F456069

General Info

Members Datasets Scaffolds Average Seq Length
503 235 1004 219

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0000132|Ga0495638_0000132_98700_99356
Length 218
Sequence MRKIQVITLFPDMFSGVFNSSMLWKAQNKQIVEFKLIDLRQFGLGPRRQVDDTPYGGGDGMLLKPEPLFAAVAAAKSYDPNARVLLMTPRGERWRQALAQQWANEEAAGLIVICGRYEGYDERITAVVDAQFSVGDYVLTGGELPAMTIIDSIVRLIPGVLGGEASAEIESFSDGETLEFPQYTRPEEFEGIKVPEVLLSGNHAAIEAWRIEQSKKAS

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
68 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
69 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
70 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
123 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
124 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
125 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
149 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
150 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
155 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
215 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
216 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
223 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
226 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
227 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
230 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
231 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
232 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
233 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.64
Nodule 0
Rhizoplane 1.19
Rhizosphere 68.79
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0000132 3300046460 Bacteria 120039
2 MBSR1b_contig_6117524 2162886012 Bacteria 3487
3 JGI24740J21852_10027231 3300001979 Bacteria 1904
4 JGI24737J22298_10002203 3300001990 Bacteria 6943
5 JGI24735J21928_10000149 3300002067 Bacteria 24660
6 JGI24738J21930_10001791 3300002075 Bacteria 5840
7 JGI24742J22300_10000035 3300002244 Bacteria 20678
8 rootH1_10002936 3300003316 Bacteria 45055
9 rootH2_10006847 3300003320 Bacteria 155484
10 rootL2_10079259 3300003322 Bacteria 1463
11 rootL2_10094401 3300003322 Bacteria 4065
12 rootL2_10168822 3300003322 Bacteria 2123
13 rootL2_10202443 3300003322 Bacteria 3213
14 rootL2_10256332 3300003322 Bacteria 4977
15 rootL2_10315181 3300003322 Unclassified 1784
16 rootH1_10030295 3300003323 Bacteria 20195
17 rootH1_10131014 3300003323 Unclassified 1920
18 rootH1_10311088 3300003323 Bacteria 4960
19 Ga0065715_10003451 3300005293 Bacteria 5227
20 Ga0070658_10000024 3300005327 Bacteria 175873
21 Ga0070658_10568127 3300005327 Bacteria 982
22 Ga0070676_10004851 3300005328 Bacteria 7119
23 Ga0070683_100000112 3300005329 Bacteria 53123
24 Ga0070683_100010750 3300005329 Bacteria 7874
25 Ga0070680_100012114 3300005336 Bacteria 6695
26 Ga0070682_100006184 3300005337 Bacteria 6708
27 Ga0070660_100000298 3300005339 Bacteria 33050
28 Ga0070660_100000316 3300005339 Bacteria 31842
29 Ga0070660_100096723 3300005339 Unclassified 2335
30 Ga0070660_100336081 3300005339 Bacteria 1242
31 Ga0070691_10011663 3300005341 Bacteria 4018
32 Ga0070661_100093549 3300005344 Bacteria 2227
33 Ga0070674_100005409 3300005356 Bacteria 7373
34 Ga0070673_100000033 3300005364 Bacteria 60744
35 Ga0070659_100000672 3300005366 Bacteria 24887
36 Ga0070659_100089113 3300005366 Bacteria 2471
37 Ga0070667_100026048 3300005367 Bacteria 4863
38 Ga0070678_100000201 3300005456 Bacteria 26383
39 Ga0070678_100003010 3300005456 Bacteria 9340
40 Ga0070662_100009029 3300005457 Bacteria 6502
41 Ga0070662_100369986 3300005457 Bacteria 1178
42 Ga0070681_10030790 3300005458 Bacteria 5385
43 Ga0068867_100008780 3300005459 Bacteria 7137
44 Ga0070685_10000690 3300005466 Bacteria 18276
45 Ga0070679_100020035 3300005530 Bacteria 6518
46 Ga0070679_100023675 3300005530 Bacteria 6015
47 Ga0070679_100124601 3300005530 Unclassified 2559
48 Ga0070679_100170654 3300005530 Bacteria 2148
49 Ga0070684_100000049 3300005535 Bacteria 79768
50 Ga0070684_100046576 3300005535 Bacteria 3757
51 Ga0070686_100019349 3300005544 Bacteria 4010
52 Ga0070686_100143965 3300005544 Bacteria 1662
53 Ga0070686_100470098 3300005544 Unclassified 970
54 Ga0068855_100000002 3300005563 Bacteria 616881
55 Ga0068855_100000558 3300005563 Bacteria 45648
56 Ga0068855_100000663 3300005563 Bacteria 41994
57 Ga0068855_100003761 3300005563 Bacteria 18553
58 Ga0068855_100042951 3300005563 Bacteria 5356
59 Ga0068855_101133363 3300005563 Unclassified 816
60 Ga0070664_100000123 3300005564 Bacteria 51444
61 Ga0070664_100033858 3300005564 Bacteria 4283
62 Ga0068857_100000002 3300005577 Bacteria 241401
63 Ga0068857_100000441 3300005577 Bacteria 29474
64 Ga0068857_100021011 3300005577 Bacteria 5744
65 Ga0068857_100067343 3300005577 Bacteria 3187
66 Ga0068857_100137169 3300005577 Bacteria 2209
67 Ga0068854_100097044 3300005578 Bacteria 2203
68 Ga0068854_100130351 3300005578 Bacteria 1919
69 Ga0068856_100000001 3300005614 Bacteria 565602
