F456071

General Info

Members Datasets Scaffolds Average Seq Length
503 210 1006 246

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0041293|Ga0495643_0041293_1044_1793
Length 237
Sequence MFRKCLAEFIGTFWLVLGGCGSAVLAATFPDVGIGLAGVSLAFGLTVLTAAYSLGPISGGHFNPAVTVGLWAGGRFPARQIGPYIVVQVAGAIVAAAVLYAIASGKPGFDAAAGGFATLASALLTELVMTFMFVLVILGATHTRAPVGFAGLAIGLALTLIHLVSIPVTNTSVNPARSTGPALFAGAWALQQLWLFWLAPLVGGALAGVLHRTMLEHDVTKPAIEGQPDGVLQPAHR

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
87 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
88 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
89 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 2643221556 Massilia sp. Root1485 Isolate Unclassified
208 2643221684 Massilia sp. Root133 Isolate Unclassified
209 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
210 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.2
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 4.37
Rhizosphere 92.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0041293 3300046522 Bacteria 2515
2 Ga0007409J51694_1014877 3300003575 Bacteria 964
3 Ga0065165_1000286 3300005262 Bacteria 85993
4 Ga0070677_10033936 3300005333 Bacteria 1968
5 Ga0070680_100043549 3300005336 Bacteria 3646
6 Ga0068868_100317360 3300005338 Bacteria 1327
7 Ga0070660_100085399 3300005339 Bacteria 2482
8 Ga0070660_100321901 3300005339 Bacteria 1270
9 Ga0070661_100008038 3300005344 Bacteria 7283
10 Ga0070661_100024527 3300005344 Bacteria 4325
11 Ga0070674_100748231 3300005356 Bacteria 840
12 Ga0070673_100175901 3300005364 Bacteria 1829
13 Ga0070659_100012614 3300005366 Bacteria 6267
14 Ga0070659_100054667 3300005366 Bacteria 3145
15 Ga0070659_100192136 3300005366 Bacteria 1678
16 Ga0070663_100391772 3300005455 Bacteria 1134
17 Ga0070662_100115640 3300005457 Bacteria 2049
18 Ga0070681_10020138 3300005458 Bacteria 6687
19 Ga0070706_100469656 3300005467 Bacteria 1170
20 Ga0070699_100203558 3300005518 Bacteria 1761
21 Ga0070679_100047579 3300005530 Bacteria 4274
22 Ga0070679_100075091 3300005530 Bacteria 3371
23 Ga0070697_100031861 3300005536 Bacteria 4242
24 Ga0070665_100000038 3300005548 Bacteria 309230
25 Ga0068855_100028919 3300005563 Bacteria 6631
26 Ga0068855_100070433 3300005563 Bacteria 4068
27 Ga0068855_100386484 3300005563 Bacteria 1536
28 Ga0070664_100019536 3300005564 Bacteria 5574
29 Ga0068857_100123883 3300005577 Bacteria 2328
30 Ga0068857_100381484 3300005577 Bacteria 1309
31 Ga0068854_100354663 3300005578 Bacteria 1202
32 Ga0068852_100195664 3300005616 Bacteria 1910
33 Ga0068852_100206876 3300005616 Bacteria 1860
34 Ga0068866_10079670 3300005718 Bacteria 1755
35 Ga0068861_100119557 3300005719 Bacteria 2123
36 Ga0068863_100235608 3300005841 Bacteria 1766
37 Ga0068863_101042387 3300005841 Bacteria 821
38 Ga0068860_100712557 3300005843 Bacteria 1014
39 Ga0075364_10002305 3300006051 Bacteria 10698
40 Ga0097621_100026285 3300006237 Bacteria 4564
41 Ga0068871_100154506 3300006358 Bacteria 1958
42 Ga0075428_100299315 3300006844 Bacteria 1729
43 Ga0075431_100084430 3300006847 Bacteria 3278
44 Ga0075431_100181001 3300006847 Bacteria 2163
45 Ga0075433_10270088 3300006852 Bacteria 1507
46 Ga0075429_100100808 3300006880 Bacteria 2521
47 Ga0099795_10052670 3300007788 Bacteria 1487
48 Ga0105244_10056104 3300009036 Bacteria 1995
49 Ga0105240_10008454 3300009093 Bacteria 14724
50 Ga0105248_10106109 3300009177 Bacteria 3167
51 Ga0105237_10102204 3300009545 Bacteria 2858
52 Ga0105238_10423071 3300009551 Bacteria 1327
53 Ga0157374_10018708 3300013296 Bacteria 6120
54 Ga0157375_10074423 3300013308 Bacteria 3418
55 Ga0157380_10098690 3300014326 Bacteria 2427
56 Ga0163161_10021320 3300017792 Bacteria 4555
57 Ga0213872_10072570 3300021361 Bacteria 1551
58 Ga0209148_1000930 3300025254 Bacteria 19265
59 Ga0207682_10015104 3300025893 Bacteria 3007
60 Ga0207642_10035120 3300025899 Bacteria 2138
61 Ga0207645_10020891 3300025907 Bacteria 4277
62 Ga0207705_10039654 3300025909 Bacteria 3376
63 Ga0207707_10114736 3300025912 Bacteria 2354
64 Ga0207657_10013265 3300025919 Bacteria 8085
65 Ga0207652_10028076 3300025921 Bacteria 4693
66 Ga0207652_10507773 3300025921 Bacteria 1085
67 Ga0207694_10311010 3300025924 Bacteria 1299
68 Ga0207659_10583418 3300025926 Bacteria 952
69 Ga0207690_10014014 3300025932 Bacteria 4832
70 Ga0207690_10649783 3300025932 Bacteria 864
71 Ga0207706_10125937 3300025933 Bacteria 2253
72 Ga0207704_10051330 3300025938 Bacteria 2493
73 Ga0207704_10450803 3300025938 Bacteria 1027
74 Ga0207691_10038318 3300025940 Bacteria 4436
75 Ga0207689_10023854 3300025942 Bacteria 5132
76 Ga0207679_10022040 3300025945 Bacteria 4331
77 Ga0207667_10048358 3300025949 Bacteria 4497
