F456138

General Info

Members Datasets Scaffolds Average Seq Length
504 311 470 391

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100009307|Ga0070668_1000093078
Length 448
Sequence MGDIASGSKFGATTLWIEMRIPKCNGREDILERIHPAAVALRRHGLVSACRSMKENGMRALCWHGKGDVRVDTVPDPKIQHPRDAVIKITACAICGSDLHLFDGYQPTMESGDILGHENMGEVIELGSEVTNLKIGDRVVVPFTISCGQCWFCQKGLFSCCDRTNPNAEMAAKAMGQSPAGLFGFSHMLGGYAGGQAEYLRVPMADVGPIKVPENITDEQALFLSDIFPTGYMAAVNAQIEPGDTVAIWGCGPVGQFAIRSALILGAGRVIAIDEVPERLAMAEAGGAETIDFSKTDVHNELMRRTNKRGPDSCIDAVGCEASGHGAADAVLDKVKAATFLATDRVHVLREAIMCCRKAGTVSIPGVYVGMGDKIPLGAAMNKGLTIKTGQTHVQAYTQPLLKLIQAGDIDPSFVVTHPASLEDAPAMYKKFRDKEDGVIKVVLRPGG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
6 2841760612 Bosea sp. Tri-49 Isolate Nodule
7 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
8 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
9 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
10 2844104063 Bosea sp. Tri-39 Isolate Nodule
11 2851182111 Bosea sp. Tri-44 Isolate Nodule
12 2851246043 Bosea sp. Tri-54 Isolate Nodule
13 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
14 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
15 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
16 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
17 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
18 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
19 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
20 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
21 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
22 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
23 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
24 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
25 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
26 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
27 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
28 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
29 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
30 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
31 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
299 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
304 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
308 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
309 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
310 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
311 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 1.59
Isolates 6.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 9.72
Nodule 3.57
Rhizoplane 3.17
Rhizosphere 76.39
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2694069 2162886007 Bacteria 65779
2 LJQas_1000088 3300000549 Bacteria 15773
3 JGI24742J22300_10001183 3300002244 Bacteria 4071
4 JGI25159J45721_1000859 3300002987 Bacteria 13230
5 JGI25153J46596_10015410 3300003215 Bacteria 3115
6 Ga0032354_1050675 3300003693 Bacteria 1430
7 Ga0032354_1067747 3300003693 Bacteria 2154
8 Ga0032354_1083202 3300003693 Bacteria 2150
9 Ga0058862_12774351 3300004803 Bacteria 2122
10 Ga0065165_1000044 3300005262 Bacteria 203774
11 Ga0065704_10070132 3300005289 Bacteria 1955461
12 Ga0065712_10070823 3300005290 Bacteria 5672
13 Ga0070690_100059484 3300005330 Bacteria 2456
14 Ga0070670_100023937 3300005331 Bacteria 5253
15 Ga0070670_100025846 3300005331 Bacteria 5052
16 Ga0070670_100157602 3300005331 Bacteria 1967
17 Ga0068869_100006515 3300005334 Bacteria 7413
