_106655032 202
374 3300009551 Ga0105238_10158883 Ga0105238_101588833 202
375 3300013105 Ga0157369_10025811 Ga0157369_100258115 202
376 3300013105 Ga0157369_10042214 Ga0157369_100422144 202
377 3300013296 Ga0157374_10080142 Ga0157374_100801426 202
378 3300013297 Ga0157378_10028412 Ga0157378_100284127 202
379 3300013306 Ga0163162_10015195 Ga0163162_100151954 202
380 3300013306 Ga0163162_10097496 Ga0163162_100974962 202
381 3300013308 Ga0157375_10078703 Ga0157375_100787033 202
382 3300014325 Ga0163163_10040723 Ga0163163_100407236 202
383 3300014745 Ga0157377_10454290 Ga0157377_104542902 202
384 3300014968 Ga0157379_10484902 Ga0157379_104849021 202
385 3300014969 Ga0157376_10721992 Ga0157376_107219922 202
386 3300016635 Ga0183361_10003 Ga0183361_1000356 202
387 3300017792 Ga0163161_10074011 Ga0163161_100740112 202
388 3300025321 Ga0207656_10024672 Ga0207656_100246722 202
389 3300025893 Ga0207682_10027715 Ga0207682_100277152 202
390 3300025903 Ga0207680_10001613 Ga0207680_1000161314 202
391 3300025907 Ga0207645_10522916 Ga0207645_105229162 202
392 3300025908 Ga0207643_10006084 Ga0207643_100060842 202
393 3300025913 Ga0207695_10800820 Ga0207695_108008202 202
394 3300025919 Ga0207657_10513783 Ga0207657_105137832 202
395 3300025920 Ga0207649_10107622 Ga0207649_101076223 202
396 3300025924 Ga0207694_10132236 Ga0207694_101322363 202
397 3300025925 Ga0207650_10051663 Ga0207650_100516632 202
398 3300025926 Ga0207659_10004406 Ga0207659_1000440612 202
399 3300025926 Ga0207659_10008459 Ga0207659_100084594 202
400 3300025931 Ga0207644_10054153 Ga0207644_100541532 202
401 3300025931 Ga0207644_10131464 Ga0207644_101314642 202
402 3300025933 Ga0207706_10040542 Ga0207706_100405422 202
403 3300025936 Ga0207670_10023518 Ga0207670_100235185 202
404 3300025938 Ga0207704_10719391 Ga0207704_107193912 202
405 3300025940 Ga0207691_10045917 Ga0207691_100459175 202
406 3300025941 Ga0207711_10028440 Ga0207711_100284405 202
407 3300025941 Ga0207711_10057540 Ga0207711_100575402 202
408 3300025942 Ga0207689_10128126 Ga0207689_101281262 202
409 3300025944 Ga0207661_10023055 Ga0207661_100230557 202
410 3300025945 Ga0207679_10016046 Ga0207679_100160462 202
411 3300025960 Ga0207651_10007067 Ga0207651_100070673 202
412 3300025960 Ga0207651_10040604 Ga0207651_100406044 202
413 3300025972 Ga0207668_10034413 Ga0207668_100344132 202
414 3300025986 Ga0207658_10135419 Ga0207658_101354191 202
415 3300025986 Ga0207658_10199189 Ga0207658_101991892 202
416 3300025986 Ga0207658_10212765 Ga0207658_102127652 202
417 3300026023 Ga0207677_10005306 Ga0207677_100053069 202
418 3300026035 Ga0207703_10105362 Ga0207703_101053622 202
419 3300026067 Ga0207678_10169196 Ga0207678_101691962 202
420 3300026075 Ga0207708_10485912 Ga0207708_104859122 202
421 3300026088 Ga0207641_10024027 Ga0207641_100240273 202
422 3300026088 Ga0207641_10392472 Ga0207641_103924722 202
423 3300026089 Ga0207648_10468921 Ga0207648_104689212 202
424 3300026089 Ga0207648_10510988 Ga0207648_105109882 202
425 3300026095 Ga0207676_10144956 Ga0207676_101449562 202
426 3300026095 Ga0207676_10500506 Ga0207676_105005061 202
427 3300026118 Ga0207675_100257735 Ga0207675_1002577351 202
428 3300026118 Ga0207675_100487956 Ga0207675_1004879562 202
429 3300026121 Ga0207683_10090815 Ga0207683_100908152 202
430 3300027312 Ga0209371_1018251 Ga0209371_10182512 202
431 3300028379 Ga0268266_10028030 Ga0268266_100280307 202
432 3300028380 Ga0268265_10102289 Ga0268265_101022892 202
433 3300028381 Ga0268264_10015685 Ga0268264_100156858 202
434 3300028381 Ga0268264_10037091 Ga0268264_100370914 202
435 3300030500 Ga0268256_1011464 Ga0268256_10114643 202
436 3300036401 Ga0373937_0016771 Ga0373937_0016771_4504_5112 202
437 3300037068 Ga0373925_0282188 Ga0373925_0282188_250_858 202
438 3300046457 Ga0495590_0044311 Ga0495590_0044311_158_796 202
439 3300046457 Ga0495590_0138054 Ga0495590_0138054_173_856 202
440 3300046459 Ga0495629_0014856 Ga0495629_0014856_3324_3941 202
441 3300046459 Ga0495629_0043493 Ga0495629_0043493_2485_3108 202