78 Ga0207703_10153670 3300026035 Bacteria 2009
79 Ga0207678_10332397 3300026067 Bacteria 1308
80 Ga0207702_10253110 3300026078 Bacteria 1655
81 Ga0207698_10373745 3300026142 Bacteria 1354
82 Ga0209179_1038266 3300027512 Bacteria 1004
83 Ga0268266_10000634 3300028379 Bacteria 47779
84 Ga0265332_10005514 3300031238 Bacteria 5831
85 Ga0265339_10000280 3300031249 Bacteria 41086
86 Ga0265331_10010454 3300031250 Bacteria 5134
87 Ga0265331_10183669 3300031250 Bacteria 944
88 Ga0265314_10005871 3300031711 Bacteria 10989
89 Ga0265342_10034426 3300031712 Bacteria 3107
90 Ga0307413_10133851 3300031824 Bacteria 1701
91 Ga0307410_10298508 3300031852 Bacteria 1270
92 Ga0307409_100062428 3300031995 Bacteria 2917
93 Ga0373955_0119200 3300035172 Bacteria 1533
94 Ga0373925_0061109 3300037068 Bacteria 2829
95 Ga0373925_0600506 3300037068 Bacteria 906
96 Ga0395899_0000139 3300037312 Bacteria 110692
97 Ga0395899_0006007 3300037312 Bacteria 9425
98 Ga0395899_0094023 3300037312 Bacteria 2169
99 Ga0395899_0410334 3300037312 Bacteria 894
100 Ga0395900_0245724 3300037418 Bacteria 1793
101 Ga0395898_0027743 3300037466 Bacteria 5678
102 Ga0395898_0271522 3300037466 Bacteria 1617
103 Ga0395905_0041359 3300037471 Bacteria 4325
104 Ga0395905_0088159 3300037471 Bacteria 2909
105 Ga0395905_0133259 3300037471 Bacteria 2337
106 Ga0395905_0677471 3300037471 Bacteria 933
107 Ga0395901_0006677 3300038443 Bacteria 11664
108 Ga0395901_0111283 3300038443 Bacteria 2876
109 Ga0395901_0147479 3300038443 Bacteria 2472
110 Ga0395901_0273200 3300038443 Bacteria 1757
111 Ga0436361_0934543 3300039447 Bacteria 2827
112 Ga0439450_066884 3300042008 Bacteria 876
113 Ga0439455_0045419 3300042012 Bacteria 1135
114 Ga0450904_000055 3300042139 Bacteria 25247
115 Ga0439458_0020705 3300042157 Bacteria 1519
116 Ga0466969_0027876 3300044656 Bacteria 2890
117 Ga0466969_0055398 3300044656 Bacteria 1940
118 Ga0466969_0163510 3300044656 Bacteria 1022
119 Ga0466972_0100014 3300044658 Bacteria 1372
120 Ga0466982_0061820 3300044672 Bacteria 2306
121 Ga0466965_0025382 3300044683 Bacteria 2868
122 Ga0466966_0001914 3300044684 Bacteria 13489
123 Ga0466966_0014154 3300044684 Bacteria 5280
124 Ga0466966_0025583 3300044684 Bacteria 3855
125 Ga0466961_0096897 3300044693 Bacteria 1860
126 Ga0466963_0050448 3300044694 Bacteria 2754
127 Ga0466970_0107852 3300044765 Bacteria 1520
128 Ga0466957_0030026 3300044842 Bacteria 3244
129 Ga0466957_0140474 3300044842 Bacteria 1555
130 Ga0466957_0309107 3300044842 Bacteria 1064
131 Ga0466959_0178288 3300045049 Bacteria 1487
132 Ga0466959_0223099 3300045049 Bacteria 1306
133 Ga0466967_0279494 3300045976 Bacteria 1601
134 Ga0466967_1148746 3300045976 Bacteria 774
135 Ga0495617_000002 3300046452 Bacteria 710121
136 Ga0495627_000207 3300046453 Bacteria 63763
137 Ga0495627_023575 3300046453 Bacteria 2014
138 Ga0495627_030970 3300046453 Bacteria 1693
139 Ga0495603_0109716 3300046455 Bacteria 1610
140 Ga0495590_0004449 3300046457 Bacteria 5653
141 Ga0495590_0032988 3300046457 Bacteria 1810
142 Ga0495638_0151767 3300046460 Bacteria 1343
143 Ga0495653_0008877 3300046463 Bacteria 8223
144 Ga0495653_0102968 3300046463 Bacteria 2065
145 Ga0495650_0000085 3300046471 Bacteria 235655
146 Ga0495650_0032523 3300046471 Bacteria 2331
147 Ga0495650_0034818 3300046471 Bacteria 2223
148 Ga0495580_0042615 3300046472 Bacteria 3232
149 Ga0495582_0002194 3300046473 Bacteria 10926
150 Ga0495582_0033801 3300046473 Bacteria 2812
151 Ga0495605_0000293 3300046474 Bacteria 55067
152 Ga0495605_0004396 3300046474 Bacteria 8294
153 Ga0495605_0004494 3300046474 Bacteria 8172
154 Ga0495605_0011250 3300046474 Bacteria 4996
155 Ga0495605_0012549 3300046474 Bacteria 4695
156 Ga0495605_0094338 3300046474 Bacteria 1382
157 Ga0495639_0201731 3300046475 Bacteria 974
158 Ga0495584_0001632 3300046491 Bacteria 13184
159 Ga0495584_0002152 3300046491 Bacteria 11248
160 Ga0495584_0005819 3300046491 Bacteria 6497
161 Ga0495584_0006531 3300046491 Bacteria 6095
162 Ga0495584_0011040 3300046491 Bacteria 4631
163 Ga0495584_0013803 3300046491 Bacteria 4118
164 Ga0495584_0016821 3300046491 Bacteria 3728
165 Ga0495584_0017335 3300046491 Bacteria 3667
166 Ga0495584_0039629 3300046491 Bacteria 2380
167 Ga0495585_0000060 3300046492 Bacteria 110761
168 Ga0495585_0001538 3300046492 Bacteria 17918
169 Ga0495585_0009014 3300046492 Bacteria 6013
170 Ga0495585_0009266 3300046492 Bacteria 5915
171 Ga0495585_0029165 3300046492 Bacteria 3142
172 Ga0495585_0029211 3300046492 Bacteria 3139
173 Ga0495585_0041145 3300046492 Bacteria 2592
174 Ga0495585_0089359 3300046492 Bacteria 1660
175 Ga0495585_0152996 3300046492 Bacteria 1202
176 Ga0495585_0157423 3300046492 Bacteria 1180
