F456083

General Info

Members Datasets Scaffolds Average Seq Length
503 282 1006 165

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0467897|Ga0496100_0467897_363_953
Length 196
Sequence MEVRANGNGSLATGALKLVVRLGDPALSPFSEITAMRSLFPLVAICCALSTSPTRAQVAVQANPDQERLVASADPRLAANKRLVYDFWREVFEGGHMELAEKYMAESYIQHNPTVPTGRAAFVDFFSKFAKPKPIEPRIKAPLVSIVAEGDYVVLSFVREVAEPSDPAKKYTTTWFDMFRIENGKIAEHWDAAQKK

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
178 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
179 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
249 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
250 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
251 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
252 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
258 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
259 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
278 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
279 2547132374 Acidovorax radicis N35 Isolate Unclassified
280 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
281 2643221717 Acidovorax sp. Root267 Isolate Unclassified
282 2738541276 Cellvibrio sp. YR554 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.4
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.33
Nodule 0.8
Rhizoplane 4.37
Rhizosphere 75.55
Stem 0
Stem Tuber 0
Unclassified 6.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0467897 3300048903 Bacteria 968
2 JGI25157J39369_1001041 3300002741 Bacteria 12688
3 rootH2_10012260 3300003320 Bacteria 5562
4 rootH2_10111248 3300003320 Bacteria 1843
5 Ga0055539_1000431 3300003752 Bacteria 14924
6 Ga0055539_1013020 3300003752 Bacteria 1020
7 Ga0055533_1000053 3300003756 Bacteria 199478
8 Ga0055525_1000904 3300003759 Bacteria 8472
9 Ga0055537_1000024 3300003773 Bacteria 111410
10 Ga0055534_1000032 3300003784 Bacteria 118890
11 Ga0055528_1000966 3300003790 Bacteria 19056
12 Ga0055528_1028158 3300003790 Bacteria 1557
13 Ga0058861_11900683 3300004800 Unclassified 595
14 Ga0065714_10011768 3300005288 Bacteria 3017
15 Ga0065712_10465691 3300005290 Bacteria 674
16 Ga0070658_10830315 3300005327 Unclassified 803
17 Ga0070676_10002126 3300005328 Bacteria 10087
18 Ga0070683_100056555 3300005329 Bacteria 3643
19 Ga0070683_100058603 3300005329 Bacteria 3577
20 Ga0070683_100818544 3300005329 Bacteria 893
21 Ga0070690_100021702 3300005330 Bacteria 3923
22 Ga0070690_100220684 3300005330 Bacteria 1328
23 Ga0070677_10053896 3300005333 Bacteria 1636
24 Ga0068869_100010105 3300005334 Bacteria 6142
25 Ga0068869_100011559 3300005334 Bacteria 5795
26 Ga0070666_10131553 3300005335 Bacteria 1739
27 Ga0070680_100051214 3300005336 Bacteria 3369
28 Ga0068868_100155238 3300005338 Bacteria 1887
29 Ga0070660_100012911 3300005339 Bacteria 5977
30 Ga0070660_100261118 3300005339 Unclassified 1414
31 Ga0070660_100425722 3300005339 Bacteria 1099
32 Ga0070660_100810723 3300005339 Bacteria 788
33 Ga0070691_10317542 3300005341 Unclassified 856
34 Ga0070687_100053513 3300005343 Bacteria 2099
35 Ga0070661_100084219 3300005344 Bacteria 2349
36 Ga0070692_10085496 3300005345 Bacteria 1706
37 Ga0070669_100009250 3300005353 Bacteria 7019
38 Ga0070669_100376804 3300005353 Bacteria 1157
39 Ga0070675_100154991 3300005354 Bacteria 1966
40 Ga0070675_100161966 3300005354 Bacteria 1924
41 Ga0070659_100018658 3300005366 Bacteria 5236
42 Ga0070667_100027534 3300005367 Bacteria 4729
43 Ga0070667_100036537 3300005367 Bacteria 4118
44 Ga0070713_100000354 3300005436 Bacteria 29691
45 Ga0070711_100059753 3300005439 Bacteria 2648
46 Ga0070700_100098425 3300005441 Bacteria 1923
47 Ga0070708_100273278 3300005445 Bacteria 1590
48 Ga0070708_101418248 3300005445 Bacteria 648
49 Ga0070663_100168608 3300005455 Bacteria 1691
50 Ga0070678_100529336 3300005456 Bacteria 1044
51 Ga0070662_100050729 3300005457 Bacteria 2993
52 Ga0070662_100077524 3300005457 Bacteria 2466
53 Ga0070662_100084458 3300005457 Bacteria 2371
54 Ga0070662_100330874 3300005457 Bacteria 1244
55 Ga0070681_10002016 3300005458 Bacteria 18381
56 Ga0070681_10016015 3300005458 Bacteria 7474
57 Ga0070681_10109705 3300005458 Unclassified 2699
58 Ga0068867_100012228 3300005459 Bacteria 6066
59 Ga0068867_100039561 3300005459 Bacteria 3438
60 Ga0068867_100435659 3300005459 Bacteria 1114
61 Ga0068867_100588602 3300005459 Bacteria 969
62 Ga0070679_100053871 3300005530 Bacteria 4005
63 Ga0070679_100120704 3300005530 Unclassified 2606
64 Ga0070679_100132052 3300005530 Bacteria 2478
65 Ga0070684_100497905 3300005535 Bacteria 1128
66 Ga0070684_100954743 3300005535 Bacteria 804
67 Ga0070697_100470548 3300005536 Bacteria 1096
68 Ga0070697_101579698 3300005536 Bacteria 586
69 Ga0068853_100040073 3300005539 Bacteria 3995
70 Ga0068853_100044626 3300005539 Bacteria 3795
71 Ga0068853_100134983 3300005539 Bacteria 2211
72 Ga0068853_100330876 3300005539 Bacteria 1413