442 3300046463 Ga0495653_0000283 Ga0495653_0000283_26130_26753 202
443 3300046477 Ga0495664_0002027 Ga0495664_0002027_9121_9744 202
444 3300046500 Ga0495596_0007730 Ga0495596_0007730_540_1157 202
445 3300046507 Ga0495606_0013396 Ga0495606_0013396_2666_3304 202
446 3300046507 Ga0495606_0063250 Ga0495606_0063250_46_663 202
447 3300046507 Ga0495606_0083659 Ga0495606_0083659_529_1152 202
448 3300046512 Ga0495610_0008455 Ga0495610_0008455_2231_2848 202
449 3300046516 Ga0495628_0003075 Ga0495628_0003075_12489_13112 202
450 3300046516 Ga0495628_0040667 Ga0495628_0040667_2714_3379 202
451 3300046517 Ga0495630_0001008 Ga0495630_0001008_12169_12792 202
452 3300046528 Ga0495642_0133436 Ga0495642_0133436_428_1045 202
453 3300046529 Ga0495652_0005427 Ga0495652_0005427_619_1242 202
454 3300046531 Ga0495665_0000067 Ga0495665_0000067_27098_27721 202
455 3300046535 Ga0495586_0025345 Ga0495586_0025345_607_1230 202
456 3300046535 Ga0495586_0569095 Ga0495586_0569095_22_639 202
457 3300046542 Ga0495597_0010258 Ga0495597_0010258_1875_2513 202
458 3300046543 Ga0495645_0132296 Ga0495645_0132296_567_1184 202
459 3300046663 Ga0495635_0003175 Ga0495635_0003175_6054_6677 202
460 3300046679 Ga0495623_0001735 Ga0495623_0001735_11651_12274 202
461 3300046680 Ga0495646_0000220 Ga0495646_0000220_17152_17775 202
462 3300046690 Ga0495624_0000356 Ga0495624_0000356_23766_24389 202
463 3300046694 Ga0495649_0005285 Ga0495649_0005285_1292_1930 202
464 3300046809 Ga0495600_0125839 Ga0495600_0125839_637_1254 202
465 3300046809 Ga0495600_0213778 Ga0495600_0213778_287_904 202
466 3300046809 Ga0495600_0460483 Ga0495600_0460483_93_716 202
467 3300047315 Ga0495581_0126967 Ga0495581_0126967_370_993 202
468 3300047317 Ga0495604_0013832 Ga0495604_0013832_5599_6222 202
469 3300047322 Ga0495680_0001377 Ga0495680_0001377_11074_11697 202
470 3300047323 Ga0495683_0001926 Ga0495683_0001926_4800_5438 202
471 3300047323 Ga0495683_0034934 Ga0495683_0034934_1846_2463 202
472 3300047443 Ga0495687_009962 Ga0495687_009962_1310_1927 202
473 3300047443 Ga0495687_012463 Ga0495687_012463_1836_2474 202
474 3300047444 Ga0495675_0019376 Ga0495675_0019376_131_796 202
475 3300047673 Ga0495593_0000220 Ga0495593_0000220_10855_11478 202
476 3300048088 Ga0495602_0005016 Ga0495602_0005016_5219_5842 202
477 3300048088 Ga0495602_0027203 Ga0495602_0027203_1176_1841 202
478 3300048903 Ga0496100_0002134 Ga0496100_0002134_4295_4918 202
479 3300048903 Ga0496100_0125506 Ga0496100_0125506_496_1104 202
480 3300048904 Ga0496101_0005093 Ga0496101_0005093_1534_2157 202
481 3300048905 Ga0496102_0008651 Ga0496102_0008651_21_644 202
482 3300048905 Ga0496102_0140998 Ga0496102_0140998_272_880 202
483 3300048906 Ga0496103_0411690 Ga0496103_0411690_67_675 202
484 3300048907 Ga0496104_0000359 Ga0496104_0000359_7658_8281 202
485 3300048907 Ga0496104_0174521 Ga0496104_0174521_19_627 202
486 3300048908 Ga0496105_0003237 Ga0496105_0003237_7807_8430 202
487 3300048908 Ga0496105_0210724 Ga0496105_0210724_411_1019 202
488 3300048909 Ga0496106_0122805 Ga0496106_0122805_963_1586 202
489 3300048909 Ga0496106_0810142 Ga0496106_0810142_84_692 202
490 3300048912 Ga0496109_0036211 Ga0496109_0036211_471_1079 202
491 3300048913 Ga0496110_0021238 Ga0496110_0021238_4535_5143 202
492 3300048913 Ga0496110_0127972 Ga0496110_0127972_607_1230 202
493 3300048917 Ga0496114_0091143 Ga0496114_0091143_646_1254 202
494 3300048920 Ga0496117_0014336 Ga0496117_0014336_2453_3070 202
495 3300048921 Ga0496118_0004700 Ga0496118_0004700_9164_9781 202
496 3300048922 Ga0496119_0037411 Ga0496119_0037411_637_1260 202
497 3300048924 Ga0496121_0021582 Ga0496121_0021582_2746_3369 202
498 3300048925 Ga0496122_0111098 Ga0496122_0111098_1092_1715 202
499 3300048929 Ga0496126_0053950 Ga0496126_0053950_1084_1707 202
500 3300049592 Ga0501076_0254519 Ga0501076_0254519_66_686 202
501 3300049743 Ga0501081_0395265 Ga0501081_0395265_62_682 202
502 3300050490 nmdc:mga03n38_87704_c1 nmdc:mga03n38_87704_c1_232_852 202
503 3300053130 Ga0500642_0000850 Ga0500642_0000850_4165_4782 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