70 Ga0068856_100000027 3300005614 Bacteria 133290
71 Ga0068856_100000200 3300005614 Bacteria 63772
72 Ga0068856_100088978 3300005614 Bacteria 3070
73 Ga0068856_100124656 3300005614 Unclassified 2579
74 Ga0068856_100593876 3300005614 Bacteria 1128
75 Ga0068852_100000001 3300005616 Bacteria 716526
76 Ga0068852_100000155 3300005616 Bacteria 45515
77 Ga0068852_100127692 3300005616 Bacteria 2337
78 Ga0068864_100497451 3300005618 Bacteria 1172
79 Ga0068858_100261066 3300005842 Bacteria 1646
80 Ga0068860_100013616 3300005843 Bacteria 7972
81 Ga0081455_10000001 3300005937 Bacteria 603871
82 Ga0081539_10003201 3300005985 Bacteria 20691
83 Ga0075365_10000001 3300006038 Bacteria 371589
84 Ga0075365_10000014 3300006038 Bacteria 79945
85 Ga0075365_10029935 3300006038 Bacteria 3483
86 Ga0075365_10042374 3300006038 Bacteria 2976
87 Ga0075365_10093438 3300006038 Unclassified 2052
88 Ga0075365_10127123 3300006038 Unclassified 1762
89 Ga0075368_10000065 3300006042 Bacteria 25604
90 Ga0075368_10002082 3300006042 Bacteria 6462
91 Ga0075363_100018117 3300006048 Bacteria 3503
92 Ga0075363_100160372 3300006048 Bacteria 1273
93 Ga0075364_10002663 3300006051 Bacteria 10027
94 Ga0075364_10002700 3300006051 Bacteria 9968
95 Ga0075364_10006382 3300006051 Bacteria 6932
96 Ga0075364_10009765 3300006051 Bacteria 5769
97 Ga0075362_10000063 3300006177 Bacteria 31783
98 Ga0075362_10084474 3300006177 Bacteria 1467
99 Ga0075362_10216418 3300006177 Bacteria 935
100 Ga0075367_10000093 3300006178 Bacteria 24511
101 Ga0075367_10009612 3300006178 Bacteria 5061
102 Ga0075369_10000001 3300006186 Bacteria 299616
103 Ga0075369_10000181 3300006186 Bacteria 18065
104 Ga0075366_10000001 3300006195 Bacteria 569172
105 Ga0075366_10000138 3300006195 Bacteria 30666
106 Ga0075366_10001109 3300006195 Bacteria 13248
107 Ga0075366_10001938 3300006195 Bacteria 10463
108 Ga0075366_10002568 3300006195 Bacteria 9334
109 Ga0075366_10239071 3300006195 Bacteria 1107
110 Ga0075366_10246603 3300006195 Bacteria 1089
111 Ga0097621_100000001 3300006237 Bacteria 632268
112 Ga0097621_100043685 3300006237 Bacteria 3613
113 Ga0075370_10000462 3300006353 Bacteria 15151
114 Ga0075370_10006270 3300006353 Bacteria 5971
115 Ga0075370_10052787 3300006353 Unclassified 2307
116 Ga0075370_10187760 3300006353 Unclassified 1217
117 Ga0068871_100000002 3300006358 Bacteria 152322
118 Ga0068871_100000232 3300006358 Bacteria 39467
119 Ga0075428_100001999 3300006844 Bacteria 21962
120 Ga0068865_100000307 3300006881 Bacteria 27001
121 Ga0105240_10000003 3300009093 Bacteria 1183681
122 Ga0105240_10000004 3300009093 Bacteria 708156
123 Ga0105240_10000050 3300009093 Bacteria 236144
124 Ga0105240_10001357 3300009093 Bacteria 42000
125 Ga0105240_10032247 3300009093 Bacteria 6785
126 Ga0105240_10233925 3300009093 Bacteria 2134
127 Ga0111539_10001451 3300009094 Bacteria 31651
128 Ga0105245_10000001 3300009098 Bacteria 939270
129 Ga0105245_10000002 3300009098 Bacteria 634374
130 Ga0105245_10000200 3300009098 Bacteria 57196
131 Ga0105245_10006834 3300009098 Bacteria 10007
132 Ga0105243_10000001 3300009148 Bacteria 1156578
133 Ga0105241_10000842 3300009174 Bacteria 23254
134 Ga0105241_10126007 3300009174 Bacteria 2068
135 Ga0105241_10169893 3300009174 Bacteria 1800
136 Ga0105241_10257938 3300009174 Bacteria 1481
137 Ga0105242_10000001 3300009176 Bacteria 574039
138 Ga0105242_10002087 3300009176 Bacteria 15739
139 Ga0105248_10830652 3300009177 Bacteria 1043
140 Ga0105237_10000001 3300009545 Bacteria 1009213
141 Ga0105237_10000002 3300009545 Bacteria 702357
142 Ga0105237_10009293 3300009545 Bacteria 10533
143 Ga0105237_10114986 3300009545 Bacteria 2684
144 Ga0105237_10838583 3300009545 Bacteria 926
145 Ga0105238_10062208 3300009551 Bacteria 3733
146 Ga0105238_10064247 3300009551 Bacteria 3671
147 Ga0105238_10072227 3300009551 Bacteria 3447
148 Ga0105238_10144125 3300009551 Bacteria 2359
149 Ga0105238_11434845 3300009551 Bacteria 718
150 Ga0105249_10002504 3300009553 Bacteria 15901
151 Ga0105032_100001 3300009979 Bacteria 472394
152 Ga0105032_100018 3300009979 Bacteria 47684
153 Ga0105032_100148 3300009979 Bacteria 7474
154 Ga0105032_101686 3300009979 Unclassified 2001
155 Ga0105029_100904 3300009984 Bacteria 1722
156 Ga0105033_100258 3300009986 Bacteria 4151
157 Ga0105033_101513 3300009986 Bacteria 1904
158 Ga0105028_100019 3300009993 Bacteria 20066
159 Ga0105239_10001223 3300010375 Bacteria 35012
160 Ga0105239_10004383 3300010375 Bacteria 16901
161 Ga0105239_10042306 3300010375 Unclassified 4993
162 Ga0105246_10007613 3300011119 Bacteria 6643
163 Ga0105246_10168087 3300011119 Unclassified 1677
164 Ga0105246_10182970 3300011119 Bacteria 1615
165 Ga0157373_10000061 3300013100 Bacteria 95718
166 Ga0157373_10012323 3300013100 Bacteria 6288
167 Ga0157373_10064545 3300013100 Unclassified 2592
168 Ga0157373_10171934 3300013100 Bacteria 1524
169 Ga0157371_10000561 3300013102 Bacteria 43999