177 Ga0495585_0173169 3300046492 Bacteria 1113
178 Ga0495594_0012200 3300046499 Bacteria 4474
179 Ga0495594_0018877 3300046499 Bacteria 3658
180 Ga0495594_0045882 3300046499 Bacteria 2399
181 Ga0495596_0001513 3300046500 Bacteria 13278
182 Ga0495596_0002222 3300046500 Bacteria 10576
183 Ga0495596_0002396 3300046500 Bacteria 10136
184 Ga0495596_0006959 3300046500 Bacteria 5147
185 Ga0495596_0009020 3300046500 Bacteria 4409
186 Ga0495596_0010389 3300046500 Bacteria 4055
187 Ga0495596_0024951 3300046500 Bacteria 2418
188 Ga0495596_0027404 3300046500 Bacteria 2291
189 Ga0495596_0041440 3300046500 Bacteria 1815
190 Ga0495607_0002697 3300046501 Bacteria 14167
191 Ga0495607_0003269 3300046501 Bacteria 12466
192 Ga0495607_0007843 3300046501 Bacteria 7347
193 Ga0495607_0007885 3300046501 Bacteria 7324
194 Ga0495607_0032114 3300046501 Bacteria 3208
195 Ga0495607_0047630 3300046501 Bacteria 2510
196 Ga0495583_0000372 3300046506 Bacteria 69750
197 Ga0495583_0011561 3300046506 Bacteria 5061
198 Ga0495583_0012943 3300046506 Bacteria 4687
199 Ga0495583_0025477 3300046506 Bacteria 2954
200 Ga0495583_0032191 3300046506 Bacteria 2532
201 Ga0495606_0025258 3300046507 Bacteria 4258
202 Ga0495606_0044723 3300046507 Bacteria 2942
203 Ga0495606_0076091 3300046507 Bacteria 2099
204 Ga0495606_0105016 3300046507 Bacteria 1713
205 Ga0495606_0259642 3300046507 Bacteria 959
206 Ga0495610_0147691 3300046512 Bacteria 1006
207 Ga0495616_0000207 3300046513 Bacteria 48768
208 Ga0495616_0003852 3300046513 Bacteria 9560
209 Ga0495616_0005637 3300046513 Bacteria 7664
210 Ga0495616_0005696 3300046513 Bacteria 7632
211 Ga0495616_0008377 3300046513 Bacteria 6131
212 Ga0495616_0009720 3300046513 Bacteria 5606
213 Ga0495616_0019146 3300046513 Bacteria 3740
214 Ga0495616_0022457 3300046513 Bacteria 3407
215 Ga0495616_0069619 3300046513 Bacteria 1705
216 Ga0495616_0094902 3300046513 Bacteria 1406
217 Ga0495620_0063031 3300046515 Bacteria 1538
218 Ga0495630_0008344 3300046517 Bacteria 7437
219 Ga0495631_0000951 3300046518 Bacteria 18026
220 Ga0495631_0003812 3300046518 Bacteria 8185
221 Ga0495631_0004785 3300046518 Bacteria 7139
222 Ga0495631_0004884 3300046518 Bacteria 7057
223 Ga0495631_0005985 3300046518 Bacteria 6328
224 Ga0495631_0006303 3300046518 Bacteria 6138
225 Ga0495631_0009757 3300046518 Bacteria 4781
226 Ga0495631_0033631 3300046518 Bacteria 2301
227 Ga0495631_0034697 3300046518 Bacteria 2260
228 Ga0495631_0078972 3300046518 Bacteria 1420
229 Ga0495632_0000077 3300046519 Bacteria 100834
230 Ga0495632_0000129 3300046519 Bacteria 77134
231 Ga0495632_0000296 3300046519 Bacteria 48157
232 Ga0495632_0003812 3300046519 Bacteria 10501
233 Ga0495632_0009110 3300046519 Bacteria 6005
234 Ga0495632_0011355 3300046519 Bacteria 5200
235 Ga0495632_0259765 3300046519 Bacteria 777
236 Ga0495637_0061688 3300046520 Bacteria 1536
237 Ga0495643_0002628 3300046522 Bacteria 13941
238 Ga0495643_0003068 3300046522 Bacteria 12557
239 Ga0495643_0040128 3300046522 Bacteria 2557
240 Ga0495644_0014515 3300046523 Bacteria 3017
241 Ga0495644_0042698 3300046523 Bacteria 1707
242 Ga0495644_0064497 3300046523 Bacteria 1376
243 Ga0495644_0095264 3300046523 Bacteria 1124
244 Ga0495644_0171740 3300046523 Bacteria 832
245 Ga0495648_0001105 3300046524 Bacteria 27423
246 Ga0495648_0003935 3300046524 Bacteria 12861
247 Ga0495648_0008300 3300046524 Bacteria 8189
248 Ga0495648_0033459 3300046524 Bacteria 3355
249 Ga0495648_0034610 3300046524 Bacteria 3285
250 Ga0495663_0002406 3300046525 Bacteria 5626
251 Ga0495666_0007927 3300046526 Bacteria 5320
252 Ga0495666_0019121 3300046526 Bacteria 3402
253 Ga0495642_0000085 3300046528 Bacteria 54372
254 Ga0495642_0000285 3300046528 Bacteria 28471
255 Ga0495642_0000313 3300046528 Bacteria 26929
256 Ga0495642_0007287 3300046528 Bacteria 4246
257 Ga0495642_0015858 3300046528 Bacteria 2933
258 Ga0495642_0022739 3300046528 Bacteria 2471
259 Ga0495642_0029469 3300046528 Bacteria 2191
260 Ga0495642_0034918 3300046528 Bacteria 2027
261 Ga0495642_0047518 3300046528 Bacteria 1758
262 Ga0495642_0076694 3300046528 Bacteria 1403
263 Ga0495654_0005307 3300046530 Bacteria 7512
264 Ga0495654_0016451 3300046530 Bacteria 3910
265 Ga0495654_0075175 3300046530 Bacteria 1594
266 Ga0495665_0003034 3300046531 Bacteria 9073
267 Ga0495665_0007366 3300046531 Bacteria 5949
268 Ga0495665_0016646 3300046531 Bacteria 3961
269 Ga0495640_0030579 3300046533 Bacteria 3854
270 Ga0495586_0001694 3300046535 Bacteria 12072
271 Ga0495586_0021248 3300046535 Bacteria 3457
272 Ga0495587_0026119 3300046536 Bacteria 3562
273 Ga0495609_0000002 3300046538 Bacteria 739816
274 Ga0495609_0000298 3300046538 Bacteria 45867