18 Ga0068869_100040593 3300005334 Bacteria 3328
19 Ga0068869_100064256 3300005334 Bacteria 2699
20 Ga0070680_100009120 3300005336 Bacteria 7610
21 Ga0070680_100105163 3300005336 Bacteria 2346
22 Ga0070682_100201261 3300005337 Bacteria 1405
23 Ga0068868_100023233 3300005338 Bacteria 4691
24 Ga0068868_100108773 3300005338 Bacteria 2251
25 Ga0070689_100000555 3300005340 Bacteria 22356
26 Ga0070689_100029557 3300005340 Bacteria 4150
27 Ga0070687_100083275 3300005343 Bacteria 1751
28 Ga0070687_100142021 3300005343 Bacteria 1399
29 Ga0070661_100010423 3300005344 Bacteria 6462
30 Ga0070661_100055408 3300005344 Bacteria 2903
31 Ga0070668_100009307 3300005347 Bacteria 7287
32 Ga0070669_100043513 3300005353 Bacteria 3271
33 Ga0070669_100192666 3300005353 Bacteria 1600
34 Ga0070675_100002990 3300005354 Bacteria 12769
35 Ga0070675_100025740 3300005354 Bacteria 4717
36 Ga0070675_100156175 3300005354 Bacteria 1959
37 Ga0070671_100015416 3300005355 Bacteria 6174
38 Ga0070671_100117591 3300005355 Bacteria 2235
39 Ga0070674_100006620 3300005356 Bacteria 6774
40 Ga0070674_100040051 3300005356 Bacteria 3168
41 Ga0070674_100079208 3300005356 Bacteria 2343
42 Ga0070673_100041523 3300005364 Bacteria 3539
43 Ga0070688_100004603 3300005365 Bacteria 7196
44 Ga0070659_100076281 3300005366 Bacteria 2673
45 Ga0070703_10021979 3300005406 Bacteria 1868
46 Ga0070701_10021629 3300005438 Bacteria 3073
47 Ga0070705_100040004 3300005440 Bacteria 2664
48 Ga0070700_100026337 3300005441 Bacteria 3433
49 Ga0070694_100003266 3300005444 Bacteria 9679
50 Ga0070663_100185899 3300005455 Bacteria 1614
51 Ga0070678_100020702 3300005456 Bacteria 4321
52 Ga0070678_100106314 3300005456 Bacteria 2186
53 Ga0070678_100139813 3300005456 Bacteria 1936
54 Ga0070678_100267487 3300005456 Bacteria 1440
55 Ga0070662_100001353 3300005457 Bacteria 15052
56 Ga0070662_100001949 3300005457 Bacteria 12689
57 Ga0070681_10006359 3300005458 Bacteria 11485
58 Ga0068867_100016933 3300005459 Bacteria 5179
59 Ga0070685_10000885 3300005466 Bacteria 16184
60 Ga0070685_10001062 3300005466 Bacteria 14728
61 Ga0070685_10002694 3300005466 Bacteria 9095
62 Ga0070685_10025161 3300005466 Bacteria 3277
63 Ga0070679_100007317 3300005530 Bacteria 10315
64 Ga0070679_100148179 3300005530 Bacteria 2324
65 Ga0070684_100030256 3300005535 Bacteria 4599
66 Ga0068853_100001675 3300005539 Bacteria 16220
67 Ga0070672_100009876 3300005543 Bacteria 6597
68 Ga0070672_100033730 3300005543 Bacteria 3879
69 Ga0070686_100000052 3300005544 Bacteria 96215
70 Ga0070686_100000521 3300005544 Bacteria 23054
71 Ga0070665_100000039 3300005548 Bacteria 306063
72 Ga0070665_100000208 3300005548 Bacteria 102367
73 Ga0070665_100009930 3300005548 Bacteria 9628
74 Ga0070665_100040148 3300005548 Bacteria 4704
75 Ga0070665_100116139 3300005548 Bacteria 2679
76 Ga0070665_100119459 3300005548 Bacteria 2638
77 Ga0070665_100182501 3300005548 Bacteria 2099
78 Ga0070665_100234766 3300005548 Bacteria 1834
79 Ga0070665_100270751 3300005548 Bacteria 1700
80 Ga0070665_100281256 3300005548 Bacteria 1666
81 Ga0070664_100001883 3300005564 Bacteria 16838
82 Ga0068857_100028704 3300005577 Bacteria 4909
83 Ga0068857_100111415 3300005577 Bacteria 2460
84 Ga0068856_100023860 3300005614 Bacteria 5950
85 Ga0068856_100212526 3300005614 Bacteria 1950
86 Ga0070702_100002227 3300005615 Bacteria 8274
87 Ga0070702_100104204 3300005615 Bacteria 1746
88 Ga0068852_100065942 3300005616 Bacteria 3160
89 Ga0068852_100173241 3300005616 Bacteria 2024