170 Ga0157371_10001961 3300013102 Bacteria 20429
171 Ga0157371_10037254 3300013102 Bacteria 3482
172 Ga0157371_10341881 3300013102 Bacteria 1088
173 Ga0157370_10002357 3300013104 Bacteria 22781
174 Ga0157370_10012318 3300013104 Bacteria 8877
175 Ga0157370_10035209 3300013104 Bacteria 4869
176 Ga0157370_10203627 3300013104 Bacteria 1835
177 Ga0157370_10332386 3300013104 Unclassified 1401
178 Ga0157369_10000029 3300013105 Bacteria 206955
179 Ga0157369_10000151 3300013105 Bacteria 98331
180 Ga0157369_10000413 3300013105 Bacteria 56589
181 Ga0157369_10000567 3300013105 Bacteria 48628
182 Ga0157369_10008576 3300013105 Bacteria 11723
183 Ga0157369_10013289 3300013105 Bacteria 9316
184 Ga0157369_10084691 3300013105 Bacteria 3388
185 Ga0157369_10112036 3300013105 Bacteria 2899
186 Ga0157369_10189191 3300013105 Bacteria 2163
187 Ga0157374_10000073 3300013296 Bacteria 100517
188 Ga0157374_10001423 3300013296 Bacteria 20253
189 Ga0157374_10004073 3300013296 Bacteria 12275
190 Ga0157374_10213119 3300013296 Bacteria 1894
191 Ga0157374_11338069 3300013296 Bacteria 739
192 Ga0157378_10642517 3300013297 Bacteria 1076
193 Ga0163162_11148948 3300013306 Bacteria 880
194 Ga0157372_10000002 3300013307 Bacteria 687862
195 Ga0157372_10000086 3300013307 Bacteria 96247
196 Ga0157372_10002447 3300013307 Bacteria 20124
197 Ga0157372_10046567 3300013307 Bacteria 4815
198 Ga0157372_10159836 3300013307 Bacteria 2603
199 Ga0157372_10305370 3300013307 Unclassified 1851
200 Ga0157372_10686043 3300013307 Bacteria 1192
201 Ga0163163_10026960 3300014325 Bacteria 5498
202 Ga0163163_10403719 3300014325 Unclassified 1425
203 Ga0157376_10000001 3300014969 Bacteria 842910
204 Ga0157376_10000027 3300014969 Bacteria 204157
205 Ga0157376_10150050 3300014969 Bacteria 2101
206 Ga0207688_10150178 3300025901 Bacteria 1376
207 Ga0207647_10001245 3300025904 Bacteria 19575
208 Ga0207647_10067177 3300025904 Bacteria 2174
209 Ga0207645_10010575 3300025907 Bacteria 6332
210 Ga0207705_10000047 3300025909 Bacteria 175887
211 Ga0207705_10000115 3300025909 Bacteria 89955
212 Ga0207705_10190644 3300025909 Unclassified 1550
213 Ga0207705_10198114 3300025909 Unclassified 1521
214 Ga0207705_10331988 3300025909 Bacteria 1170
215 Ga0207654_10012883 3300025911 Unclassified 4290
216 Ga0207654_10144880 3300025911 Bacteria 1519
217 Ga0207654_10173641 3300025911 Bacteria 1401
218 Ga0207695_10000009 3300025913 Bacteria 1034276
219 Ga0207695_10000158 3300025913 Bacteria 201891
220 Ga0207695_10012231 3300025913 Bacteria 10306
221 Ga0207695_10396347 3300025913 Bacteria 1265
222 Ga0207671_10000003 3300025914 Bacteria 1065461
223 Ga0207671_10000008 3300025914 Bacteria 798229
224 Ga0207671_10080255 3300025914 Bacteria 2445
225 Ga0207660_10085381 3300025917 Bacteria 2328
226 Ga0207657_10000712 3300025919 Bacteria 35358
227 Ga0207657_10002562 3300025919 Bacteria 19664
228 Ga0207657_10004361 3300025919 Bacteria 14986
229 Ga0207657_10044405 3300025919 Bacteria 3906
230 Ga0207657_10052585 3300025919 Bacteria 3534
231 Ga0207657_10061138 3300025919 Unclassified 3231
232 Ga0207649_10004926 3300025920 Bacteria 7218
233 Ga0207652_10019802 3300025921 Bacteria 5539
234 Ga0207652_10028902 3300025921 Bacteria 4628
235 Ga0207652_10542797 3300025921 Bacteria 1045
236 Ga0207694_10096061 3300025924 Bacteria 2344
237 Ga0207694_10157135 3300025924 Bacteria 1835
238 Ga0207694_10341208 3300025924 Bacteria 1239
239 Ga0207687_10000001 3300025927 Bacteria 1130810
240 Ga0207687_10000004 3300025927 Bacteria 841177
241 Ga0207690_10000527 3300025932 Bacteria 24894
242 Ga0207690_10002652 3300025932 Bacteria 10785
243 Ga0207706_10000073 3300025933 Bacteria 103803
244 Ga0207706_10840946 3300025933 Bacteria 778
245 Ga0207686_10017794 3300025934 Bacteria 4010
246 Ga0207669_10006666 3300025937 Bacteria 5292
247 Ga0207704_10001468 3300025938 Bacteria 10545
248 Ga0207661_10000077 3300025944 Bacteria 67190
249 Ga0207661_10002445 3300025944 Bacteria 12778
250 Ga0207679_10000124 3300025945 Bacteria 63038
251 Ga0207667_10000005 3300025949 Bacteria 715503
252 Ga0207667_10000060 3300025949 Bacteria 192320
253 Ga0207667_10000756 3300025949 Bacteria 42002
254 Ga0207667_10038991 3300025949 Bacteria 5066
255 Ga0207667_10123290 3300025949 Bacteria 2670
256 Ga0207651_10000141 3300025960 Bacteria 31367
257 Ga0207712_10003874 3300025961 Bacteria 9451
258 Ga0207640_10110274 3300025981 Bacteria 1949
259 Ga0207658_10009982 3300025986 Bacteria 6453
260 Ga0207658_10016737 3300025986 Bacteria 5046
261 Ga0207703_10114112 3300026035 Bacteria 2310
262 Ga0207702_10000001 3300026078 Bacteria 895738
263 Ga0207702_10000015 3300026078 Bacteria 250830
264 Ga0207702_10000034 3300026078 Bacteria 164965
265 Ga0207702_10000057 3300026078 Bacteria 131118
266 Ga0207702_10211055 3300026078 Bacteria 1805
267 Ga0207702_10746796 3300026078 Bacteria 966
268 Ga0207648_10026260 3300026089 Bacteria 5177
269 Ga0207674_10000001 3300026116 Bacteria 616581
270 Ga0207674_10000878 3300026116 Bacteria 39325