275 Ga0495609_0000886 3300046538 Bacteria 21874
276 Ga0495609_0010916 3300046538 Bacteria 4340
277 Ga0495609_0012909 3300046538 Bacteria 3954
278 Ga0495609_0017434 3300046538 Bacteria 3334
279 Ga0495609_0021406 3300046538 Bacteria 2983
280 Ga0495609_0023815 3300046538 Bacteria 2811
281 Ga0495609_0034920 3300046538 Bacteria 2277
282 Ga0495597_0000226 3300046542 Bacteria 51108
283 Ga0495597_0000812 3300046542 Bacteria 24678
284 Ga0495597_0000995 3300046542 Bacteria 21765
285 Ga0495597_0003907 3300046542 Bacteria 8415
286 Ga0495597_0010562 3300046542 Bacteria 4505
287 Ga0495597_0012539 3300046542 Bacteria 4088
288 Ga0495597_0030728 3300046542 Bacteria 2446
289 Ga0495597_0100323 3300046542 Bacteria 1221
290 Ga0495645_0035511 3300046543 Bacteria 3634
291 Ga0495645_0247677 3300046543 Bacteria 1186
292 Ga0495622_0006961 3300046557 Bacteria 5248
293 Ga0495622_0060554 3300046557 Bacteria 1753
294 Ga0495633_0001851 3300046558 Bacteria 15535
295 Ga0495633_0015416 3300046558 Bacteria 3965
296 Ga0495633_0018337 3300046558 Bacteria 3556
297 Ga0495633_0039291 3300046558 Bacteria 2258
298 Ga0495633_0131256 3300046558 Bacteria 1159
299 Ga0495656_0012532 3300046615 Bacteria 3131
300 Ga0495656_0016119 3300046615 Bacteria 2832
301 Ga0495656_0144397 3300046615 Bacteria 1144
302 Ga0495656_0199668 3300046615 Bacteria 992
303 Ga0495668_0000274 3300046616 Bacteria 72330
304 Ga0495668_0000941 3300046616 Bacteria 32463
305 Ga0495668_0001920 3300046616 Bacteria 18482
306 Ga0495668_0002973 3300046616 Bacteria 13285
307 Ga0495668_0006948 3300046616 Bacteria 7325
308 Ga0495668_0010024 3300046616 Bacteria 5768
309 Ga0495668_0011866 3300046616 Bacteria 5193
310 Ga0495668_0012332 3300046616 Bacteria 5070
311 Ga0495668_0025787 3300046616 Bacteria 3338
312 Ga0495668_0038328 3300046616 Bacteria 2678
313 Ga0495668_0042272 3300046616 Bacteria 2537
314 Ga0495668_0079078 3300046616 Bacteria 1805
315 Ga0495634_0007884 3300046642 Bacteria 7949
316 Ga0495611_0000773 3300046648 Bacteria 17861
317 Ga0495611_0005097 3300046648 Bacteria 5631
318 Ga0495611_0024293 3300046648 Bacteria 2636
319 Ga0495611_0029099 3300046648 Bacteria 2421
320 Ga0495611_0118072 3300046648 Bacteria 1236
321 Ga0495611_0163411 3300046648 Bacteria 1040
322 Ga0495611_0201734 3300046648 Bacteria 927
323 Ga0495625_0012809 3300046660 Bacteria 6780
324 Ga0495625_0020366 3300046660 Bacteria 5122
325 Ga0495625_0086872 3300046660 Bacteria 2169
326 Ga0495635_0006164 3300046663 Bacteria 8359
327 Ga0495635_0086722 3300046663 Bacteria 2142
328 Ga0495659_0110303 3300046664 Bacteria 1074
329 Ga0495661_0001749 3300046665 Bacteria 17475
330 Ga0495661_0003878 3300046665 Bacteria 10932
331 Ga0495661_0004982 3300046665 Bacteria 9483
332 Ga0495661_0005057 3300046665 Bacteria 9413
333 Ga0495661_0005993 3300046665 Bacteria 8581
334 Ga0495661_0020928 3300046665 Bacteria 4266
335 Ga0495661_0025026 3300046665 Bacteria 3861
336 Ga0495661_0045361 3300046665 Bacteria 2689
337 Ga0495661_0052283 3300046665 Bacteria 2462
338 Ga0495661_0089564 3300046665 Bacteria 1753
339 Ga0495661_0097418 3300046665 Bacteria 1661
340 Ga0495661_0098738 3300046665 Bacteria 1647
341 Ga0495588_0000177 3300046674 Bacteria 78598
342 Ga0495588_0015555 3300046674 Bacteria 3664
343 Ga0495588_0034967 3300046674 Bacteria 2544
344 Ga0495588_0037318 3300046674 Bacteria 2468
345 Ga0495588_0126376 3300046674 Bacteria 1348
346 Ga0495623_0007137 3300046679 Bacteria 7253
347 Ga0495623_0008273 3300046679 Bacteria 6766
348 Ga0495646_0167944 3300046680 Bacteria 1211
349 Ga0495669_0000092 3300046684 Bacteria 59765
350 Ga0495669_0001619 3300046684 Bacteria 9246
351 Ga0495669_0004755 3300046684 Bacteria 5630
352 Ga0495669_0032550 3300046684 Bacteria 2292
353 Ga0495669_0194166 3300046684 Bacteria 969
354 Ga0495670_0000623 3300046691 Bacteria 16953
355 Ga0495670_0012324 3300046691 Bacteria 4203
356 Ga0495670_0012951 3300046691 Bacteria 4100
357 Ga0495670_0020078 3300046691 Bacteria 3293
358 Ga0495670_0031241 3300046691 Bacteria 2646
359 Ga0495671_0000965 3300046692 Bacteria 20129
360 Ga0495671_0015306 3300046692 Bacteria 4113
361 Ga0495671_0020859 3300046692 Bacteria 3449
362 Ga0495671_0128194 3300046692 Bacteria 1237
363 Ga0495649_0000277 3300046694 Bacteria 45216
364 Ga0495649_0001292 3300046694 Bacteria 19128
365 Ga0495649_0009432 3300046694 Bacteria 5803
366 Ga0495649_0014753 3300046694 Bacteria 4467
367 Ga0495649_0114376 3300046694 Bacteria 1429
368 Ga0495589_0000535 3300046794 Bacteria 26576
369 Ga0495589_0000972 3300046794 Bacteria 17487
370 Ga0495589_0004770 3300046794 Bacteria 7205
371 Ga0495589_0014376 3300046794 Bacteria 4077
372 Ga0495589_0027168 3300046794 Bacteria 2894
373 Ga0495589_0059785 3300046794 Bacteria 1872