73 Ga0070672_100022473 3300005543 Bacteria 4634
74 Ga0070672_100051863 3300005543 Bacteria 3201
75 Ga0070672_100156907 3300005543 Bacteria 1885
76 Ga0070665_100303469 3300005548 Unclassified 1600
77 Ga0070665_100606307 3300005548 Bacteria 1108
78 Ga0070704_100442518 3300005549 Bacteria 1117
79 Ga0068855_100057508 3300005563 Bacteria 4558
80 Ga0068855_100237110 3300005563 Bacteria 2040
81 Ga0068855_100393423 3300005563 Bacteria 1520
82 Ga0068857_100025633 3300005577 Bacteria 5191
83 Ga0068857_100032310 3300005577 Bacteria 4628
84 Ga0068857_100092003 3300005577 Bacteria 2715
85 Ga0068857_100396458 3300005577 Bacteria 1284
86 Ga0068854_100061685 3300005578 Bacteria 2716
87 Ga0068854_100160660 3300005578 Bacteria 1740
88 Ga0068854_100168430 3300005578 Bacteria 1702
89 Ga0068854_100393122 3300005578 Bacteria 1145
90 Ga0068856_100036308 3300005614 Bacteria 4832
91 Ga0068856_100277374 3300005614 Unclassified 1693
92 Ga0068852_100320618 3300005616 Bacteria 1505
93 Ga0068852_100994213 3300005616 Bacteria 857
94 Ga0068859_100116413 3300005617 Bacteria 2737
95 Ga0068859_100406000 3300005617 Unclassified 1458
96 Ga0068859_101000006 3300005617 Bacteria 918
97 Ga0068864_100012571 3300005618 Bacteria 7000
98 Ga0068864_101383900 3300005618 Bacteria 705
99 Ga0068861_100005189 3300005719 Bacteria 8780
100 Ga0068861_100031611 3300005719 Bacteria 3890
101 Ga0068851_10047688 3300005834 Bacteria 2170
102 Ga0068870_10016697 3300005840 Bacteria 3514
103 Ga0068870_10062422 3300005840 Bacteria 2007
104 Ga0068863_100339918 3300005841 Bacteria 1460
105 Ga0068863_100605033 3300005841 Bacteria 1085
106 Ga0068863_100675434 3300005841 Bacteria 1025
107 Ga0068858_100135174 3300005842 Bacteria 2313
108 Ga0068860_100071343 3300005843 Bacteria 3301
109 Ga0068860_100099773 3300005843 Bacteria 2769
110 Ga0075365_10211254 3300006038 Bacteria 1360
111 Ga0075363_100345888 3300006048 Bacteria 868
112 Ga0075364_10075780 3300006051 Bacteria 2220
113 Ga0075364_10107788 3300006051 Bacteria 1857
114 Ga0075432_10118761 3300006058 Bacteria 991
115 Ga0070715_10052686 3300006163 Bacteria 1756
116 Ga0075362_10033180 3300006177 Bacteria 2244
117 Ga0075366_10003150 3300006195 Bacteria 8633
118 Ga0075366_10187311 3300006195 Bacteria 1257
119 Ga0075366_10298720 3300006195 Bacteria 985
120 Ga0075366_10340612 3300006195 Bacteria 919
121 Ga0097621_100127786 3300006237 Bacteria 2160
122 Ga0075370_10037398 3300006353 Bacteria 2729
123 Ga0075370_10133171 3300006353 Bacteria 1451
124 Ga0075370_10134881 3300006353 Bacteria 1442
125 Ga0075370_10172785 3300006353 Bacteria 1270
126 Ga0068871_100120278 3300006358 Bacteria 2218
127 Ga0068871_100513242 3300006358 Bacteria 1082
128 Ga0075434_100120027 3300006871 Plasmid 2644
129 Ga0068865_100090950 3300006881 Unclassified 2213
130 Ga0068865_100091220 3300006881 Bacteria 2211
131 Ga0068865_101021136 3300006881 Bacteria 725
132 Ga0075436_100006365 3300006914 Bacteria 8092
133 Ga0075436_100066246 3300006914 Unclassified 2496
134 Ga0097620_100116410 3300006931 Bacteria 2737
135 Ga0097620_100406008 3300006931 Unclassified 1458
136 Ga0097620_100999976 3300006931 Bacteria 918
137 Ga0079104_1026887 3300006946 Bacteria 1481
138 Ga0099826_10000060 3300006948 Bacteria 63334
139 Ga0105240_10022760 3300009093 Bacteria 8301
140 Ga0105240_10159984 3300009093 Bacteria 2676
141 Ga0111539_10178146 3300009094 Bacteria 2483
142 Ga0105245_10351175 3300009098 Bacteria 1461
143 Ga0105245_10485593 3300009098 Bacteria 1249
144 Ga0105243_10213221 3300009148 Bacteria 1702
145 Ga0105243_11209626 3300009148 Bacteria 769
146 Ga0105241_10084377 3300009174 Bacteria 2494
147 Ga0105241_10417827 3300009174 Bacteria 1180
148 Ga0105242_10020541 3300009176 Bacteria 5180
149 Ga0105242_10070260 3300009176 Bacteria 2903
150 Ga0105242_10237406 3300009176 Bacteria 1637
151 Ga0105242_10454557 3300009176 Bacteria 1208
152 Ga0105242_11288435 3300009176 Bacteria 754
153 Ga0105248_10009179 3300009177 Bacteria 10878
154 Ga0105248_10190636 3300009177 Bacteria 2310
155 Ga0105248_11189808 3300009177 Bacteria 862
156 Ga0105248_12053382 3300009177 Bacteria 650
157 Ga0105237_10056123 3300009545 Bacteria 3943
158 Ga0105237_10059483 3300009545 Bacteria 3823
159 Ga0105237_10210082 3300009545 Bacteria 1946
160 Ga0105237_10799964 3300009545 Bacteria 950
161 Ga0105238_10023381 3300009551 Bacteria 6300
162 Ga0105238_10032025 3300009551 Bacteria 5351
163 Ga0105238_10429979 3300009551 Bacteria 1316
164 Ga0105238_10818492 3300009551 Bacteria 947
165 Ga0105238_11003399 3300009551 Bacteria 856
166 Ga0105249_10000569 3300009553 Bacteria 33896
167 Ga0105249_10003872 3300009553 Bacteria 12918
168 Ga0105249_11083444 3300009553 Bacteria 871
169 Ga0105249_12200326 3300009553 Bacteria 624
170 Ga0105239_10014663 3300010375 Bacteria 8691
171 Ga0105239_10358556 3300010375 Unclassified 1646
172 Ga0105239_10652476 3300010375 Bacteria 1202