90 Ga0068859_100001116 3300005617 Bacteria 27403
91 Ga0068859_100005471 3300005617 Bacteria 12924
92 Ga0068859_100099873 3300005617 Bacteria 2957
93 Ga0068864_100021278 3300005618 Bacteria 5434
94 Ga0068864_100100479 3300005618 Bacteria 2564
95 Ga0068864_100103397 3300005618 Bacteria 2529
96 Ga0068866_10001536 3300005718 Bacteria 9803
97 Ga0068861_100002300 3300005719 Bacteria 12409
98 Ga0068861_100026433 3300005719 Bacteria 4219
99 Ga0068861_100071991 3300005719 Bacteria 2681
100 Ga0068863_100037211 3300005841 Bacteria 4634
101 Ga0068863_100090440 3300005841 Bacteria 2902
102 Ga0068858_100048619 3300005842 Bacteria 3928
103 Ga0068858_100120119 3300005842 Bacteria 2457
104 Ga0068860_100302884 3300005843 Bacteria 1566
105 Ga0068862_100032202 3300005844 Bacteria 4429
106 Ga0081539_10000546 3300005985 Bacteria 77546
107 Ga0070717_10128268 3300006028 Bacteria 2179
108 Ga0070717_10294301 3300006028 Bacteria 1442
109 Ga0075365_10001088 3300006038 Bacteria 11800
110 Ga0075365_10020310 3300006038 Bacteria 4116
111 Ga0075368_10031157 3300006042 Bacteria 2067
112 Ga0075363_100069488 3300006048 Bacteria 1911
113 Ga0075363_100069639 3300006048 Bacteria 1909
114 Ga0075363_100151249 3300006048 Bacteria 1310
115 Ga0075364_10016232 3300006051 Bacteria 4632
116 Ga0075362_10022238 3300006177 Bacteria 2670
117 Ga0075367_10003189 3300006178 Bacteria 7744
118 Ga0075367_10046491 3300006178 Bacteria 2550
119 Ga0075366_10001041 3300006195 Bacteria 13626
120 Ga0075366_10027282 3300006195 Bacteria 3349
121 Ga0075366_10044796 3300006195 Bacteria 2623
122 Ga0075366_10163101 3300006195 Bacteria 1351
123 Ga0097621_100012925 3300006237 Bacteria 6204
124 Ga0075370_10008744 3300006353 Bacteria 5224
125 Ga0075370_10019769 3300006353 Bacteria 3671
126 Ga0075370_10035162 3300006353 Bacteria 2811
127 Ga0068871_100078580 3300006358 Bacteria 2728
128 Ga0068871_100143978 3300006358 Bacteria 2028
129 Ga0075428_100040962 3300006844 Bacteria 5093
130 Ga0075431_100000768 3300006847 Bacteria 27809
131 Ga0075429_100023486 3300006880 Bacteria 5351
132 Ga0068865_100017812 3300006881 Bacteria 4574
133 Ga0068865_100200981 3300006881 Bacteria 1547
134 Ga0097620_100001116 3300006931 Bacteria 27403
135 Ga0097620_100005471 3300006931 Bacteria 12924
136 Ga0097620_100099875 3300006931 Bacteria 2957
137 Ga0097620_100174983 3300006931 Bacteria 2228
138 Ga0105240_10003711 3300009093 Bacteria 23604
139 Ga0105240_10005551 3300009093 Bacteria 18769
140 Ga0105240_10011618 3300009093 Bacteria 12246
141 Ga0105240_10038506 3300009093 Bacteria 6133
142 Ga0111539_10036253 3300009094 Bacteria 5965
143 Ga0111539_10204902 3300009094 Bacteria 2299
144 Ga0105245_10032949 3300009098 Bacteria 4588
145 Ga0105245_10133468 3300009098 Bacteria 2331
146 Ga0114129_10574465 3300009147 Bacteria 1463
147 Ga0105243_10008657 3300009148 Bacteria 7805
148 Ga0105243_10032897 3300009148 Bacteria 4008
149 Ga0105243_10172975 3300009148 Bacteria 1872
150 Ga0105242_10023570 3300009176 Bacteria 4850
151 Ga0105242_10303010 3300009176 Bacteria 1459
152 Ga0105248_10322701 3300009177 Bacteria 1739
153 Ga0105237_10121197 3300009545 Bacteria 2610
154 Ga0105238_10000043 3300009551 Bacteria 154120
155 Ga0105238_10000174 3300009551 Bacteria 70407
156 Ga0105238_10000516 3300009551 Bacteria 40563
157 Ga0105238_10001173 3300009551 Bacteria 26330
158 Ga0105238_10266279 3300009551 Bacteria 1694
159 Ga0105249_10021363 3300009553 Bacteria 5795
160 Ga0105239_10000507 3300010375 Bacteria 56420
161 Ga0105239_10033790 3300010375 Bacteria 5615