271 Ga0207674_10020195 3300026116 Bacteria 7203
272 Ga0207674_10025636 3300026116 Bacteria 6280
273 Ga0207674_10257702 3300026116 Bacteria 1691
274 Ga0207674_10341468 3300026116 Bacteria 1448
275 Ga0207674_10566842 3300026116 Unclassified 1097
276 Ga0207683_10003131 3300026121 Bacteria 14456
277 Ga0207683_10008126 3300026121 Bacteria 8974
278 Ga0207698_10000001 3300026142 Bacteria 625389
279 Ga0207698_10000048 3300026142 Bacteria 90201
280 Ga0207698_10014507 3300026142 Bacteria 5241
281 Ga0209813_10000001 3300027866 Bacteria 280406
282 Ga0209813_10000335 3300027866 Bacteria 12250
283 Ga0207428_10038033 3300027907 Bacteria 3914
284 Ga0268264_10022595 3300028381 Bacteria 5134
285 Ga0265326_10000530 3300028558 Bacteria 14529
286 Ga0265326_10001685 3300028558 Bacteria 7649
287 Ga0265334_10000115 3300028573 Bacteria 52649
288 Ga0265334_10002006 3300028573 Bacteria 9646
289 Ga0265334_10004363 3300028573 Bacteria 6287
290 Ga0265336_10000424 3300028666 Bacteria 26224
291 Ga0265336_10000652 3300028666 Bacteria 18911
292 Ga0265338_10000003 3300028800 Bacteria 733923
293 Ga0265338_10000039 3300028800 Bacteria 236135
294 Ga0265338_10000482 3300028800 Bacteria 71209
295 Ga0265338_10000625 3300028800 Bacteria 61650
296 Ga0265338_10012735 3300028800 Bacteria 9568
297 Ga0265324_10039495 3300029957 Bacteria 1636
298 Ga0314311_1023813 3300030733 Bacteria 1073
299 Ga0314311_1061458 3300030733 Bacteria 2888
300 Ga0316179_1064424 3300030734 Bacteria 12008
301 Ga0316178_1164474 3300030735 Bacteria 1441
302 Ga0316180_1178386 3300030736 Bacteria 3765
303 Ga0316183_1069499 3300030742 Bacteria 3281
304 Ga0316183_1103932 3300030742 Bacteria 7412
305 Ga0316183_1119405 3300030742 Bacteria 2821
306 Ga0316183_1192095 3300030742 Bacteria 16108
307 Ga0316181_1138937 3300030744 Bacteria 58229
308 Ga0316182_1000204 3300030745 Bacteria 16925
309 Ga0316182_1017501 3300030745 Bacteria 11122
310 Ga0316182_1107000 3300030745 Bacteria 3022
311 Ga0316182_1258468 3300030745 Bacteria 2309
312 Ga0265325_10034156 3300031241 Bacteria 2708
313 Ga0265327_10000017 3300031251 Bacteria 445264
314 Ga0307509_10019515 3300031507 Bacteria 7727
315 Ga0265313_10035909 3300031595 Bacteria 2491
316 Ga0265313_10146440 3300031595 Bacteria 1012
317 Ga0307516_10000078 3300031730 Bacteria 106523
318 Ga0307516_10008182 3300031730 Bacteria 11877
319 Ga0307406_10000001 3300031901 Bacteria 638191
320 Ga0307406_10000610 3300031901 Bacteria 20414
321 Ga0373959_0000052 3300034820 Bacteria 26566
322 Ga0395899_0003792 3300037312 Bacteria 11936
323 Ga0395899_0074289 3300037312 Unclassified 2484
324 Ga0395899_0147813 3300037312 Unclassified 1667
325 Ga0395900_0000001 3300037418 Bacteria 931146
326 Ga0395900_0208489 3300037418 Bacteria 1974
327 Ga0395900_0252072 3300037418 Unclassified 1766
328 Ga0395900_0464753 3300037418 Unclassified 1219
329 Ga0395900_0610166 3300037418 Bacteria 1031
330 Ga0395898_0000002 3300037466 Bacteria 931013
331 Ga0395898_0015984 3300037466 Bacteria 7689
332 Ga0395898_0038110 3300037466 Bacteria 4766
333 Ga0395905_0002429 3300037471 Bacteria 20672
334 Ga0395901_0000006 3300038443 Bacteria 514112
335 Ga0395901_0006327 3300038443 Bacteria 11992
336 Ga0395901_0010187 3300038443 Bacteria 9524
337 Ga0395901_0036009 3300038443 Bacteria 5114
338 Ga0439438_017103 3300041405 Unclassified 2095
339 Ga0439461_0005440 3300041410 Bacteria 2169
340 Ga0451853_0989547 3300041512 Unclassified 1467
341 Ga0439431_0036841 3300041997 Unclassified 1233
342 Ga0439442_014942 3300042002 Bacteria 1599
343 Ga0439445_0001581 3300042004 Bacteria 4962
344 Ga0439432_041379 3300042006 Unclassified 1459
345 Ga0439463_003406 3300042016 Bacteria 4030
346 Ga0450920_002665 3300042122 Bacteria 3057
347 Ga0450906_002227 3300042145 Bacteria 4238
348 Ga0439446_0000001 3300042156 Bacteria 275840
349 Ga0439446_0000974 3300042156 Bacteria 6228
350 Ga0450909_001464 3300042185 Bacteria 3290
351 Ga0439434_0017929 3300042435 Unclassified 2119
352 Ga0439464_0001074 3300042439 Bacteria 6281
353 Ga0450918_005396 3300042531 Bacteria 2301
354 Ga0466972_0069662 3300044658 Bacteria 1679
355 Ga0466965_0000206 3300044683 Bacteria 18416
356 Ga0466963_0120632 3300044694 Bacteria 1804
357 Ga0453684_0264865 3300044712 Bacteria 1967
358 Ga0453684_0463256 3300044712 Bacteria 1409
359 Ga0451576_0034967 3300045051 Bacteria 5333
360 Ga0466958_0267103 3300045836 Unclassified 1095
361 Ga0495638_0000551 3300046460 Bacteria 42775
362 Ga0495583_0003976 3300046506 Bacteria 10912
363 Ga0495583_0088037 3300046506 Unclassified 1341
364 Ga0495588_0000171 3300046674 Bacteria 83176
365 Ga0495671_0103574 3300046692 Bacteria 1390
366 Ga0495660_0000005 3300046810 Bacteria 574567
367 Ga0495672_0021011 3300047320 Bacteria 4264
368 Ga0496100_0184354 3300048903 Bacteria 1511
369 Ga0496100_0225338 3300048903 Bacteria 1377
370 Ga0496105_0387534 3300048908 Unclassified 1111
371 Ga0496112_0025793 3300048915 Bacteria 5646
372 Ga0496113_0289238 3300048916 Unclassified 1311