173 Ga0105239_10912263 3300010375 Bacteria 1008
174 Ga0105246_10079023 3300011119 Bacteria 2338
175 Ga0105246_10109160 3300011119 Bacteria 2029
176 Ga0105246_10410916 3300011119 Bacteria 1127
177 Ga0105246_10742460 3300011119 Bacteria 865
178 Ga0157373_10066827 3300013100 Bacteria 2542
179 Ga0157371_10025245 3300013102 Bacteria 4333
180 Ga0157371_10258903 3300013102 Bacteria 1254
181 Ga0157370_10001541 3300013104 Bacteria 28510
182 Ga0157370_10222859 3300013104 Bacteria 1746
183 Ga0157369_10023185 3300013105 Bacteria 6915
184 Ga0157369_10142239 3300013105 Bacteria 2538
185 Ga0157369_11300399 3300013105 Bacteria 741
186 Ga0157374_10058511 3300013296 Bacteria 3602
187 Ga0157374_10091768 3300013296 Bacteria 2897
188 Ga0157374_10122232 3300013296 Unclassified 2514
189 Ga0157374_10240355 3300013296 Bacteria 1781
190 Ga0157378_10140719 3300013297 Bacteria 2240
191 Ga0157378_10148686 3300013297 Bacteria 2181
192 Ga0157378_10460464 3300013297 Bacteria 1264
193 Ga0163162_10012159 3300013306 Bacteria 8403
194 Ga0163162_10033731 3300013306 Bacteria 5088
195 Ga0163162_10101102 3300013306 Bacteria 2975
196 Ga0163162_10133434 3300013306 Bacteria 2593
197 Ga0163162_10213487 3300013306 Bacteria 2060
198 Ga0163162_11671333 3300013306 Unclassified 727
199 Ga0157372_10094958 3300013307 Bacteria 3397
200 Ga0157372_11066491 3300013307 Bacteria 935
201 Ga0157372_11273651 3300013307 Bacteria 849
202 Ga0157375_10644805 3300013308 Bacteria 1216
203 Ga0157375_10760307 3300013308 Bacteria 1120
204 Ga0163163_10004182 3300014325 Bacteria 12299
205 Ga0163163_11011911 3300014325 Bacteria 894
206 Ga0157380_10009129 3300014326 Bacteria 7090
207 Ga0157380_10013980 3300014326 Bacteria 5862
208 Ga0157380_10044081 3300014326 Bacteria 3494
209 Ga0157380_10095641 3300014326 Bacteria 2461
210 Ga0157380_10649974 3300014326 Bacteria 1052
211 Ga0182008_10527408 3300014497 Bacteria 653
212 Ga0157377_10012006 3300014745 Bacteria 4344
213 Ga0157379_10073305 3300014968 Bacteria 3064
214 Ga0157379_10178067 3300014968 Bacteria 1921
215 Ga0163161_10004853 3300017792 Bacteria 9362
216 Ga0163161_10035355 3300017792 Bacteria 3576
217 Ga0163161_10082475 3300017792 Bacteria 2369
218 Ga0163161_10138081 3300017792 Bacteria 1844
219 Ga0163161_10371584 3300017792 Bacteria 1141
220 Ga0209674_100039 3300025226 Bacteria 402292
221 Ga0209563_100080 3300025230 Bacteria 199504
222 Ga0209646_1000076 3300025246 Bacteria 212891
223 Ga0209026_1000011 3300025250 Bacteria 507291
224 Ga0209677_100086 3300025253 Bacteria 112759
225 Ga0209677_100308 3300025253 Bacteria 32011
226 Ga0209759_1000034 3300025256 Bacteria 271209
227 Ga0209565_1000039 3300025263 Bacteria 278026
228 Ga0209673_1000284 3300025273 Bacteria 94932
229 Ga0209673_1010969 3300025273 Bacteria 3776
230 Ga0209675_1000030 3300025291 Bacteria 278026
231 Ga0209676_1043480 3300025292 Bacteria 1239
232 Ga0209025_1027189 3300025294 Bacteria 2845
233 Ga0209256_1017374 3300025299 Bacteria 2393
234 Ga0209051_1100523 3300025303 Bacteria 779
235 Ga0207697_10045534 3300025315 Bacteria 1806
236 Ga0207656_10022539 3300025321 Bacteria 2528
237 Ga0207656_10035588 3300025321 Bacteria 2086
238 Ga0207682_10020397 3300025893 Bacteria 2603
239 Ga0207688_10151691 3300025901 Bacteria 1369
240 Ga0207680_10043839 3300025903 Bacteria 2626
241 Ga0207685_10145516 3300025905 Unclassified 1067
242 Ga0207645_10011545 3300025907 Bacteria 6025
243 Ga0207643_10071058 3300025908 Bacteria 2003
244 Ga0207707_10000659 3300025912 Bacteria 34203
245 Ga0207707_10005489 3300025912 Bacteria 11084
246 Ga0207707_10031818 3300025912 Bacteria 4618
247 Ga0207695_10003912 3300025913 Bacteria 20607
248 Ga0207695_10447052 3300025913 Bacteria 1176
249 Ga0207671_10027936 3300025914 Bacteria 4217
250 Ga0207671_10244164 3300025914 Unclassified 1411
251 Ga0207671_10349354 3300025914 Bacteria 1173
252 Ga0207671_11010196 3300025914 Bacteria 655
253 Ga0207663_10253568 3300025916 Bacteria 1296
254 Ga0207660_10011567 3300025917 Bacteria 5750
255 Ga0207660_10187721 3300025917 Bacteria 1608
256 Ga0207662_10251795 3300025918 Bacteria 1159
257 Ga0207657_10038357 3300025919 Bacteria 4266
258 Ga0207657_10172224 3300025919 Unclassified 1753
259 Ga0207657_10402372 3300025919 Bacteria 1077
260 Ga0207657_10433327 3300025919 Bacteria 1032
261 Ga0207649_10142807 3300025920 Bacteria 1640
262 Ga0207652_10009622 3300025921 Bacteria 7774
263 Ga0207652_10039072 3300025921 Bacteria 4026
264 Ga0207652_10066830 3300025921 Bacteria 3117
265 Ga0207681_10032317 3300025923 Bacteria 3425
266 Ga0207681_10217441 3300025923 Bacteria 1476
267 Ga0207681_11133662 3300025923 Bacteria 657
268 Ga0207694_10003748 3300025924 Bacteria 12049
269 Ga0207694_10028071 3300025924 Bacteria 4290
270 Ga0207694_10219270 3300025924 Bacteria 1551
271 Ga0207694_10225409 3300025924 Bacteria 1529
272 Ga0207694_10448911 3300025924 Bacteria 1076
273 Ga0207694_10931963 3300025924 Bacteria 735