162 Ga0105239_10050132 3300010375 Bacteria 4579
163 Ga0105239_10116941 3300010375 Bacteria 2959
164 Ga0105239_10143800 3300010375 Bacteria 2659
165 Ga0105246_10099593 3300011119 Bacteria 2113
166 Ga0157371_10067973 3300013102 Bacteria 2522
167 Ga0157374_10078854 3300013296 Bacteria 3120
168 Ga0157378_10008114 3300013297 Bacteria 9162
169 Ga0157378_10014681 3300013297 Bacteria 6862
170 Ga0157378_10094509 3300013297 Bacteria 2722
171 Ga0157378_10316277 3300013297 Bacteria 1515
172 Ga0163162_10024137 3300013306 Bacteria 6001
173 Ga0163162_10030031 3300013306 Bacteria 5382
174 Ga0163162_10091794 3300013306 Bacteria 3120
175 Ga0163162_10112726 3300013306 Bacteria 2818
176 Ga0163162_10140217 3300013306 Bacteria 2531
177 Ga0157372_10000422 3300013307 Bacteria 46497
178 Ga0157372_10086278 3300013307 Bacteria 3561
179 Ga0157372_10602929 3300013307 Bacteria 1280
180 Ga0157375_10057145 3300013308 Bacteria 3856
181 Ga0157375_10108050 3300013308 Bacteria 2876
182 Ga0163163_10004475 3300014325 Bacteria 11923
183 Ga0163163_10162351 3300014325 Bacteria 2280
184 Ga0157380_10024894 3300014326 Bacteria 4534
185 Ga0157380_10259328 3300014326 Bacteria 1578
186 Ga0157377_10001026 3300014745 Bacteria 11802
187 Ga0157377_10016387 3300014745 Bacteria 3812
188 Ga0157377_10164332 3300014745 Bacteria 1383
189 Ga0157379_10108397 3300014968 Bacteria 2493
190 Ga0157376_10035524 3300014969 Bacteria 4032
191 Ga0157376_10043738 3300014969 Bacteria 3677
192 Ga0157376_10115024 3300014969 Bacteria 2374
193 Ga0163161_10028044 3300017792 Bacteria 3997
194 Ga0197907_10018712 3300020069 Bacteria 3588
195 Ga0206354_10790096 3300020081 Bacteria 2940
196 Ga0213874_10000797 3300021377 Bacteria 6409
197 Ga0213876_10034268 3300021384 Bacteria 2677
198 Ga0213875_10007213 3300021388 Bacteria 5764
199 Ga0213871_10005270 3300021441 Bacteria 2652
200 Ga0213871_10011553 3300021441 Bacteria 2030
201 Ga0224712_10005547 3300022467 Bacteria 3525
202 Ga0224712_10054417 3300022467 Bacteria 1571
203 Ga0209130_1000089 3300025284 Bacteria 152711
204 Ga0209676_1000049 3300025292 Bacteria 403210
205 Ga0209050_1005983 3300025298 Bacteria 7381
206 Ga0207426_1014828 3300025302 Bacteria 2847
207 Ga0207642_10002915 3300025899 Bacteria 5352
208 Ga0207688_10029085 3300025901 Bacteria 3040
209 Ga0207707_10007087 3300025912 Bacteria 9769
210 Ga0207695_10003576 3300025913 Bacteria 21756
211 Ga0207695_10006107 3300025913 Bacteria 15714
212 Ga0207695_10037694 3300025913 Bacteria 5214
213 Ga0207671_10079215 3300025914 Bacteria 2461
214 Ga0207657_10014670 3300025919 Bacteria 7635
215 Ga0207657_10103620 3300025919 Bacteria 2358
216 Ga0207649_10125191 3300025920 Bacteria 1738
217 Ga0207652_10031955 3300025921 Bacteria 4421
218 Ga0207652_10128601 3300025921 Bacteria 2257
219 Ga0207681_10030343 3300025923 Bacteria 3524
220 Ga0207694_10000065 3300025924 Bacteria 131061
221 Ga0207694_10001106 3300025924 Bacteria 23353
222 Ga0207694_10003606 3300025924 Bacteria 12262
223 Ga0207650_10062024 3300025925 Bacteria 2792
224 Ga0207659_10005113 3300025926 Bacteria 7952
225 Ga0207687_10032614 3300025927 Bacteria 3528
226 Ga0207687_10054483 3300025927 Bacteria 2798
227 Ga0207700_10375825 3300025928 Bacteria 1242
228 Ga0207664_10053209 3300025929 Bacteria 3203
229 Ga0207644_10031952 3300025931 Bacteria 3671
230 Ga0207644_10100910 3300025931 Bacteria 2168
231 Ga0207644_10141657 3300025931 Bacteria 1852
232 Ga0207706_10000659 3300025933 Bacteria 36314
233 Ga0207706_10006694 3300025933 Bacteria 10654