373 Ga0496115_0000405 3300048918 Bacteria 35545
374 Ga0496124_0126158 3300048927 Bacteria 2038
375 Ga0496126_0031280 3300048929 Bacteria 5031
376 Ga0501031_0002442 3300049568 Bacteria 11833
377 Ga0501032_0000624 3300049569 Bacteria 28751
378 Ga0501034_0013740 3300049571 Bacteria 8329
379 Ga0501034_0037263 3300049571 Bacteria 4923
380 Ga0501034_0043701 3300049571 Bacteria 4533
381 Ga0501036_0001666 3300049572 Bacteria 17221
382 Ga0501037_0000001 3300049573 Bacteria 753276
383 Ga0501037_0000031 3300049573 Bacteria 133137
384 Ga0501038_0080347 3300049574 Unclassified 2748
385 Ga0501040_0103327 3300049576 Unclassified 1989
386 Ga0501042_0052896 3300049578 Bacteria 2897
387 Ga0501043_0000366 3300049579 Bacteria 40919
388 Ga0501046_0000138 3300049580 Bacteria 77052
389 Ga0501047_0000032 3300049581 Bacteria 208294
390 Ga0501047_0000310 3300049581 Bacteria 56101
391 Ga0501048_0000013 3300049582 Bacteria 76554
392 Ga0501069_0220897 3300049585 Bacteria 1101
393 Ga0501070_0120791 3300049586 Unclassified 2165
394 Ga0501073_0054298 3300049589 Bacteria 2805
395 Ga0501083_0037527 3300049744 Bacteria 3300
396 Ga0501035_0000033 3300049822 Bacteria 175087
397 Ga0501035_0000799 3300049822 Bacteria 33519
398 Ga0501044_0085458 3300049823 Bacteria 3188
399 Ga0501045_0209784 3300049824 Bacteria 1451
400 nmdc:mga03683_191874_c1 3300050489 Bacteria 935
401 nmdc:mga03683_22837_c1 3300050489 Bacteria 2429
402 nmdc:mga03683_80_c1 3300050489 Bacteria 35991
403 nmdc:mga03n38_142_c1 3300050490 Bacteria 15721
404 nmdc:mga03n38_83781_c1 3300050490 Bacteria 1504
405 nmdc:mga00v17_10757_c1 3300050491 Bacteria 5012
406 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
407 nmdc:mga00v17_1693_c1 3300050491 Bacteria 11473
408 nmdc:mga00v17_182905_c1 3300050491 Bacteria 1352
409 nmdc:mga00v17_2126_c1 3300050491 Bacteria 10185
410 nmdc:mga00v17_221460_c1 3300050491 Bacteria 1225
411 nmdc:mga00v17_27256_c1 3300050491 Bacteria 3335
412 nmdc:mga00v17_401052_c1 3300050491 Bacteria 891
413 nmdc:mga0yw44_100729_c1 3300050492 Unclassified 1840
414 nmdc:mga0yw44_14057_c1 3300050492 Bacteria 4236
415 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
416 nmdc:mga0yw44_185144_c1 3300050492 Bacteria 1372
417 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
418 nmdc:mga0yw44_248569_c1 3300050492 Unclassified 1183
419 nmdc:mga0yw44_25522_c1 3300050492 Unclassified 3362
420 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
421 nmdc:mga0yw44_38391_c1 3300050492 Bacteria 2833
422 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
423 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
424 nmdc:mga0k408_13_c1 3300050493 Bacteria 48149
425 nmdc:mga0k408_214_c1 3300050493 Bacteria 31125
426 nmdc:mga0k408_2723_c1 3300050493 Bacteria 9384
427 nmdc:mga0k408_2889_c1 3300050493 Bacteria 9112
428 nmdc:mga0k408_3696_c1 3300050493 Bacteria 7332
429 nmdc:mga0k408_6247_c1 3300050493 Bacteria 6358
430 nmdc:mga06z11_127_c1 3300050494 Bacteria 25603
431 nmdc:mga06z11_15_c1 3300050494 Bacteria 82672
432 nmdc:mga06z11_198_c1 3300050494 Bacteria 24266
433 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
434 nmdc:mga04h51_251_c1 3300050495 Bacteria 14040
435 nmdc:mga04h51_9766_c1 3300050495 Unclassified 2614
436 nmdc:mga07m45_104556_c1 3300050496 Bacteria 1628
437 nmdc:mga07m45_20643_c1 3300050496 Bacteria 2952
438 nmdc:mga07m45_37131_c1 3300050496 Bacteria 2717
439 nmdc:mga07m45_5621_c1 3300050496 Bacteria 6264
440 nmdc:mga08y16_5295_c1 3300050511 Bacteria 13491
441 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
442 nmdc:mga0sz30_48939_c1 3300050516 Bacteria 1790
443 Ga0500610_0000006 3300053079 Bacteria 134304
444 Ga0500610_0051502 3300053079 Bacteria 2144
445 Ga0500643_000043 3300053087 Bacteria 157905
446 Ga0500643_006482 3300053087 Unclassified 4880
447 Ga0500643_013335 3300053087 Unclassified 2906
448 Ga0500644_0000471 3300053088 Bacteria 17804
449 Ga0500644_0000594 3300053088 Bacteria 13826
450 Ga0500644_0008359 3300053088 Bacteria 2730
451 Ga0500644_0023408 3300053088 Bacteria 1876
452 Ga0500644_0029433 3300053088 Bacteria 1727
453 Ga0500646_0000007 3300053090 Bacteria 115744
454 Ga0500646_0000490 3300053090 Bacteria 11629
455 Ga0500583_0000082 3300053092 Bacteria 54810
456 Ga0500583_0006482 3300053092 Bacteria 4034
457 Ga0500651_0000001 3300053093 Bacteria 529808
458 Ga0500651_0000447 3300053093 Bacteria 22020
459 Ga0500651_0002954 3300053093 Bacteria 9156
460 Ga0500651_0042370 3300053093 Bacteria 2868
461 Ga0500651_0057950 3300053093 Bacteria 2423
462 Ga0500641_0000001 3300053096 Bacteria 1115973
463 Ga0500650_0000001 3300053098 Bacteria 818797
464 Ga0500650_0034484 3300053098 Bacteria 2313
465 Ga0500555_000001 3300053103 Bacteria 1353713
466 Ga0500555_000002 3300053103 Bacteria 1314346
467 Ga0500555_000009 3300053103 Bacteria 263998
468 Ga0500556_0012414 3300053104 Bacteria 2545
469 Ga0500562_000002 3300053108 Bacteria 977234