274 Ga0207659_10002492 3300025926 Bacteria 10978
275 Ga0207659_10076750 3300025926 Bacteria 2457
276 Ga0207659_10247410 3300025926 Bacteria 1445
277 Ga0207687_10150824 3300025927 Bacteria 1774
278 Ga0207700_10000042 3300025928 Bacteria 95374
279 Ga0207700_10046915 3300025928 Bacteria 3199
280 Ga0207644_10036181 3300025931 Bacteria 3464
281 Ga0207690_10562072 3300025932 Bacteria 928
282 Ga0207706_10005161 3300025933 Bacteria 12189
283 Ga0207706_10008889 3300025933 Bacteria 9248
284 Ga0207706_10044023 3300025933 Bacteria 3956
285 Ga0207706_10084338 3300025933 Bacteria 2793
286 Ga0207686_10174068 3300025934 Bacteria 1520
287 Ga0207686_10259800 3300025934 Bacteria 1273
288 Ga0207709_10758658 3300025935 Bacteria 780
289 Ga0207670_10202421 3300025936 Bacteria 1509
290 Ga0207669_10187339 3300025937 Bacteria 1489
291 Ga0207704_10217864 3300025938 Bacteria 1410
292 Ga0207704_10750755 3300025938 Bacteria 811
293 Ga0207691_10062232 3300025940 Bacteria 3388
294 Ga0207691_10120956 3300025940 Bacteria 2320
295 Ga0207691_10152371 3300025940 Bacteria 2032
296 Ga0207711_11185065 3300025941 Bacteria 705
297 Ga0207689_10001974 3300025942 Bacteria 19384
298 Ga0207689_11115018 3300025942 Bacteria 665
299 Ga0207661_10102901 3300025944 Bacteria 2402
300 Ga0207661_10548899 3300025944 Bacteria 1058
301 Ga0207679_10777047 3300025945 Bacteria 872
302 Ga0207667_10016391 3300025949 Bacteria 8376
303 Ga0207712_10012913 3300025961 Bacteria 5345
304 Ga0207640_10003720 3300025981 Bacteria 8226
305 Ga0207640_10011731 3300025981 Bacteria 4969
306 Ga0207640_11287717 3300025981 Bacteria 652
307 Ga0207658_10019916 3300025986 Bacteria 4643
308 Ga0207677_10408679 3300026023 Bacteria 1153
309 Ga0207703_10284764 3300026035 Bacteria 1502
310 Ga0207639_10029330 3300026041 Bacteria 4026
311 Ga0207639_10041066 3300026041 Bacteria 3458
312 Ga0207678_10131623 3300026067 Bacteria 2134
313 Ga0207678_10151848 3300026067 Bacteria 1978
314 Ga0207708_10023978 3300026075 Bacteria 4614
315 Ga0207708_10060490 3300026075 Bacteria 2891
316 Ga0207702_10000629 3300026078 Bacteria 38750
317 Ga0207702_10103635 3300026078 Bacteria 2517
318 Ga0207702_10387769 3300026078 Unclassified 1345
319 Ga0207702_10455126 3300026078 Bacteria 1242
320 Ga0207641_10008687 3300026088 Bacteria 8388
321 Ga0207641_10598225 3300026088 Bacteria 1079
322 Ga0207648_10070394 3300026089 Bacteria 3050
323 Ga0207648_10142257 3300026089 Bacteria 2115
324 Ga0207648_10485509 3300026089 Bacteria 1129
325 Ga0207676_10377507 3300026095 Bacteria 1319
326 Ga0207676_10626560 3300026095 Bacteria 1036
327 Ga0207674_10003424 3300026116 Bacteria 19421
328 Ga0207674_10028856 3300026116 Bacteria 5849
329 Ga0207674_10050033 3300026116 Bacteria 4272
330 Ga0207674_11382604 3300026116 Bacteria 673
331 Ga0207675_100001938 3300026118 Bacteria 20656
332 Ga0207675_100007765 3300026118 Bacteria 10122
333 Ga0207675_100083851 3300026118 Bacteria 2990
334 Ga0207683_10072087 3300026121 Bacteria 3055
335 Ga0207683_10630202 3300026121 Bacteria 993
336 Ga0207698_10152496 3300026142 Bacteria 2008
337 Ga0207698_10219974 3300026142 Bacteria 1715
338 Ga0207698_10705365 3300026142 Bacteria 1004
339 Ga0209281_1018195 3300027111 Bacteria 1410
340 Ga0209282_1000200 3300027666 Bacteria 32028
341 Ga0268266_10382765 3300028379 Unclassified 1327
342 Ga0268264_10098843 3300028381 Bacteria 2531
343 Ga0268264_10121829 3300028381 Bacteria 2299
344 Ga0268264_10142931 3300028381 Bacteria 2136
345 Ga0268264_10804598 3300028381 Bacteria 939
346 Ga0307517_10010923 3300028786 Bacteria 12650
347 Ga0307517_10046677 3300028786 Bacteria 4510
348 Ga0307515_10000494 3300028794 Bacteria 94354
349 Ga0307515_10006088 3300028794 Bacteria 24256
350 Ga0307515_10009239 3300028794 Bacteria 19087
351 Ga0307515_10082687 3300028794 Bacteria 4148
352 Ga0307515_10170950 3300028794 Bacteria 2166
353 Ga0265338_10536592 3300028800 Unclassified 820
354 Ga0307512_10068043 3300030522 Bacteria 2675
355 Ga0316183_1055656 3300030742 Bacteria 922
356 Ga0316181_1015265 3300030744 Bacteria 2855
357 Ga0316182_1055903 3300030745 Bacteria 3230
358 Ga0265762_1014174 3300030760 Unclassified 1437
359 Ga0265340_10206473 3300031247 Bacteria 883
360 Ga0307513_10575214 3300031456 Bacteria 837
361 Ga0307509_10000539 3300031507 Bacteria 64754
362 Ga0307509_10072227 3300031507 Bacteria 3596
363 Ga0307509_10347080 3300031507 Bacteria 1209
364 Ga0307408_100047574 3300031548 Bacteria 3072
365 Ga0307408_100063098 3300031548 Bacteria 2709
366 Ga0307408_100086886 3300031548 Bacteria 2351
367 Ga0307408_100163198 3300031548 Bacteria 1771
368 Ga0307408_100224888 3300031548 Bacteria 1533
369 Ga0307408_100453789 3300031548 Bacteria 1112
370 Ga0307508_10000096 3300031616 Bacteria 103730
371 Ga0307508_10236145 3300031616 Bacteria 1426
372 Ga0307508_10335597 3300031616 Bacteria 1103
373 Ga0307514_10001231 3300031649 Bacteria 33814