234 Ga0207686_10149868 3300025934 Bacteria 1623
235 Ga0207670_10059575 3300025936 Bacteria 2597
236 Ga0207670_10117506 3300025936 Bacteria 1927
237 Ga0207670_10122249 3300025936 Bacteria 1894
238 Ga0207669_10039309 3300025937 Bacteria 2732
239 Ga0207669_10040827 3300025937 Bacteria 2695
240 Ga0207669_10062472 3300025937 Bacteria 2294
241 Ga0207669_10205222 3300025937 Bacteria 1434
242 Ga0207704_10255406 3300025938 Bacteria 1318
243 Ga0207665_10018952 3300025939 Bacteria 4521
244 Ga0207691_10027847 3300025940 Bacteria 5296
245 Ga0207691_10041938 3300025940 Bacteria 4221
246 Ga0207711_10169331 3300025941 Bacteria 1981
247 Ga0207689_10005252 3300025942 Bacteria 11618
248 Ga0207689_10027351 3300025942 Bacteria 4775
249 Ga0207689_10049488 3300025942 Bacteria 3466
250 Ga0207689_10098612 3300025942 Bacteria 2401
251 Ga0207661_10004492 3300025944 Bacteria 9781
252 Ga0207661_10181410 3300025944 Bacteria 1839
253 Ga0207679_10138906 3300025945 Bacteria 1961
254 Ga0207667_10000056 3300025949 Bacteria 206107
255 Ga0207712_10013229 3300025961 Bacteria 5288
256 Ga0207712_10067515 3300025961 Bacteria 2560
257 Ga0207668_10048399 3300025972 Bacteria 2917
258 Ga0207668_10082244 3300025972 Bacteria 2339
259 Ga0207668_10138581 3300025972 Bacteria 1868
260 Ga0207668_10236597 3300025972 Bacteria 1475
261 Ga0207658_10018586 3300025986 Bacteria 4803
262 Ga0207677_10010951 3300026023 Bacteria 5151
263 Ga0207703_10031421 3300026035 Bacteria 4198
264 Ga0207703_10175939 3300026035 Bacteria 1885
265 Ga0207639_10069246 3300026041 Bacteria 2753
266 Ga0207678_10006159 3300026067 Bacteria 10669
267 Ga0207678_10021942 3300026067 Bacteria 5597
268 Ga0207678_10220713 3300026067 Bacteria 1623
269 Ga0207708_10024288 3300026075 Bacteria 4584
270 Ga0207708_10063018 3300026075 Bacteria 2832
271 Ga0207702_10130445 3300026078 Bacteria 2261
272 Ga0207641_10074211 3300026088 Bacteria 2933
273 Ga0207641_10074238 3300026088 Bacteria 2933
274 Ga0207648_10002549 3300026089 Bacteria 19533
275 Ga0207648_10002727 3300026089 Bacteria 18757
276 Ga0207676_10001652 3300026095 Bacteria 16425
277 Ga0207676_10092826 3300026095 Bacteria 2483
278 Ga0207674_10036894 3300026116 Bacteria 5087
279 Ga0207675_100003854 3300026118 Bacteria 14580
280 Ga0207675_100031589 3300026118 Bacteria 4933
281 Ga0207675_100085899 3300026118 Bacteria 2953
282 Ga0207683_10035490 3300026121 Bacteria 4337
283 Ga0207683_10049193 3300026121 Bacteria 3690
284 Ga0207683_10053801 3300026121 Bacteria 3530
285 Ga0207683_10074377 3300026121 Bacteria 3006
286 Ga0207683_10077977 3300026121 Bacteria 2935
287 Ga0207683_10136818 3300026121 Bacteria 2205
288 Ga0207698_10039280 3300026142 Bacteria 3505
289 Ga0207698_10070029 3300026142 Bacteria 2777
290 Ga0207698_10138478 3300026142 Bacteria 2092
291 Ga0207698_10221331 3300026142 Bacteria 1711
292 Ga0268266_10000128 3300028379 Bacteria 148961
293 Ga0268266_10000325 3300028379 Bacteria 75057
294 Ga0268266_10100253 3300028379 Bacteria 2551
295 Ga0268266_10125417 3300028379 Bacteria 2290
296 Ga0268265_10008874 3300028380 Bacteria 6795
297 Ga0268265_10093471 3300028380 Bacteria 2409
298 Ga0268264_10018135 3300028381 Bacteria 5756
299 Ga0268264_10367151 3300028381 Bacteria 1375
300 Ga0265334_10019420 3300028573 Bacteria 2796
301 Ga0307515_10239134 3300028794 Bacteria 1591
302 Ga0265332_10013593 3300031238 Bacteria 3606
303 Ga0265327_10002638 3300031251 Bacteria 18504
304 Ga0307405_10083627 3300031731 Bacteria 2093
305 Ga0307405_10216759 3300031731 Bacteria 1401