374 Ga0495589_0088804 3300046794 Bacteria 1501
375 Ga0495589_0152693 3300046794 Bacteria 1102
376 Ga0495600_0248601 3300046809 Bacteria 1132
377 Ga0495660_0002353 3300046810 Bacteria 12081
378 Ga0495660_0006875 3300046810 Bacteria 6700
379 Ga0495660_0010411 3300046810 Bacteria 5410
380 Ga0495660_0024709 3300046810 Bacteria 3421
381 Ga0495660_0066190 3300046810 Bacteria 1927
382 Ga0495660_0071706 3300046810 Bacteria 1836
383 Ga0495660_0181716 3300046810 Bacteria 1017
384 Ga0495581_0026115 3300047315 Bacteria 3388
385 Ga0495604_0033921 3300047317 Bacteria 4038
386 Ga0495604_0098875 3300047317 Bacteria 2148
387 Ga0495636_0000616 3300047318 Bacteria 13093
388 Ga0495636_0094186 3300047318 Bacteria 1303
389 Ga0495636_0124490 3300047318 Bacteria 1143
390 Ga0495674_0023732 3300047319 Bacteria 5647
391 Ga0495672_0000188 3300047320 Bacteria 89538
392 Ga0495672_0004356 3300047320 Bacteria 11634
393 Ga0495676_0000309 3300047321 Bacteria 39532
394 Ga0495676_0052363 3300047321 Bacteria 3259
395 Ga0495680_0009206 3300047322 Bacteria 8903
396 Ga0495680_0051846 3300047322 Bacteria 3201
397 Ga0495680_0327951 3300047322 Bacteria 1070
398 Ga0495683_0015724 3300047323 Bacteria 3929
399 Ga0495683_0019638 3300047323 Bacteria 3487
400 Ga0495683_0040809 3300047323 Bacteria 2343
401 Ga0495683_0202090 3300047323 Bacteria 895
402 Ga0495687_001953 3300047443 Bacteria 17622
403 Ga0495687_002700 3300047443 Bacteria 13761
404 Ga0495687_002725 3300047443 Bacteria 13707
405 Ga0495675_0002301 3300047444 Bacteria 11408
406 Ga0495675_0024758 3300047444 Bacteria 3828
407 Ga0495675_0104474 3300047444 Bacteria 1770
408 Ga0495677_0000041 3300047445 Bacteria 75366
409 Ga0495677_0001222 3300047445 Bacteria 10290
410 Ga0495677_0001520 3300047445 Bacteria 9339
411 Ga0495677_0006703 3300047445 Bacteria 4335
412 Ga0495677_0007142 3300047445 Bacteria 4183
413 Ga0495677_0010372 3300047445 Bacteria 3423
414 Ga0495677_0011980 3300047445 Bacteria 3164
415 Ga0495677_0012199 3300047445 Bacteria 3136
416 Ga0495677_0025683 3300047445 Bacteria 2137
417 Ga0495677_0027398 3300047445 Bacteria 2068
418 Ga0495677_0058729 3300047445 Bacteria 1423
419 Ga0495679_003572 3300047446 Bacteria 7426
420 Ga0495679_014399 3300047446 Bacteria 2932
421 Ga0495679_031502 3300047446 Bacteria 1710
422 Ga0495685_002161 3300047447 Bacteria 6103
423 Ga0495685_015961 3300047447 Bacteria 2565
424 Ga0495673_0067653 3300047469 Bacteria 1511
425 Ga0495681_0000667 3300047470 Bacteria 26095
426 Ga0495681_0001579 3300047470 Bacteria 16952
427 Ga0495681_0009196 3300047470 Bacteria 6110
428 Ga0495681_0017517 3300047470 Bacteria 3974
429 Ga0495681_0037570 3300047470 Bacteria 2383
430 Ga0495681_0055112 3300047470 Bacteria 1855
431 Ga0495681_0122540 3300047470 Bacteria 1114
432 Ga0495681_0154811 3300047470 Bacteria 959
433 Ga0495686_0001109 3300047472 Bacteria 31944
434 Ga0495686_0140023 3300047472 Bacteria 1428
435 Ga0495686_0141535 3300047472 Bacteria 1419
436 Ga0495593_0003783 3300047673 Bacteria 9038
437 Ga0495593_0021037 3300047673 Bacteria 3647
438 Ga0495602_0005903 3300048088 Bacteria 12859
439 Ga0495614_0015329 3300048089 Bacteria 3340
440 Ga0495614_0023416 3300048089 Bacteria 2664
441 Ga0495614_0053457 3300048089 Bacteria 1732
442 Ga0495615_0007072 3300048090 Bacteria 2113
443 Ga0495626_0002537 3300048091 Bacteria 12549
444 Ga0495626_0012338 3300048091 Bacteria 4483
445 Ga0495626_0018995 3300048091 Bacteria 3440
446 Ga0495626_0030566 3300048091 Bacteria 2597
447 Ga0495626_0040948 3300048091 Bacteria 2185
448 Ga0495626_0050847 3300048091 Bacteria 1913
449 Ga0495626_0059189 3300048091 Bacteria 1748
450 Ga0495626_0064349 3300048091 Bacteria 1661
451 Ga0496100_0492967 3300048903 Bacteria 943
452 Ga0496101_0017410 3300048904 Bacteria 4874
453 Ga0496102_0041771 3300048905 Bacteria 4154
454 Ga0496103_0015003 3300048906 Bacteria 4606
455 Ga0496103_0084291 3300048906 Bacteria 2002
456 Ga0496104_0474381 3300048907 Bacteria 1163
457 Ga0496106_0001933 3300048909 Bacteria 15541
458 Ga0496107_0046574 3300048910 Bacteria 3121
459 Ga0496107_0292772 3300048910 Bacteria 1212
460 Ga0496109_0005892 3300048912 Bacteria 10280
461 Ga0496109_0236207 3300048912 Bacteria 1720
462 Ga0496110_0000068 3300048913 Bacteria 51803
463 Ga0496110_0029998 3300048913 Bacteria 4685
464 Ga0496110_0042754 3300048913 Bacteria 3955
465 Ga0496111_0015127 3300048914 Bacteria 5288
466 Ga0496112_0224017 3300048915 Bacteria 1836
467 Ga0496112_0813507 3300048915 Bacteria 859
468 Ga0496113_0045202 3300048916 Bacteria 3265
469 Ga0496113_0322018 3300048916 Bacteria 1239
470 Ga0496114_0328530 3300048917 Bacteria 1352
471 Ga0496114_0557236 3300048917 Bacteria 1012
472 Ga0496115_0117024 3300048918 Bacteria 2192