146

211

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

30

99

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

25

104

0.85

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

21

98

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ibp-assembly1.cif.gz_A crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900011, with bound glutathione 0.9639 2 200
4ibp-assembly1.cif.gz_A crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900011, with bound glutathione 0.9454 2 200
4iji-assembly4.cif.gz_E crystal structure of a glutathione transferase family member from psuedomonas fluorescens pf-5, target efi-900011, with bound s-(propanoic acid)-glutathione 0.9432 2 199
4iji-assembly2.cif.gz_C crystal structure of a glutathione transferase family member from psuedomonas fluorescens pf-5, target efi-900011, with bound s-(propanoic acid)-glutathione 0.9383 1 200
4iji-assembly1.cif.gz_F crystal structure of a glutathione transferase family member from psuedomonas fluorescens pf-5, target efi-900011, with bound s-(propanoic acid)-glutathione 0.9354 2 200
ID Description Score Start End Superfamily
4gltD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9428 82 190 1.20.1050.10
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9286 2 77 3.40.30.10
4ijiG02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.925 82 190 1.20.1050.10
4ibpA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9227 82 190 1.20.1050.10
af_Q4CZ29_2_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9204 2 77 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3A9JJW8-F1-model_v4 Glutathione S-transferase family protein 0.9878 1 199 GO:0016740
AF-A0A7Y3SP25-F1-model_v4 deleted 0.9866 1 201
AF-A0A5N7RLG9-F1-model_v4 Glutathione S-transferase 0.9854 1 201 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A1G8ABG5-F1-model_v4 Glutathione S-transferase 0.9854 1 201 GO:0005737
GO:0016740
AF-A0A208XI22-F1-model_v4 GST N-terminal domain-containing protein 0.9803 2 201 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Feature Viewer

pLDDT pTM Quality
96.09 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map