306 Ga0307413_10009491 3300031824 Bacteria 4661
307 Ga0307413_10225206 3300031824 Bacteria 1373
308 Ga0307410_10008592 3300031852 Bacteria 5674
309 Ga0307410_10108549 3300031852 Bacteria 2004
310 Ga0307407_10009797 3300031903 Bacteria 4483
311 Ga0307407_10137446 3300031903 Bacteria 1572
312 Ga0307409_100030860 3300031995 Bacteria 3858
313 Ga0307409_100112665 3300031995 Bacteria 2284
314 Ga0307409_100130646 3300031995 Bacteria 2145
315 Ga0307409_100325436 3300031995 Bacteria 1440
316 Ga0307411_10043378 3300032005 Bacteria 2877
317 Ga0307411_10116576 3300032005 Bacteria 1923
318 Ga0307415_100001415 3300032126 Bacteria 11469
319 Ga0373931_0081565 3300035691 Bacteria 1786
320 Ga0395899_0043803 3300037312 Bacteria 3336
321 Ga0395900_0025109 3300037418 Bacteria 6100
322 Ga0395905_0143764 3300037471 Bacteria 2244
323 Ga0436364_0460242 3300037853 Bacteria 2342
324 Ga0436364_0694451 3300037853 Bacteria 6440
325 Ga0395901_0014517 3300038443 Bacteria 8010
326 Ga0395901_0370813 3300038443 Bacteria 1475
327 Ga0436365_0000363 3300039437 Bacteria 1509
328 Ga0436365_0447799 3300039437 Bacteria 61454
329 Ga0436365_0780329 3300039437 Bacteria 13691
330 Ga0436360_0287066 3300039438 Bacteria 14235
331 Ga0436363_0145740 3300039450 Bacteria 8567
332 Ga0436362_0533387 3300039453 Bacteria 14227
333 Ga0439453_0003761 3300041408 Bacteria 2207
334 Ga0451807_0379999 3300041486 Bacteria 6936
335 Ga0451837_1549212 3300041494 Bacteria 1542
336 Ga0466969_0038462 3300044656 Bacteria 2407
337 Ga0466966_0061524 3300044684 Bacteria 2368
338 Ga0466961_0041063 3300044693 Bacteria 2965
339 Ga0466963_0127858 3300044694 Bacteria 1753
340 Ga0466964_0000867 3300044706 Bacteria 9902
341 Ga0466959_0020401 3300045049 Bacteria 4882
342 Ga0466959_0037384 3300045049 Bacteria 3587
343 Ga0466959_0045232 3300045049 Bacteria 3242
344 Ga0451576_0105608 3300045051 Bacteria 2930
345 Ga0466958_0049177 3300045836 Bacteria 2550
346 Ga0466958_0265115 3300045836 Bacteria 1100
347 Ga0495592_0156040 3300046454 Bacteria 1574
348 Ga0495603_0059947 3300046455 Bacteria 2249
349 Ga0495650_0001186 3300046471 Bacteria 27652
350 Ga0495639_0047669 3300046475 Bacteria 1942
351 Ga0495596_0045958 3300046500 Bacteria 1716
352 Ga0495608_0025729 3300046511 Bacteria 4018
353 Ga0495610_0054941 3300046512 Bacteria 1922
354 Ga0495628_0018271 3300046516 Bacteria 5813
355 Ga0495632_0101772 3300046519 Bacteria 1353
356 Ga0495643_0000203 3300046522 Bacteria 92549
357 Ga0495648_0083543 3300046524 Bacteria 1809
358 Ga0495648_0108801 3300046524 Bacteria 1513
359 Ga0495652_0010521 3300046529 Bacteria 8382
360 Ga0495587_0018269 3300046536 Bacteria 4350
361 Ga0495598_0039668 3300046537 Bacteria 1370
362 Ga0495621_0000077 3300046539 Bacteria 19813
363 Ga0495667_0008837 3300046559 Bacteria 6850
364 Ga0495625_0020908 3300046660 Bacteria 5045
365 Ga0495635_0014600 3300046663 Bacteria 5494
366 Ga0495588_0002342 3300046674 Bacteria 8112
367 Ga0495657_0001221 3300046675 Bacteria 22566
368 Ga0495599_0008694 3300046678 Bacteria 6181
369 Ga0495599_0109820 3300046678 Bacteria 1718
370 Ga0495646_0004704 3300046680 Bacteria 8603
371 Ga0495669_0067490 3300046684 Bacteria 1626
372 Ga0495671_0048665 3300046692 Bacteria 2115
373 Ga0495589_0046824 3300046794 Bacteria 2145
374 Ga0495600_0001187 3300046809 Bacteria 14257
375 Ga0495660_0108198 3300046810 Bacteria 1422
376 Ga0495604_0001041 3300047317 Bacteria 23066
377 Ga0495674_0029094 3300047319 Bacteria 5033
378 Ga0495680_0000463 3300047322 Bacteria 45632