473 Ga0496121_0113973 3300048924 Bacteria 2056
474 Ga0496121_0159828 3300048924 Bacteria 1649
475 Ga0496122_0000445 3300048925 Bacteria 86566
476 Ga0496122_0129632 3300048925 Bacteria 1606
477 Ga0496123_0001531 3300048926 Bacteria 31933
478 Ga0496124_0008983 3300048927 Bacteria 10343
479 Ga0496124_0040017 3300048927 Bacteria 4058
480 Ga0496125_0002437 3300048928 Bacteria 24169
481 Ga0496125_0137861 3300048928 Bacteria 1702
482 Ga0496125_0272628 3300048928 Bacteria 1053
483 Ga0495678_000316 3300049459 Bacteria 51625
484 Ga0495678_002167 3300049459 Bacteria 13851
485 Ga0495678_002239 3300049459 Bacteria 13483
486 Ga0495678_003962 3300049459 Bacteria 8857
487 Ga0495678_103811 3300049459 Bacteria 981
488 Ga0495682_0000107 3300049460 Bacteria 73486
489 Ga0495682_0028359 3300049460 Bacteria 2075
490 Ga0495682_0030285 3300049460 Bacteria 2002
491 Ga0501071_0253810 3300049587 Bacteria 1328
492 nmdc:mga00v17_714_c1 3300050491 Bacteria 18152
493 nmdc:mga05p37_8611_c1 3300050507 Bacteria 12061
494 nmdc:mga05p37_910431_c1 3300050507 Bacteria 947
495 nmdc:mga06r32_12501_c1 3300050510 Bacteria 7662
496 nmdc:mga06r32_512524_c1 3300050510 Bacteria 1176
497 nmdc:mga06r32_58824_c1 3300050510 Bacteria 3694
498 nmdc:mga08y16_49573_c1 3300050511 Bacteria 4395
499 nmdc:mga0a205_238223_c1 3300050515 Bacteria 1701
500 2643798072 2643221556 Bacteria 7251154
501 2644473250 2643221684 Bacteria 7145183
502 2809143827 2808606418 Bacteria 6724496
503 8047678078 8047673197 Bacteria 7395230
504 Ga0495643_0041293
505 Ga0007409J51694_1014877
506 Ga0065165_1000286
507 Ga0070677_10033936
508 Ga0070680_100043549
509 Ga0068868_100317360
510 Ga0070660_100085399
511 Ga0070660_100321901
512 Ga0070661_100008038
513 Ga0070661_100024527
514 Ga0070674_100748231
515 Ga0070673_100175901
516 Ga0070659_100012614
517 Ga0070659_100054667
518 Ga0070659_100192136
519 Ga0070663_100391772
520 Ga0070662_100115640
521 Ga0070681_10020138
522 Ga0070706_100469656
523 Ga0070699_100203558
524 Ga0070679_100047579
525 Ga0070679_100075091
526 Ga0070697_100031861
527 Ga0070665_100000038
528 Ga0068855_100028919
529 Ga0068855_100070433
530 Ga0068855_100386484
531 Ga0070664_100019536
532 Ga0068857_100123883
533 Ga0068857_100381484
534 Ga0068854_100354663
535 Ga0068852_100195664
536 Ga0068852_100206876
537 Ga0068866_10079670
538 Ga0068861_100119557
539 Ga0068863_100235608
540 Ga0068863_101042387
541 Ga0068860_100712557
542 Ga0075364_10002305
543 Ga0097621_100026285
544 Ga0068871_100154506
545 Ga0075428_100299315
546 Ga0075431_100084430
547 Ga0075431_100181001
548 Ga0075433_10270088
549 Ga0075429_100100808
550 Ga0099795_10052670
551 Ga0105244_10056104
552 Ga0105240_10008454
553 Ga0105248_10106109
554 Ga0105237_10102204
555 Ga0105238_10423071
556 Ga0157374_10018708
557 Ga0157375_10074423
558 Ga0157380_10098690
559 Ga0163161_10021320
560 Ga0213872_10072570
561 Ga0209148_1000930
562 Ga0207682_10015104
563 Ga0207642_10035120
564 Ga0207645_10020891
565 Ga0207705_10039654
566 Ga0207707_10114736
567 Ga0207657_10013265
568 Ga0207652_10028076
569 Ga0207652_10507773
570 Ga0207694_10311010
571 Ga0207659_10583418
572 Ga0207690_10014014
573 Ga0207690_10649783
574 Ga0207706_10125937
575 Ga0207704_10051330
576 Ga0207704_10450803
577 Ga0207691_10038318
578 Ga0207689_10023854
579 Ga0207679_10022040
580 Ga0207667_10048358
581 Ga0207703_10153670
582 Ga0207678_10332397
583 Ga0207702_10253110
584 Ga0207698_10373745
585 Ga0209179_1038266
586 Ga0268266_10000634
587 Ga0265332_10005514
588 Ga0265339_10000280
589 Ga0265331_10010454
590 Ga0265331_10183669
591 Ga0265314_10005871
592 Ga0265342_10034426
593 Ga0307413_10133851
594 Ga0307410_10298508
595 Ga0307409_100062428
596 Ga0373955_0119200
597 Ga0373925_0061109
598 Ga0373925_0600506
599 Ga0395899_0000139
600 Ga0395899_0006007
601 Ga0395899_0094023
602 Ga0395899_0410334
603 Ga0395900_0245724
604 Ga0395898_0027743
605 Ga0395898_0271522
606 Ga0395905_0041359
607 Ga0395905_0088159
608 Ga0395905_0133259
609 Ga0395905_0677471
610 Ga0395901_0006677
611 Ga0395901_0111283
612 Ga0395901_0147479
613 Ga0395901_0273200
614 Ga0436361_0934543
615 Ga0439450_066884
616 Ga0439455_0045419
617 Ga0450904_000055
618 Ga0439458_0020705
619 Ga0466969_0027876
620 Ga0466969_0055398
621 Ga0466969_0163510
622 Ga0466972_0100014
623 Ga0466982_0061820
624 Ga0466965_0025382
625 Ga0466966_0001914
626 Ga0466966_0014154
627 Ga0466966_0025583
628 Ga0466961_0096897
629 Ga0466963_0050448
630 Ga0466970_0107852
631 Ga0466957_0030026
632 Ga0466957_0140474
633 Ga0466957_0309107
634 Ga0466959_0178288
635 Ga0466959_0223099
636 Ga0466967_0279494
637 Ga0466967_1148746
638 Ga0495617_000002
639 Ga0495627_000207
640 Ga0495627_023575