470 Ga0500562_004711 3300053108 Bacteria 3436
471 Ga0500569_000018 3300053109 Bacteria 42775
472 Ga0500593_017808 3300053117 Bacteria 3089
473 Ga0500594_0000001 3300053118 Bacteria 1178472
474 Ga0500594_0000018 3300053118 Bacteria 61549
475 Ga0500614_000001 3300053123 Bacteria 1274484
476 Ga0500614_000921 3300053123 Bacteria 7378
477 Ga0500628_000028 3300053129 Bacteria 59993
478 Ga0500642_0003187 3300053130 Bacteria 4922
479 Ga0500652_000001 3300053131 Bacteria 946868
480 Ga0500652_000022 3300053131 Bacteria 118313
481 Ga0500655_001382 3300053133 Bacteria 4597
482 Ga0500577_0000124 3300053142 Bacteria 18743
483 Ga0500577_0000996 3300053142 Bacteria 7296
484 Ga0500577_0001222 3300053142 Bacteria 6572
485 Ga0500577_0006182 3300053142 Bacteria 3283
486 Ga0500577_0018811 3300053142 Bacteria 2228
487 Ga0500577_0029402 3300053142 Bacteria 1902
488 Ga0500577_0030703 3300053142 Bacteria 1873
489 Ga0500579_000781 3300053143 Bacteria 18261
490 Ga0500588_0000557 3300053146 Bacteria 6064
491 Ga0500589_000013 3300053147 Bacteria 109118
492 Ga0500603_160325 3300053150 Bacteria 701
493 Ga0500604_0002568 3300053151 Bacteria 4949
494 Ga0500616_0000012 3300053153 Bacteria 681798
495 Ga0500620_030693 3300053155 Bacteria 1699
496 Ga0500649_000004 3300053722 Bacteria 139374
497 Ga0500570_002919 3300053724 Bacteria 8651
498 Ga0500570_112686 3300053724 Bacteria 1097
499 Ga0500611_020486 3300053727 Bacteria 1249
500 Ga0500613_004749 3300053738 Unclassified 1270
501 Ga0501084_0311515 3300054114 Bacteria 1329
502 Ga0501082_0510640 3300060353 Bacteria 1050
503 Ga0495638_0000132
504 MBSR1b_contig_6117524
505 JGI24740J21852_10027231
506 JGI24737J22298_10002203
507 JGI24735J21928_10000149
508 JGI24738J21930_10001791
509 JGI24742J22300_10000035
510 rootH1_10002936
511 rootH2_10006847
512 rootL2_10079259
513 rootL2_10094401
514 rootL2_10168822
515 rootL2_10202443
516 rootL2_10256332
517 rootL2_10315181
518 rootH1_10030295
519 rootH1_10131014
520 rootH1_10311088
521 Ga0065715_10003451
522 Ga0070658_10000024
523 Ga0070658_10568127
524 Ga0070676_10004851
525 Ga0070683_100000112
526 Ga0070683_100010750
527 Ga0070680_100012114
528 Ga0070682_100006184
529 Ga0070660_100000298
530 Ga0070660_100000316
531 Ga0070660_100096723
532 Ga0070660_100336081
533 Ga0070691_10011663
534 Ga0070661_100093549
535 Ga0070674_100005409
536 Ga0070673_100000033
537 Ga0070659_100000672
538 Ga0070659_100089113
539 Ga0070667_100026048
540 Ga0070678_100000201
541 Ga0070678_100003010
542 Ga0070662_100009029
543 Ga0070662_100369986
544 Ga0070681_10030790
545 Ga0068867_100008780
546 Ga0070685_10000690
547 Ga0070679_100020035
548 Ga0070679_100023675
549 Ga0070679_100124601
550 Ga0070679_100170654
551 Ga0070684_100000049
552 Ga0070684_100046576
553 Ga0070686_100019349
554 Ga0070686_100143965
555 Ga0070686_100470098
556 Ga0068855_100000002
557 Ga0068855_100000558
558 Ga0068855_100000663
559 Ga0068855_100003761
560 Ga0068855_100042951
561 Ga0068855_101133363
562 Ga0070664_100000123
563 Ga0070664_100033858
564 Ga0068857_100000002
565 Ga0068857_100000441
566 Ga0068857_100021011
567 Ga0068857_100067343
568 Ga0068857_100137169
569 Ga0068854_100097044
570 Ga0068854_100130351
571 Ga0068856_100000001
572 Ga0068856_100000027
573 Ga0068856_100000200
574 Ga0068856_100088978
575 Ga0068856_100124656
576 Ga0068856_100593876
577 Ga0068852_100000001
578 Ga0068852_100000155
579 Ga0068852_100127692
580 Ga0068864_100497451
581 Ga0068858_100261066
582 Ga0068860_100013616
583 Ga0081455_10000001
584 Ga0081539_10003201
585 Ga0075365_10000001
586 Ga0075365_10000014
587 Ga0075365_10029935
588 Ga0075365_10042374
589 Ga0075365_10093438
590 Ga0075365_10127123
591 Ga0075368_10000065
592 Ga0075368_10002082
593 Ga0075363_100018117
594 Ga0075363_100160372
595 Ga0075364_10002663
596 Ga0075364_10002700
597 Ga0075364_10006382
598 Ga0075364_10009765
599 Ga0075362_10000063
600 Ga0075362_10084474
601 Ga0075362_10216418
602 Ga0075367_10000093
603 Ga0075367_10009612
604 Ga0075369_10000001
605 Ga0075369_10000181
606 Ga0075366_10000001
607 Ga0075366_10000138
608 Ga0075366_10001109
609 Ga0075366_10001938
610 Ga0075366_10002568
611 Ga0075366_10239071
612 Ga0075366_10246603
613 Ga0097621_100000001
614 Ga0097621_100043685
615 Ga0075370_10000462
616 Ga0075370_10006270
617 Ga0075370_10052787
618 Ga0075370_10187760
619 Ga0068871_100000002
620 Ga0068871_100000232
621 Ga0075428_100001999
622 Ga0068865_100000307
623 Ga0105240_10000003
624 Ga0105240_10000004
625 Ga0105240_10000050
626 Ga0105240_10001357
627 Ga0105240_10032247
628 Ga0105240_10233925
629 Ga0111539_10001451
630 Ga0105245_10000001
631 Ga0105245_10000002
632 Ga0105245_10000200
633 Ga0105245_10006834
634 Ga0105243_10000001
635 Ga0105241_10000842
636 Ga0105241_10126007
637 Ga0105241_10169893
638 Ga0105241_10257938
639 Ga0105242_10000001
640 Ga0105242_10002087
641 Ga0105248_10830652
642 Ga0105237_10000001
643 Ga0105237_10000002
644 Ga0105237_10009293
645 Ga0105237_10114986
646 Ga0105237_10838583