379 Ga0495686_0008255 3300047472 Bacteria 7670
380 Ga0495602_0004605 3300048088 Bacteria 14387
381 Ga0496100_0040358 3300048903 Bacteria 2969
382 Ga0496101_0140826 3300048904 Bacteria 1838
383 Ga0496102_0082274 3300048905 Bacteria 2969
384 Ga0496103_0076978 3300048906 Bacteria 2094
385 Ga0496105_0126237 3300048908 Bacteria 2109
386 Ga0496106_0109074 3300048909 Bacteria 2153
387 Ga0496107_0148881 3300048910 Bacteria 1731
388 Ga0496108_0015427 3300048911 Bacteria 6232
389 Ga0496108_0291283 3300048911 Bacteria 1421
390 Ga0496110_0013129 3300048913 Bacteria 6839
391 Ga0496110_0208741 3300048913 Bacteria 1775
392 Ga0496111_0116719 3300048914 Bacteria 1969
393 Ga0496112_0014070 3300048915 Bacteria 7408
394 Ga0496112_0253781 3300048915 Bacteria 1709
395 Ga0496115_0309470 3300048918 Bacteria 1293
396 Ga0496121_0007011 3300048924 Bacteria 13688
397 Ga0496121_0034623 3300048924 Bacteria 4544
398 Ga0496121_0142887 3300048924 Bacteria 1773
399 Ga0496122_0000996 3300048925 Bacteria 50450
400 Ga0496122_0050995 3300048925 Bacteria 3150
401 Ga0496123_0003880 3300048926 Bacteria 16266
402 Ga0496124_0000003 3300048927 Bacteria 1300161
403 Ga0496126_0054382 3300048929 Bacteria 3626
404 Ga0496126_0079755 3300048929 Bacteria 2898
405 Ga0496126_0099985 3300048929 Bacteria 2539
406 Ga0501032_0000154 3300049569 Bacteria 55570
407 Ga0501033_0005849 3300049570 Bacteria 9667
408 Ga0501034_0000618 3300049571 Bacteria 55711
409 Ga0501034_0008528 3300049571 Bacteria 10817
410 Ga0501034_0072987 3300049571 Bacteria 3440
411 Ga0501034_0100967 3300049571 Plasmid 2879
412 Ga0501036_0000894 3300049572 Bacteria 22309
413 Ga0501037_0000345 3300049573 Bacteria 39172
414 Ga0501038_0000104 3300049574 Bacteria 70771
415 Ga0501038_0002397 3300049574 Bacteria 17462
416 Ga0501038_0314155 3300049574 Bacteria 1227
417 Ga0501039_0000027 3300049575 Bacteria 150215
418 Ga0501040_0028992 3300049576 Bacteria 3734
419 Ga0501041_0010224 3300049577 Bacteria 5531
420 Ga0501043_0033532 3300049579 Bacteria 4040
421 Ga0501046_0079591 3300049580 Bacteria 2533
422 Ga0501047_0043168 3300049581 Bacteria 4355
423 Ga0501047_0144120 3300049581 Bacteria 2260
424 Ga0501070_0367686 3300049586 Bacteria 1166
425 Ga0501072_0011653 3300049588 Bacteria 6716
426 Ga0501239_002424 3300049672 Bacteria 1690
427 Ga0501249_036687 3300049679 Bacteria 1105
428 Ga0501268_002125 3300049765 Bacteria 2575
429 Ga0501035_0000217 3300049822 Bacteria 68667
430 Ga0501035_0069040 3300049822 Bacteria 3133
431 Ga0501044_0107092 3300049823 Bacteria 2807
432 Ga0501044_0110300 3300049823 Bacteria 2760
433 nmdc:mga03683_64846_c1 3300050489 Bacteria 1551
434 nmdc:mga0yw44_128347_c1 3300050492 Bacteria 1639
435 nmdc:mga0yw44_213774_c1 3300050492 Bacteria 1276
436 nmdc:mga0yw44_259_c1 3300050492 Bacteria 18064
437 nmdc:mga0yw44_49670_c1 3300050492 Bacteria 2533
438 nmdc:mga0yw44_55554_c1 3300050492 Bacteria 1802
439 nmdc:mga0k408_865_c1 3300050493 Bacteria 16667
440 nmdc:mga06z11_147946_c1 3300050494 Bacteria 1333
441 nmdc:mga06z11_16743_c1 3300050494 Bacteria 3309
442 nmdc:mga06z11_7187_c1 3300050494 Bacteria 4571
443 nmdc:mga06z11_7510_c1 3300050494 Bacteria 4489
444 nmdc:mga06z11_79246_c1 3300050494 Bacteria 1758
445 nmdc:mga07m45_122686_c1 3300050496 Bacteria 1501
446 nmdc:mga07m45_35640_c1 3300050496 Bacteria 2768
447 nmdc:mga07m45_44417_c1 3300050496 Bacteria 2494
448 nmdc:mga07m45_998_c1 3300050496 Bacteria 12497
449 nmdc:mga05p37_6679_c1 3300050507 Bacteria 13602