641 Ga0495627_030970
642 Ga0495603_0109716
643 Ga0495590_0004449
644 Ga0495590_0032988
645 Ga0495638_0151767
646 Ga0495653_0008877
647 Ga0495653_0102968
648 Ga0495650_0000085
649 Ga0495650_0032523
650 Ga0495650_0034818
651 Ga0495580_0042615
652 Ga0495582_0002194
653 Ga0495582_0033801
654 Ga0495605_0000293
655 Ga0495605_0004396
656 Ga0495605_0004494
657 Ga0495605_0011250
658 Ga0495605_0012549
659 Ga0495605_0094338
660 Ga0495639_0201731
661 Ga0495584_0001632
662 Ga0495584_0002152
663 Ga0495584_0005819
664 Ga0495584_0006531
665 Ga0495584_0011040
666 Ga0495584_0013803
667 Ga0495584_0016821
668 Ga0495584_0017335
669 Ga0495584_0039629
670 Ga0495585_0000060
671 Ga0495585_0001538
672 Ga0495585_0009014
673 Ga0495585_0009266
674 Ga0495585_0029165
675 Ga0495585_0029211
676 Ga0495585_0041145
677 Ga0495585_0089359
678 Ga0495585_0152996
679 Ga0495585_0157423
680 Ga0495585_0173169
681 Ga0495594_0012200
682 Ga0495594_0018877
683 Ga0495594_0045882
684 Ga0495596_0001513
685 Ga0495596_0002222
686 Ga0495596_0002396
687 Ga0495596_0006959
688 Ga0495596_0009020
689 Ga0495596_0010389
690 Ga0495596_0024951
691 Ga0495596_0027404
692 Ga0495596_0041440
693 Ga0495607_0002697
694 Ga0495607_0003269
695 Ga0495607_0007843
696 Ga0495607_0007885
697 Ga0495607_0032114
698 Ga0495607_0047630
699 Ga0495583_0000372
700 Ga0495583_0011561
701 Ga0495583_0012943
702 Ga0495583_0025477
703 Ga0495583_0032191
704 Ga0495606_0025258
705 Ga0495606_0044723
706 Ga0495606_0076091
707 Ga0495606_0105016
708 Ga0495606_0259642
709 Ga0495610_0147691
710 Ga0495616_0000207
711 Ga0495616_0003852
712 Ga0495616_0005637
713 Ga0495616_0005696
714 Ga0495616_0008377
715 Ga0495616_0009720
716 Ga0495616_0019146
717 Ga0495616_0022457
718 Ga0495616_0069619
719 Ga0495616_0094902
720 Ga0495620_0063031
721 Ga0495630_0008344
722 Ga0495631_0000951
723 Ga0495631_0003812
724 Ga0495631_0004785
725 Ga0495631_0004884
726 Ga0495631_0005985
727 Ga0495631_0006303
728 Ga0495631_0009757
729 Ga0495631_0033631
730 Ga0495631_0034697
731 Ga0495631_0078972
732 Ga0495632_0000077
733 Ga0495632_0000129
734 Ga0495632_0000296
735 Ga0495632_0003812
736 Ga0495632_0009110
737 Ga0495632_0011355
738 Ga0495632_0259765
739 Ga0495637_0061688
740 Ga0495643_0002628
741 Ga0495643_0003068
742 Ga0495643_0040128
743 Ga0495644_0014515
744 Ga0495644_0042698
745 Ga0495644_0064497
746 Ga0495644_0095264
747 Ga0495644_0171740
748 Ga0495648_0001105
749 Ga0495648_0003935
750 Ga0495648_0008300
751 Ga0495648_0033459
752 Ga0495648_0034610
753 Ga0495663_0002406
754 Ga0495666_0007927
755 Ga0495666_0019121
756 Ga0495642_0000085
757 Ga0495642_0000285
758 Ga0495642_0000313
759 Ga0495642_0007287
760 Ga0495642_0015858
761 Ga0495642_0022739
762 Ga0495642_0029469
763 Ga0495642_0034918
764 Ga0495642_0047518
765 Ga0495642_0076694
766 Ga0495654_0005307
767 Ga0495654_0016451
768 Ga0495654_0075175
769 Ga0495665_0003034
770 Ga0495665_0007366
771 Ga0495665_0016646
772 Ga0495640_0030579
773 Ga0495586_0001694
774 Ga0495586_0021248
775 Ga0495587_0026119
776 Ga0495609_0000002
777 Ga0495609_0000298
778 Ga0495609_0000886
779 Ga0495609_0010916
780 Ga0495609_0012909
781 Ga0495609_0017434
782 Ga0495609_0021406
783 Ga0495609_0023815
784 Ga0495609_0034920
785 Ga0495597_0000226
786 Ga0495597_0000812
787 Ga0495597_0000995
788 Ga0495597_0003907
789 Ga0495597_0010562
790 Ga0495597_0012539
791 Ga0495597_0030728
792 Ga0495597_0100323
793 Ga0495645_0035511
794 Ga0495645_0247677
795 Ga0495622_0006961
796 Ga0495622_0060554
797 Ga0495633_0001851
798 Ga0495633_0015416
799 Ga0495633_0018337
800 Ga0495633_0039291
801 Ga0495633_0131256
802 Ga0495656_0012532
803 Ga0495656_0016119
804 Ga0495656_0144397
805 Ga0495656_0199668
806 Ga0495668_0000274
807 Ga0495668_0000941
808 Ga0495668_0001920
809 Ga0495668_0002973
810 Ga0495668_0006948
811 Ga0495668_0010024
812 Ga0495668_0011866
813 Ga0495668_0012332
814 Ga0495668_0025787
815 Ga0495668_0038328
816 Ga0495668_0042272
817 Ga0495668_0079078
818 Ga0495634_0007884
819 Ga0495611_0000773
820 Ga0495611_0005097
821 Ga0495611_0024293
822 Ga0495611_0029099
823 Ga0495611_0118072
824 Ga0495611_0163411
825 Ga0495611_0201734
826 Ga0495625_0012809
827 Ga0495625_0020366
828 Ga0495625_0086872
829 Ga0495635_0006164
830 Ga0495635_0086722
831 Ga0495659_0110303
832 Ga0495661_0001749
833 Ga0495661_0003878
834 Ga0495661_0004982
835 Ga0495661_0005057
836 Ga0495661_0005993
837 Ga0495661_0020928
838 Ga0495661_0025026
839 Ga0495661_0045361
840 Ga0495661_0052283
841 Ga0495661_0089564
842 Ga0495661_0097418
843 Ga0495661_0098738
844 Ga0495588_0000177
845 Ga0495588_0015555
846 Ga0495588_0034967
847 Ga0495588_0037318
848 Ga0495588_0126376
849 Ga0495623_0007137
850 Ga0495623_0008273
851 Ga0495646_0167944
852 Ga0495669_0000092