647 Ga0105238_10062208
648 Ga0105238_10064247
649 Ga0105238_10072227
650 Ga0105238_10144125
651 Ga0105238_11434845
652 Ga0105249_10002504
653 Ga0105032_100001
654 Ga0105032_100018
655 Ga0105032_100148
656 Ga0105032_101686
657 Ga0105029_100904
658 Ga0105033_100258
659 Ga0105033_101513
660 Ga0105028_100019
661 Ga0105239_10001223
662 Ga0105239_10004383
663 Ga0105239_10042306
664 Ga0105246_10007613
665 Ga0105246_10168087
666 Ga0105246_10182970
667 Ga0157373_10000061
668 Ga0157373_10012323
669 Ga0157373_10064545
670 Ga0157373_10171934
671 Ga0157371_10000561
672 Ga0157371_10001961
673 Ga0157371_10037254
674 Ga0157371_10341881
675 Ga0157370_10002357
676 Ga0157370_10012318
677 Ga0157370_10035209
678 Ga0157370_10203627
679 Ga0157370_10332386
680 Ga0157369_10000029
681 Ga0157369_10000151
682 Ga0157369_10000413
683 Ga0157369_10000567
684 Ga0157369_10008576
685 Ga0157369_10013289
686 Ga0157369_10084691
687 Ga0157369_10112036
688 Ga0157369_10189191
689 Ga0157374_10000073
690 Ga0157374_10001423
691 Ga0157374_10004073
692 Ga0157374_10213119
693 Ga0157374_11338069
694 Ga0157378_10642517
695 Ga0163162_11148948
696 Ga0157372_10000002
697 Ga0157372_10000086
698 Ga0157372_10002447
699 Ga0157372_10046567
700 Ga0157372_10159836
701 Ga0157372_10305370
702 Ga0157372_10686043
703 Ga0163163_10026960
704 Ga0163163_10403719
705 Ga0157376_10000001
706 Ga0157376_10000027
707 Ga0157376_10150050
708 Ga0207688_10150178
709 Ga0207647_10001245
710 Ga0207647_10067177
711 Ga0207645_10010575
712 Ga0207705_10000047
713 Ga0207705_10000115
714 Ga0207705_10190644
715 Ga0207705_10198114
716 Ga0207705_10331988
717 Ga0207654_10012883
718 Ga0207654_10144880
719 Ga0207654_10173641
720 Ga0207695_10000009
721 Ga0207695_10000158
722 Ga0207695_10012231
723 Ga0207695_10396347
724 Ga0207671_10000003
725 Ga0207671_10000008
726 Ga0207671_10080255
727 Ga0207660_10085381
728 Ga0207657_10000712
729 Ga0207657_10002562
730 Ga0207657_10004361
731 Ga0207657_10044405
732 Ga0207657_10052585
733 Ga0207657_10061138
734 Ga0207649_10004926
735 Ga0207652_10019802
736 Ga0207652_10028902
737 Ga0207652_10542797
738 Ga0207694_10096061
739 Ga0207694_10157135
740 Ga0207694_10341208
741 Ga0207687_10000001
742 Ga0207687_10000004
743 Ga0207690_10000527
744 Ga0207690_10002652
745 Ga0207706_10000073
746 Ga0207706_10840946
747 Ga0207686_10017794
748 Ga0207669_10006666
749 Ga0207704_10001468
750 Ga0207661_10000077
751 Ga0207661_10002445
752 Ga0207679_10000124
753 Ga0207667_10000005
754 Ga0207667_10000060
755 Ga0207667_10000756
756 Ga0207667_10038991
757 Ga0207667_10123290
758 Ga0207651_10000141
759 Ga0207712_10003874
760 Ga0207640_10110274
761 Ga0207658_10009982
762 Ga0207658_10016737
763 Ga0207703_10114112
764 Ga0207702_10000001
765 Ga0207702_10000015
766 Ga0207702_10000034
767 Ga0207702_10000057
768 Ga0207702_10211055
769 Ga0207702_10746796
770 Ga0207648_10026260
771 Ga0207674_10000001
772 Ga0207674_10000878
773 Ga0207674_10020195
774 Ga0207674_10025636
775 Ga0207674_10257702
776 Ga0207674_10341468
777 Ga0207674_10566842
778 Ga0207683_10003131
779 Ga0207683_10008126
780 Ga0207698_10000001
781 Ga0207698_10000048
782 Ga0207698_10014507
783 Ga0209813_10000001
784 Ga0209813_10000335
785 Ga0207428_10038033
786 Ga0268264_10022595
787 Ga0265326_10000530
788 Ga0265326_10001685
789 Ga0265334_10000115
790 Ga0265334_10002006
791 Ga0265334_10004363
792 Ga0265336_10000424
793 Ga0265336_10000652
794 Ga0265338_10000003
795 Ga0265338_10000039
796 Ga0265338_10000482
797 Ga0265338_10000625
798 Ga0265338_10012735
799 Ga0265324_10039495
800 Ga0314311_1023813
801 Ga0314311_1061458
802 Ga0316179_1064424
803 Ga0316178_1164474
804 Ga0316180_1178386
805 Ga0316183_1069499
806 Ga0316183_1103932
807 Ga0316183_1119405
808 Ga0316183_1192095
809 Ga0316181_1138937
810 Ga0316182_1000204
811 Ga0316182_1017501
812 Ga0316182_1107000
813 Ga0316182_1258468
814 Ga0265325_10034156
815 Ga0265327_10000017
816 Ga0307509_10019515
817 Ga0265313_10035909
818 Ga0265313_10146440
819 Ga0307516_10000078
820 Ga0307516_10008182
821 Ga0307406_10000001
822 Ga0307406_10000610
823 Ga0373959_0000052
824 Ga0395899_0003792
825 Ga0395899_0074289
826 Ga0395899_0147813
827 Ga0395900_0000001
828 Ga0395900_0208489
829 Ga0395900_0252072
830 Ga0395900_0464753
831 Ga0395900_0610166
832 Ga0395898_0000002
833 Ga0395898_0015984
834 Ga0395898_0038110
835 Ga0395905_0002429
836 Ga0395901_0000006
837 Ga0395901_0006327
838 Ga0395901_0010187
839 Ga0395901_0036009
840 Ga0439438_017103
841 Ga0439461_0005440
842 Ga0451853_0989547
843 Ga0439431_0036841
844 Ga0439442_014942
845 Ga0439445_0001581
846 Ga0439432_041379
847 Ga0439463_003406
848 Ga0450920_002665
849 Ga0450906_002227
850 Ga0439446_0000001
851 Ga0439446_0000974
852 Ga0450909_001464
853 Ga0439434_0017929
854 Ga0439464_0001074
855 Ga0450918_005396
856 Ga0466972_0069662
857 Ga0466965_0000206
858 Ga0466963_0120632
859 Ga0453684_0264865
860 Ga0453684_0463256
861 Ga0451576_0034967
862 Ga0466958_0267103
863 Ga0495638_0000551