374 Ga0307514_10153233 3300031649 Bacteria 1542
375 Ga0307514_10351129 3300031649 Bacteria 786
376 Ga0307516_10090180 3300031730 Bacteria 2895
377 Ga0307516_10269340 3300031730 Bacteria 1390
378 Ga0307516_10354710 3300031730 Bacteria 1132
379 Ga0307516_10573541 3300031730 Bacteria 782
380 Ga0307412_10111493 3300031911 Bacteria 1954
381 Ga0307412_10679616 3300031911 Bacteria 881
382 Ga0307412_11471020 3300031911 Bacteria 618
383 Ga0307416_100286733 3300032002 Bacteria 1627
384 Ga0307414_10147855 3300032004 Bacteria 1849
385 Ga0307411_10490879 3300032005 Bacteria 1036
386 Ga0307411_10589050 3300032005 Bacteria 954
387 Ga0307510_10003423 3300033180 Bacteria 18505
388 Ga0307510_10268142 3300033180 Bacteria 1185
389 Ga0373941_0168374 3300035115 Bacteria 815
390 Ga0373954_0373190 3300035118 Unclassified 705
391 Ga0373931_0003874 3300035691 Bacteria 6768
392 Ga0373935_0546657 3300035692 Bacteria 844
393 Ga0373927_0101859 3300035695 Bacteria 1868
394 Ga0373937_0310763 3300036401 Bacteria 1491
395 Ga0373937_0503464 3300036401 Unclassified 1151
396 Ga0373937_1130246 3300036401 Bacteria 732
397 Ga0373925_0217508 3300037068 Unclassified 1524
398 Ga0395898_0019622 3300037466 Bacteria 6877
399 Ga0395901_0005935 3300038443 Bacteria 12368
400 Ga0436365_1749871 3300039437 Bacteria 626
401 Ga0439436_0037395 3300041404 Bacteria 1398
402 Ga0451793_0865086 3300041452 Bacteria 991
403 Ga0451833_0293784 3300041491 Bacteria 595
404 Ga0451845_0372831 3300041501 Bacteria 1179
405 Ga0439450_085492 3300042008 Bacteria 788
406 Ga0439462_0036299 3300042015 Bacteria 1312
407 Ga0439446_0002979 3300042156 Bacteria 4143
408 Ga0439464_0000864 3300042439 Bacteria 6731
409 Ga0439460_0050819 3300042461 Bacteria 1243
410 Ga0466969_0000007 3300044656 Bacteria 152114
411 Ga0466965_0137763 3300044683 Bacteria 1269
412 Ga0453684_0145668 3300044712 Bacteria 2822
413 Ga0466968_0321227 3300044735 Bacteria 748
414 Ga0466960_0228235 3300044901 Bacteria 1027
415 Ga0466959_0010140 3300045049 Bacteria 6721
416 Ga0451576_0021520 3300045051 Bacteria 7010
417 Ga0451576_0422154 3300045051 Bacteria 1399
418 Ga0495592_0001842 3300046454 Bacteria 14907
419 Ga0495603_0295143 3300046455 Bacteria 931
420 Ga0495629_0176874 3300046459 Bacteria 1480
421 Ga0495629_0572389 3300046459 Bacteria 757
422 Ga0495638_0160895 3300046460 Bacteria 1295
423 Ga0495638_0187590 3300046460 Bacteria 1175
424 Ga0495580_0392266 3300046472 Bacteria 937
425 Ga0495582_0000735 3300046473 Bacteria 18080
426 Ga0495639_0442915 3300046475 Bacteria 659
427 Ga0495648_0300800 3300046524 Bacteria 752
428 Ga0495625_0256635 3300046660 Unclassified 1133
429 Ga0495623_0536880 3300046679 Unclassified 614
430 Ga0495646_0129244 3300046680 Bacteria 1423
431 Ga0495658_0001903 3300046683 Bacteria 10657
432 Ga0495658_0160983 3300046683 Bacteria 1384
433 Ga0495658_0192311 3300046683 Bacteria 1269
434 Ga0495658_0276635 3300046683 Bacteria 1059
435 Ga0495686_0286517 3300047472 Bacteria 914
436 Ga0496100_0341428 3300048903 Bacteria 1129
437 Ga0496101_0073045 3300048904 Bacteria 2519
438 Ga0496102_0042644 3300048905 Bacteria 4112
439 Ga0496103_0510190 3300048906 Bacteria 769
440 Ga0496104_0009677 3300048907 Bacteria 8587
441 Ga0496104_0382199 3300048907 Bacteria 1321
442 Ga0496105_0005715 3300048908 Bacteria 9468
443 Ga0496105_0008178 3300048908 Bacteria 8130
444 Ga0496105_0331156 3300048908 Bacteria 1219
445 Ga0496106_0205695 3300048909 Bacteria 1567
446 Ga0496107_0008125 3300048910 Bacteria 7255
447 Ga0496108_0151169 3300048911 Bacteria 2003
448 Ga0496109_0493766 3300048912 Bacteria 1155
449 Ga0496110_0128942 3300048913 Bacteria 2283
450 Ga0496111_0011766 3300048914 Bacteria 5907
451 Ga0496113_0413339 3300048916 Bacteria 1083
452 Ga0496114_0132627 3300048917 Bacteria 2152
453 Ga0496114_0216839 3300048917 Bacteria 1679
454 Ga0496114_0543147 3300048917 Bacteria 1027
455 Ga0496115_0067730 3300048918 Bacteria 2888
456 Ga0496121_0003714 3300048924 Bacteria 21408
457 Ga0496124_0383803 3300048927 Bacteria 981
458 Ga0496125_0378511 3300048928 Unclassified 835
459 Ga0501290_080086 3300049513 Bacteria 556
460 Ga0501292_000649 3300049515 Bacteria 4255
461 Ga0501294_005705 3300049517 Bacteria 1182
462 Ga0501298_013683 3300049521 Bacteria 1440
463 Ga0501222_005931 3300049662 Bacteria 1643
464 Ga0501223_016442 3300049663 Bacteria 1462
465 Ga0501228_035337 3300049666 Bacteria 630
466 Ga0501257_011650 3300049686 Bacteria 2010
467 Ga0501221_015817 3300049704 Bacteria 1420
468 Ga0501229_000249 3300049706 Bacteria 6050
469 Ga0501265_000809 3300049762 Bacteria 3449
470 Ga0501278_002450 3300049774 Bacteria 1306
471 nmdc:mga03683_218344_c1 3300050489 Bacteria 879
472 nmdc:mga03683_4601_c2 3300050489 Bacteria 2321
473 nmdc:mga03n38_81204_c1 3300050490 Bacteria 1524
474 nmdc:mga0k408_129630_c1 3300050493 Bacteria 1497
475 nmdc:mga0k408_317763_c1 3300050493 Bacteria 929