853 Ga0495669_0001619
854 Ga0495669_0004755
855 Ga0495669_0032550
856 Ga0495669_0194166
857 Ga0495670_0000623
858 Ga0495670_0012324
859 Ga0495670_0012951
860 Ga0495670_0020078
861 Ga0495670_0031241
862 Ga0495671_0000965
863 Ga0495671_0015306
864 Ga0495671_0020859
865 Ga0495671_0128194
866 Ga0495649_0000277
867 Ga0495649_0001292
868 Ga0495649_0009432
869 Ga0495649_0014753
870 Ga0495649_0114376
871 Ga0495589_0000535
872 Ga0495589_0000972
873 Ga0495589_0004770
874 Ga0495589_0014376
875 Ga0495589_0027168
876 Ga0495589_0059785
877 Ga0495589_0088804
878 Ga0495589_0152693
879 Ga0495600_0248601
880 Ga0495660_0002353
881 Ga0495660_0006875
882 Ga0495660_0010411
883 Ga0495660_0024709
884 Ga0495660_0066190
885 Ga0495660_0071706
886 Ga0495660_0181716
887 Ga0495581_0026115
888 Ga0495604_0033921
889 Ga0495604_0098875
890 Ga0495636_0000616
891 Ga0495636_0094186
892 Ga0495636_0124490
893 Ga0495674_0023732
894 Ga0495672_0000188
895 Ga0495672_0004356
896 Ga0495676_0000309
897 Ga0495676_0052363
898 Ga0495680_0009206
899 Ga0495680_0051846
900 Ga0495680_0327951
901 Ga0495683_0015724
902 Ga0495683_0019638
903 Ga0495683_0040809
904 Ga0495683_0202090
905 Ga0495687_001953
906 Ga0495687_002700
907 Ga0495687_002725
908 Ga0495675_0002301
909 Ga0495675_0024758
910 Ga0495675_0104474
911 Ga0495677_0000041
912 Ga0495677_0001222
913 Ga0495677_0001520
914 Ga0495677_0006703
915 Ga0495677_0007142
916 Ga0495677_0010372
917 Ga0495677_0011980
918 Ga0495677_0012199
919 Ga0495677_0025683
920 Ga0495677_0027398
921 Ga0495677_0058729
922 Ga0495679_003572
923 Ga0495679_014399
924 Ga0495679_031502
925 Ga0495685_002161
926 Ga0495685_015961
927 Ga0495673_0067653
928 Ga0495681_0000667
929 Ga0495681_0001579
930 Ga0495681_0009196
931 Ga0495681_0017517
932 Ga0495681_0037570
933 Ga0495681_0055112
934 Ga0495681_0122540
935 Ga0495681_0154811
936 Ga0495686_0001109
937 Ga0495686_0140023
938 Ga0495686_0141535
939 Ga0495593_0003783
940 Ga0495593_0021037
941 Ga0495602_0005903
942 Ga0495614_0015329
943 Ga0495614_0023416
944 Ga0495614_0053457
945 Ga0495615_0007072
946 Ga0495626_0002537
947 Ga0495626_0012338
948 Ga0495626_0018995
949 Ga0495626_0030566
950 Ga0495626_0040948
951 Ga0495626_0050847
952 Ga0495626_0059189
953 Ga0495626_0064349
954 Ga0496100_0492967
955 Ga0496101_0017410
956 Ga0496102_0041771
957 Ga0496103_0015003
958 Ga0496103_0084291
959 Ga0496104_0474381
960 Ga0496106_0001933
961 Ga0496107_0046574
962 Ga0496107_0292772
963 Ga0496109_0005892
964 Ga0496109_0236207
965 Ga0496110_0000068
966 Ga0496110_0029998
967 Ga0496110_0042754
968 Ga0496111_0015127
969 Ga0496112_0224017
970 Ga0496112_0813507
971 Ga0496113_0045202
972 Ga0496113_0322018
973 Ga0496114_0328530
974 Ga0496114_0557236
975 Ga0496115_0117024
976 Ga0496121_0113973
977 Ga0496121_0159828
978 Ga0496122_0000445
979 Ga0496122_0129632
980 Ga0496123_0001531
981 Ga0496124_0008983
982 Ga0496124_0040017
983 Ga0496125_0002437
984 Ga0496125_0137861
985 Ga0496125_0272628
986 Ga0495678_000316
987 Ga0495678_002167
988 Ga0495678_002239
989 Ga0495678_003962
990 Ga0495678_103811
991 Ga0495682_0000107
992 Ga0495682_0028359
993 Ga0495682_0030285
994 Ga0501071_0253810
995 nmdc:mga00v17_714_c1
996 nmdc:mga05p37_8611_c1
997 nmdc:mga05p37_910431_c1
998 nmdc:mga06r32_12501_c1
999 nmdc:mga06r32_512524_c1
1000 nmdc:mga06r32_58824_c1
1001 nmdc:mga08y16_49573_c1
1002 nmdc:mga0a205_238223_c1
1003 2643798072
1004 2644473250
1005 2809143827
1006 8047678078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

1

211

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9841 1 228
2o9g-assembly1.cif.gz_A crystal structure of aqpz mutant l170c complexed with mercury. 0.9837 1 228
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9835 1 228
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.9829 1 228
3nka-assembly2.cif.gz_B crystal structure of aqpz h174g,t183f 0.9827 1 228
ID Description Score Start End Superfamily
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9795 1 228 1.20.1080.10
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9506 1 228 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9418 2 99 1.20.1080.10
2b5fB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9238 1 225 1.20.1080.10
af_A0A1D6PLK2_10_163_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9203 2 105 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A2J4YQS4-F1-model_v4 Aquaporin Z 0.9876 47 229 GO:0005886
GO:0015250
AF-A0A2T3J1Q4-F1-model_v4 Aquaporin Z 0.9873 1 223 GO:0005886
GO:0015250
AF-A0A2S5MA84-F1-model_v4 Aquaporin Z 0.9869 41 229 GO:0005886
GO:0015250
AF-A0A0C5WTB5-F1-model_v4 Aquaporin Z 0.9867 1 229 GO:0005886
GO:0015250
AF-A0A0D1LSR2-F1-model_v4 deleted 0.9866 1 228

Map