864 Ga0495583_0003976
865 Ga0495583_0088037
866 Ga0495588_0000171
867 Ga0495671_0103574
868 Ga0495660_0000005
869 Ga0495672_0021011
870 Ga0496100_0184354
871 Ga0496100_0225338
872 Ga0496105_0387534
873 Ga0496112_0025793
874 Ga0496113_0289238
875 Ga0496115_0000405
876 Ga0496124_0126158
877 Ga0496126_0031280
878 Ga0501031_0002442
879 Ga0501032_0000624
880 Ga0501034_0013740
881 Ga0501034_0037263
882 Ga0501034_0043701
883 Ga0501036_0001666
884 Ga0501037_0000001
885 Ga0501037_0000031
886 Ga0501038_0080347
887 Ga0501040_0103327
888 Ga0501042_0052896
889 Ga0501043_0000366
890 Ga0501046_0000138
891 Ga0501047_0000032
892 Ga0501047_0000310
893 Ga0501048_0000013
894 Ga0501069_0220897
895 Ga0501070_0120791
896 Ga0501073_0054298
897 Ga0501083_0037527
898 Ga0501035_0000033
899 Ga0501035_0000799
900 Ga0501044_0085458
901 Ga0501045_0209784
902 nmdc:mga03683_191874_c1
903 nmdc:mga03683_22837_c1
904 nmdc:mga03683_80_c1
905 nmdc:mga03n38_142_c1
906 nmdc:mga03n38_83781_c1
907 nmdc:mga00v17_10757_c1
908 nmdc:mga00v17_120_c1
909 nmdc:mga00v17_1693_c1
910 nmdc:mga00v17_182905_c1
911 nmdc:mga00v17_2126_c1
912 nmdc:mga00v17_221460_c1
913 nmdc:mga00v17_27256_c1
914 nmdc:mga00v17_401052_c1
915 nmdc:mga0yw44_100729_c1
916 nmdc:mga0yw44_14057_c1
917 nmdc:mga0yw44_16_c1
918 nmdc:mga0yw44_185144_c1
919 nmdc:mga0yw44_1_c1
920 nmdc:mga0yw44_248569_c1
921 nmdc:mga0yw44_25522_c1
922 nmdc:mga0yw44_2_c1
923 nmdc:mga0yw44_38391_c1
924 nmdc:mga0yw44_3_c1
925 nmdc:mga0yw44_4_c1
926 nmdc:mga0k408_13_c1
927 nmdc:mga0k408_214_c1
928 nmdc:mga0k408_2723_c1
929 nmdc:mga0k408_2889_c1
930 nmdc:mga0k408_3696_c1
931 nmdc:mga0k408_6247_c1
932 nmdc:mga06z11_127_c1
933 nmdc:mga06z11_15_c1
934 nmdc:mga06z11_198_c1
935 nmdc:mga04h51_1_c1
936 nmdc:mga04h51_251_c1
937 nmdc:mga04h51_9766_c1
938 nmdc:mga07m45_104556_c1
939 nmdc:mga07m45_20643_c1
940 nmdc:mga07m45_37131_c1
941 nmdc:mga07m45_5621_c1
942 nmdc:mga08y16_5295_c1
943 nmdc:mga0sz30_1_c1
944 nmdc:mga0sz30_48939_c1
945 Ga0500610_0000006
946 Ga0500610_0051502
947 Ga0500643_000043
948 Ga0500643_006482
949 Ga0500643_013335
950 Ga0500644_0000471
951 Ga0500644_0000594
952 Ga0500644_0008359
953 Ga0500644_0023408
954 Ga0500644_0029433
955 Ga0500646_0000007
956 Ga0500646_0000490
957 Ga0500583_0000082
958 Ga0500583_0006482
959 Ga0500651_0000001
960 Ga0500651_0000447
961 Ga0500651_0002954
962 Ga0500651_0042370
963 Ga0500651_0057950
964 Ga0500641_0000001
965 Ga0500650_0000001
966 Ga0500650_0034484
967 Ga0500555_000001
968 Ga0500555_000002
969 Ga0500555_000009
970 Ga0500556_0012414
971 Ga0500562_000002
972 Ga0500562_004711
973 Ga0500569_000018
974 Ga0500593_017808
975 Ga0500594_0000001
976 Ga0500594_0000018
977 Ga0500614_000001
978 Ga0500614_000921
979 Ga0500628_000028
980 Ga0500642_0003187
981 Ga0500652_000001
982 Ga0500652_000022
983 Ga0500655_001382
984 Ga0500577_0000124
985 Ga0500577_0000996
986 Ga0500577_0001222
987 Ga0500577_0006182
988 Ga0500577_0018811
989 Ga0500577_0029402
990 Ga0500577_0030703
991 Ga0500579_000781
992 Ga0500588_0000557
993 Ga0500589_000013
994 Ga0500603_160325
995 Ga0500604_0002568
996 Ga0500616_0000012
997 Ga0500620_030693
998 Ga0500649_000004
999 Ga0500570_002919
1000 Ga0500570_112686
1001 Ga0500611_020486
1002 Ga0500613_004749
1003 Ga0501084_0311515
1004 Ga0501082_0510640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

23

218

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8byh-assembly1.cif.gz_A crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9258 1 201
8byh-assembly1.cif.gz_B crystal structure of trmd domain from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9227 1 201
8b1n-assembly1.cif.gz_B crystal structure of trmd-tm1570 from calditerrivibrio nitroreducens in complex with s-adenosyl-l-methionine 0.9213 1 197
8apt-assembly1.cif.gz_A crystal structure of h. influenzae trmd in complex with compound 13 0.9202 1 201
6jki-assembly1.cif.gz_B crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa 0.9196 1 197
ID Description Score Start End Superfamily
3knuD02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9824 167 199 1.10.1270.20
3knuB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9816 167 199 1.10.1270.20
5zhjA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9646 166 199 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9482 165 201 1.10.1270.20
3ky7A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9479 164 199 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A7C3K4Y8-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9825 2 138 GO:0002939
GO:0005829
GO:0052906
AF-A0A563CP47-F1-model_v4 deleted 0.977 1 154
AF-A0A661TIM6-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9715 1 149 GO:0002939
GO:0005829
GO:0052906
AF-A0A7V1U7T3-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9566 2 146 GO:0002939
GO:0005829
GO:0052906
AF-A0A661I5S3-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9554 3 149 GO:0002939
GO:0005829
GO:0052906

Map