476 nmdc:mga0k408_415463_c1 3300050493 Unclassified 800
477 nmdc:mga0k408_41621_c1 3300050493 Bacteria 2645
478 nmdc:mga0k408_423409_c1 3300050493 Bacteria 792
479 nmdc:mga0k408_595_c2 3300050493 Bacteria 18958
480 nmdc:mga0k408_8383_c1 3300050493 Bacteria 5544
481 nmdc:mga06z11_840865_c1 3300050494 Bacteria 559
482 nmdc:mga07m45_30356_c1 3300050496 Bacteria 2994
483 nmdc:mga07m45_49910_c1 3300050496 Bacteria 2357
484 nmdc:mga0n895_477305_c1 3300050512 Bacteria 1258
485 nmdc:mga0rr50_142929_c1 3300050513 Bacteria 1926
486 nmdc:mga08x19_133226_c1 3300050514 Unclassified 1673
487 nmdc:mga0a205_39992_c1 3300050515 Plasmid 4514
488 Ga0495595_0441510 3300053084 Unclassified 661
489 Ga0500644_0001797 3300053088 Bacteria 5543
490 Ga0500651_0343774 3300053093 Bacteria 848
491 Ga0500562_005799 3300053108 Bacteria 3109
492 Ga0500594_0015901 3300053118 Bacteria 1822
493 Ga0500652_103671 3300053131 Unclassified 1189
494 Ga0500559_0000278 3300053136 Bacteria 39648
495 Ga0500559_0001149 3300053136 Bacteria 15966
496 Ga0500622_0000413 3300053156 Bacteria 40682
497 Ga0500622_0004660 3300053156 Bacteria 8483
498 Ga0500634_0050967 3300053161 Bacteria 2228
499 Ga0500599_012565 3300053736 Bacteria 1138
500 2548498921 2547132374 Bacteria 5530232
501 2644158967 2643221628 Bacteria 5745828
502 2644648380 2643221717 Bacteria 5676132
503 2738715568 2738541276 Bacteria 4690596
504 Ga0496100_0467897
505 JGI25157J39369_1001041
506 rootH2_10012260
507 rootH2_10111248
508 Ga0055539_1000431
509 Ga0055539_1013020
510 Ga0055533_1000053
511 Ga0055525_1000904
512 Ga0055537_1000024
513 Ga0055534_1000032
514 Ga0055528_1000966
515 Ga0055528_1028158
516 Ga0058861_11900683
517 Ga0065714_10011768
518 Ga0065712_10465691
519 Ga0070658_10830315
520 Ga0070676_10002126
521 Ga0070683_100056555
522 Ga0070683_100058603
523 Ga0070683_100818544
524 Ga0070690_100021702
525 Ga0070690_100220684
526 Ga0070677_10053896
527 Ga0068869_100010105
528 Ga0068869_100011559
529 Ga0070666_10131553
530 Ga0070680_100051214
531 Ga0068868_100155238
532 Ga0070660_100012911
533 Ga0070660_100261118
534 Ga0070660_100425722
535 Ga0070660_100810723
536 Ga0070691_10317542
537 Ga0070687_100053513
538 Ga0070661_100084219
539 Ga0070692_10085496
540 Ga0070669_100009250
541 Ga0070669_100376804
542 Ga0070675_100154991
543 Ga0070675_100161966
544 Ga0070659_100018658
545 Ga0070667_100027534
546 Ga0070667_100036537
547 Ga0070713_100000354
548 Ga0070711_100059753
549 Ga0070700_100098425
550 Ga0070708_100273278
551 Ga0070708_101418248
552 Ga0070663_100168608
553 Ga0070678_100529336
554 Ga0070662_100050729
555 Ga0070662_100077524
556 Ga0070662_100084458
557 Ga0070662_100330874
558 Ga0070681_10002016
559 Ga0070681_10016015
560 Ga0070681_10109705
561 Ga0068867_100012228
562 Ga0068867_100039561
563 Ga0068867_100435659
564 Ga0068867_100588602
565 Ga0070679_100053871
566 Ga0070679_100120704
567 Ga0070679_100132052
568 Ga0070684_100497905
569 Ga0070684_100954743
570 Ga0070697_100470548
571 Ga0070697_101579698
572 Ga0068853_100040073
573 Ga0068853_100044626
574 Ga0068853_100134983
575 Ga0068853_100330876
576 Ga0070672_100022473
577 Ga0070672_100051863
578 Ga0070672_100156907
579 Ga0070665_100303469
580 Ga0070665_100606307
581 Ga0070704_100442518
582 Ga0068855_100057508
583 Ga0068855_100237110
584 Ga0068855_100393423
585 Ga0068857_100025633
586 Ga0068857_100032310
587 Ga0068857_100092003
588 Ga0068857_100396458
589 Ga0068854_100061685
590 Ga0068854_100160660
591 Ga0068854_100168430
592 Ga0068854_100393122
593 Ga0068856_100036308
594 Ga0068856_100277374
595 Ga0068852_100320618
596 Ga0068852_100994213
597 Ga0068859_100116413
598 Ga0068859_100406000
599 Ga0068859_101000006
600 Ga0068864_100012571
601 Ga0068864_101383900
602 Ga0068861_100005189
603 Ga0068861_100031611
604 Ga0068851_10047688
605 Ga0068870_10016697
606 Ga0068870_10062422
607 Ga0068863_100339918
608 Ga0068863_100605033
609 Ga0068863_100675434
610 Ga0068858_100135174
611 Ga0068860_100071343
612 Ga0068860_100099773
613 Ga0075365_10211254
614 Ga0075363_100345888
615 Ga0075364_10075780
616 Ga0075364_10107788
617 Ga0075432_10118761
618 Ga0070715_10052686
619 Ga0075362_10033180
620 Ga0075366_10003150
621 Ga0075366_10187311
622 Ga0075366_10298720
623 Ga0075366_10340612
624 Ga0097621_100127786
625 Ga0075370_10037398
626 Ga0075370_10133171
627 Ga0075370_10134881
628 Ga0075370_10172785
629 Ga0068871_100120278
630 Ga0068871_100513242
631 Ga0075434_100120027
632 Ga0068865_100090950
633 Ga0068865_100091220
634 Ga0068865_101021136
635 Ga0075436_100006365
636 Ga0075436_100066246
637 Ga0097620_100116410
638 Ga0097620_100406008
639 Ga0097620_100999976
640 Ga0079104_1026887
641 Ga0099826_10000060
642 Ga0105240_10022760
643 Ga0105240_10159984
644 Ga0111539_10178146
645 Ga0105245_10351175
646 Ga0105245_10485593
647 Ga0105243_10213221
648 Ga0105243_11209626
649 Ga0105241_10084377
650 Ga0105241_10417827
651 Ga0105242_10020541
652 Ga0105242_10070260
653 Ga0105242_10237406
654 Ga0105242_10454557
655 Ga0105242_11288435
656 Ga0105248_10009179
657 Ga0105248_10190636
658 Ga0105248_11189808
659 Ga0105248_12053382
660 Ga0105237_10056123
661 Ga0105237_10059483
662 Ga0105237_10210082
663 Ga0105237_10799964
664 Ga0105238_10023381
665 Ga0105238_10032025
666 Ga0105238_10429979
667 Ga0105238_10818492
668 Ga0105238_11003399
669 Ga0105249_10000569
670 Ga0105249_10003872
671 Ga0105249_11083444
672 Ga0105249_12200326
673 Ga0105239_10014663
674 Ga0105239_10358556
675 Ga0105239_10652476
676 Ga0105239_10912263
677 Ga0105246_10079023
678 Ga0105246_10109160
679 Ga0105246_10410916
680 Ga0105246_10742460
681 Ga0157373_10066827
682 Ga0157371_10025245
683 Ga0157371_10258903
684 Ga0157370_10001541
685 Ga0157370_10222859
686 Ga0157369_10023185
687 Ga0157369_10142239
688 Ga0157369_11300399
689 Ga0157374_10058511
690 Ga0157374_10091768
691 Ga0157374_10122232
692 Ga0157374_10240355
693 Ga0157378_10140719
694 Ga0157378_10148686
695 Ga0157378_10460464
696 Ga0163162_10012159
697 Ga0163162_10033731
698 Ga0163162_10101102
699 Ga0163162_10133434
700 Ga0163162_10213487
701 Ga0163162_11671333
702 Ga0157372_10094958
703 Ga0157372_11066491
704 Ga0157372_11273651
705 Ga0157375_10644805
706 Ga0157375_10760307
707 Ga0163163_10004182
708 Ga0163163_11011911
709 Ga0157380_10009129
710 Ga0157380_10013980
711 Ga0157380_10044081
712 Ga0157380_10095641
713 Ga0157380_10649974
714 Ga0182008_10527408
715 Ga0157377_10012006
716 Ga0157379_10073305
717 Ga0157379_10178067
718 Ga0163161_10004853
719 Ga0163161_10035355
720 Ga0163161_10082475
721 Ga0163161_10138081
722 Ga0163161_10371584
723 Ga0209674_100039
724 Ga0209563_100080
725 Ga0209646_1000076
726 Ga0209026_1000011
727 Ga0209677_100086
728 Ga0209677_100308
729 Ga0209759_1000034
730 Ga0209565_1000039
731 Ga0209673_1000284
732 Ga0209673_1010969
733 Ga0209675_1000030
734 Ga0209676_1043480
735 Ga0209025_1027189
736 Ga0209256_1017374
737 Ga0209051_1100523
738 Ga0207697_10045534
739 Ga0207656_10022539
740 Ga0207656_10035588
741 Ga0207682_10020397
742 Ga0207688_10151691
743 Ga0207680_10043839
744 Ga0207685_10145516
745 Ga0207645_10011545
746 Ga0207643_10071058
747 Ga0207707_10000659
748 Ga0207707_10005489
749 Ga0207707_10031818
750 Ga0207695_10003912
751 Ga0207695_10447052
752 Ga0207671_10027936
753 Ga0207671_10244164
754 Ga0207671_10349354
755 Ga0207671_11010196
756 Ga0207663_10253568
757 Ga0207660_10011567
758 Ga0207660_10187721
759 Ga0207662_10251795
760 Ga0207657_10038357
761 Ga0207657_10172224
762 Ga0207657_10402372
763 Ga0207657_10433327
764 Ga0207649_10142807
765 Ga0207652_10009622
766 Ga0207652_10039072
767 Ga0207652_10066830
768 Ga0207681_10032317
769 Ga0207681_10217441
770 Ga0207681_11133662
771 Ga0207694_10003748
772 Ga0207694_10028071
773 Ga0207694_10219270
774 Ga0207694_10225409
775 Ga0207694_10448911
776 Ga0207694_10931963
777 Ga0207659_10002492
778 Ga0207659_10076750
779 Ga0207659_10247410
780 Ga0207687_10150824
781 Ga0207700_10000042
782 Ga0207700_10046915
783 Ga0207644_10036181
784 Ga0207690_10562072
785 Ga0207706_10005161
786 Ga0207706_10008889
787 Ga0207706_10044023
788 Ga0207706_10084338
789 Ga0207686_10174068
790 Ga0207686_10259800
791 Ga0207709_10758658
792 Ga0207670_10202421
793 Ga0207669_10187339
794 Ga0207704_10217864
795 Ga0207704_10750755
796 Ga0207691_10062232
797 Ga0207691_10120956
798 Ga0207691_10152371
799 Ga0207711_11185065
800 Ga0207689_10001974
801 Ga0207689_11115018
802 Ga0207661_10102901
803 Ga0207661_10548899
804 Ga0207679_10777047
805 Ga0207667_10016391
806 Ga0207712_10012913
807 Ga0207640_10003720
808 Ga0207640_10011731
809 Ga0207640_11287717
810 Ga0207658_10019916
811 Ga0207677_10408679
812 Ga0207703_10284764
813 Ga0207639_10029330
814 Ga0207639_10041066
815 Ga0207678_10131623
816 Ga0207678_10151848
817 Ga0207708_10023978
818 Ga0207708_10060490
819 Ga0207702_10000629
820 Ga0207702_10103635
821 Ga0207702_10387769
822 Ga0207702_10455126
823 Ga0207641_10008687
824 Ga0207641_10598225
825 Ga0207648_10070394
826 Ga0207648_10142257
827 Ga0207648_10485509
828 Ga0207676_10377507
829 Ga0207676_10626560
830 Ga0207674_10003424
831 Ga0207674_10028856
832 Ga0207674_10050033
833 Ga0207674_11382604
834 Ga0207675_100001938
835 Ga0207675_100007765
836 Ga0207675_100083851
837 Ga0207683_10072087
838 Ga0207683_10630202
839 Ga0207698_10152496
840 Ga0207698_10219974
841 Ga0207698_10705365
842 Ga0209281_1018195
843 Ga0209282_1000200
844 Ga0268266_10382765
845 Ga0268264_10098843
846 Ga0268264_10121829
847 Ga0268264_10142931
848 Ga0268264_10804598
849 Ga0307517_10010923
850 Ga0307517_10046677
851 Ga0307515_10000494
852 Ga0307515_10006088
853 Ga0307515_10009239
854 Ga0307515_10082687
855 Ga0307515_10170950
856 Ga0265338_10536592
857 Ga0307512_10068043
858 Ga0316183_1055656
859 Ga0316181_1015265
860 Ga0316182_1055903
861 Ga0265762_1014174
862 Ga0265340_10206473
863 Ga0307513_10575214
864 Ga0307509_10000539
865 Ga0307509_10072227
866 Ga0307509_10347080
867 Ga0307408_100047574
868 Ga0307408_100063098
869 Ga0307408_100086886
870 Ga0307408_100163198
871 Ga0307408_100224888
872 Ga0307408_100453789
873 Ga0307508_10000096
874 Ga0307508_10236145
875 Ga0307508_10335597
876 Ga0307514_10001231
877 Ga0307514_10153233
878 Ga0307514_10351129
879 Ga0307516_10090180
880 Ga0307516_10269340
881 Ga0307516_10354710
882 Ga0307516_10573541
883 Ga0307412_10111493
884 Ga0307412_10679616
885 Ga0307412_11471020
886 Ga0307416_100286733
887 Ga0307414_10147855
888 Ga0307411_10490879
889 Ga0307411_10589050
890 Ga0307510_10003423
891 Ga0307510_10268142
892 Ga0373941_0168374
893 Ga0373954_0373190
894 Ga0373931_0003874
895 Ga0373935_0546657
896 Ga0373927_0101859
897 Ga0373937_0310763
898 Ga0373937_0503464
899 Ga0373937_1130246
900 Ga0373925_0217508
901 Ga0395898_0019622
902 Ga0395901_0005935
903 Ga0436365_1749871
904 Ga0439436_0037395
905 Ga0451793_0865086
906 Ga0451833_0293784
907 Ga0451845_0372831
908 Ga0439450_085492
909 Ga0439462_0036299
910 Ga0439446_0002979
911 Ga0439464_0000864
912 Ga0439460_0050819
913 Ga0466969_0000007
914 Ga0466965_0137763
915 Ga0453684_0145668
916 Ga0466968_0321227
917 Ga0466960_0228235
918 Ga0466959_0010140
919 Ga0451576_0021520
920 Ga0451576_0422154
921 Ga0495592_0001842
922 Ga0495603_0295143
923 Ga0495629_0176874
924 Ga0495629_0572389
925 Ga0495638_0160895
926 Ga0495638_0187590
927 Ga0495580_0392266
928 Ga0495582_0000735
929 Ga0495639_0442915
930 Ga0495648_0300800
931 Ga0495625_0256635
932 Ga0495623_0536880
933 Ga0495646_0129244
934 Ga0495658_0001903
935 Ga0495658_0160983
936 Ga0495658_0192311
937 Ga0495658_0276635
938 Ga0495686_0286517
939 Ga0496100_0341428
940 Ga0496101_0073045
941 Ga0496102_0042644
942 Ga0496103_0510190
943 Ga0496104_0009677
944 Ga0496104_0382199
945 Ga0496105_0005715
946 Ga0496105_0008178
947 Ga0496105_0331156
948 Ga0496106_0205695
949 Ga0496107_0008125
950 Ga0496108_0151169
951 Ga0496109_0493766
952 Ga0496110_0128942
953 Ga0496111_0011766
954 Ga0496113_0413339
955 Ga0496114_0132627
956 Ga0496114_0216839
957 Ga0496114_0543147
958 Ga0496115_0067730
959 Ga0496121_0003714
960 Ga0496124_0383803
961 Ga0496125_0378511
962 Ga0501290_080086
963 Ga0501292_000649
964 Ga0501294_005705
965 Ga0501298_013683
966 Ga0501222_005931
967 Ga0501223_016442
968 Ga0501228_035337
969 Ga0501257_011650
970 Ga0501221_015817
971 Ga0501229_000249
972 Ga0501265_000809
973 Ga0501278_002450
974 nmdc:mga03683_218344_c1
975 nmdc:mga03683_4601_c2
976 nmdc:mga03n38_81204_c1
977 nmdc:mga0k408_129630_c1
978 nmdc:mga0k408_317763_c1
979 nmdc:mga0k408_415463_c1
980 nmdc:mga0k408_41621_c1
981 nmdc:mga0k408_423409_c1
982 nmdc:mga0k408_595_c2
983 nmdc:mga0k408_8383_c1
984 nmdc:mga06z11_840865_c1
985 nmdc:mga07m45_30356_c1
986 nmdc:mga07m45_49910_c1
987 nmdc:mga0n895_477305_c1
988 nmdc:mga0rr50_142929_c1
989 nmdc:mga08x19_133226_c1
990 nmdc:mga0a205_39992_c1
991 Ga0495595_0441510
992 Ga0500644_0001797
993 Ga0500651_0343774
994 Ga0500562_005799
995 Ga0500594_0015901
996 Ga0500652_103671
997 Ga0500559_0000278
998 Ga0500559_0001149
999 Ga0500622_0000413
1000 Ga0500622_0004660
1001 Ga0500634_0050967
1002 Ga0500599_012565
1003 2548498921
1004 2644158967
1005 2644648380
1006 2738715568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

84

189

0.92

PF07366

SnoaL

SnoaL-like polyketide cyclase

82

195

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bng-assembly1.cif.gz_B structure of an m.tuberculosis leh-like epoxide hydrolase 0.6926 46 160
5tpj-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.6925 50 160
2bng-assembly1.cif.gz_C-2 structure of an m.tuberculosis leh-like epoxide hydrolase 0.6904 45 160
4xdv-assembly2.cif.gz_E crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclohexanediol 0.6796 35 160
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.6779 42 167
ID Description Score Start End Superfamily
af_B0S750_62_245_1.20.870.10 Mainly Alpha;Up-down Bundle;Son of sevenless (SoS) protein; Chain S, domain 1;Son of sevenless (SoS) protein Chain: S domain 1 0.7593 111 147 1.20.870.10
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7391 48 166 3.10.450.50
af_Q4CRZ1_58_338_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.7291 116 157 2.120.10.10
af_Q54S79_439_628_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7281 122 153 2.130.10.10
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.727 48 166 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1A8TEE5-F1-model_v4 SnoaL-like domain protein 0.9707 26 166 GO:0030638
AF-A0A349Z003-F1-model_v4 SnoaL-like domain-containing protein 0.9697 27 167 GO:0030638
AF-A0A3N7JVE8-F1-model_v4 SnoaL-like domain-containing protein 0.9668 26 167 GO:0030638
AF-A0A7K1SFG3-F1-model_v4 Uncharacterized protein 0.9614 64 128
AF-A0A8A7W0I0-F1-model_v4 deleted 0.9601 26 167

Map