450 nmdc:mga09592_31300_c1 3300050508 Bacteria 4433
451 nmdc:mga06r32_102312_c1 3300050510 Bacteria 2812
452 nmdc:mga06r32_1672_c1 3300050510 Bacteria 20023
453 nmdc:mga08y16_181528_c1 3300050511 Bacteria 2185
454 Ga0495601_0005610 3300053077 Bacteria 7316
455 Ga0495612_0003363 3300053078 Bacteria 6627
456 Ga0495619_0011619 3300053085 Bacteria 5548
457 Ga0495619_0025750 3300053085 Bacteria 3780
458 Ga0495619_0053546 3300053085 Bacteria 2670
459 Ga0500646_0002366 3300053090 Bacteria 4897
460 Ga0500641_0008270 3300053096 Bacteria 3712
461 Ga0500628_001228 3300053129 Bacteria 4427
462 Ga0500658_0008281 3300053134 Bacteria 3842
463 Ga0500577_0094156 3300053142 Bacteria 1215
464 Ga0500616_0000761 3300053153 Bacteria 37071
465 Ga0500633_0003205 3300053160 Bacteria 3522
466 Ga0500611_000549 3300053727 Bacteria 3802
467 Ga0501084_0013932 3300054114 Bacteria 6656
468 Ga0501084_0137119 3300054114 Bacteria 2060
469 Ga0500661_000297 3300055283 Bacteria 9030
470 Ga0466962_0024273 3300061719 Bacteria 2913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0253781 Ga0496112_0253781_663_1676 336
2 3300044694 Ga0466963_0127858 Ga0466963_0127858_706_1740 338
3 3300046524 Ga0495648_0083543 Ga0495648_0083543_75_1109 338
4 3300049679 Ga0501249_036687 Ga0501249_036687_26_1048 338
5 3300041494 Ga0451837_1549212 Ga0451837_1549212_471_1499 340
6 3300049581 Ga0501047_0043168 Ga0501047_0043168_53_1081 340
7 3300045836 Ga0466958_0265115 Ga0466958_0265115_16_1047 341
8 3300049574 Ga0501038_0314155 Ga0501038_0314155_33_1067 341
9 3300031824 Ga0307413_10009491 Ga0307413_100094913 356
10 3300049586 Ga0501070_0367686 Ga0501070_0367686_57_1145 361
11 3300014969 Ga0157376_10043738 Ga0157376_100437384 362
12 3300048903 Ga0496100_0040358 Ga0496100_0040358_989_2101 368
13 3300046692 Ga0495671_0048665 Ga0495671_0048665_29_1144 369
14 3300005548 Ga0070665_100000039 Ga0070665_10000003951 370
15 3300028379 Ga0268266_10000128 Ga0268266_1000012820 370
16 iso_pu_bacteria 2857737099 2857738518 371
17 3300009551 Ga0105238_10000174 Ga0105238_1000017413 372
18 3300037853 Ga0436364_0694451 Ga0436364_0694451_598_1722 372
19 3300039437 Ga0436365_0780329 Ga0436365_0780329_5441_6565 372
20 3300039438 Ga0436360_0287066 Ga0436360_0287066_4865_5989 372
21 3300039450 Ga0436363_0145740 Ga0436363_0145740_4183_5307 372
22 3300039453 Ga0436362_0533387 Ga0436362_0533387_8520_9644 372
23 3300013306 Ga0163162_10024137 Ga0163162_100241375 373
24 3300005617 Ga0068859_100005471 Ga0068859_10000547112 375
25 3300006931 Ga0097620_100005471 Ga0097620_10000547112 375
26 3300031731 Ga0307405_10083627 Ga0307405_100836271 375
27 3300031852 Ga0307410_10008592 Ga0307410_100085928 375
28 3300031903 Ga0307407_10009797 Ga0307407_100097976 375
29 3300031995 Ga0307409_100030860 Ga0307409_1000308605 375
30 3300032005 Ga0307411_10043378 Ga0307411_100433782 375
31 3300032126 Ga0307415_100001415 Ga0307415_1000014156 375
32 3300046471 Ga0495650_0001186 Ga0495650_0001186_18039_19214 375
33 3300048924 Ga0496121_0034623 Ga0496121_0034623_3077_4210 375
34 3300054114 Ga0501084_0137119 Ga0501084_0137119_890_2023 375
35 3300028794 Ga0307515_10239134 Ga0307515_102391342 376
36 3300005444 Ga0070694_100003266 Ga0070694_1000032662 378
37 3300005614 Ga0068856_100023860 Ga0068856_1000238606 378
38 3300044684 Ga0466966_0061524 Ga0466966_0061524_102_1241 378
39 3300045049 Ga0466959_0020401 Ga0466959_0020401_1424_2563 378
40 3300045836 Ga0466958_0049177 Ga0466958_0049177_760_1899 378
41 3300049576 Ga0501040_0028992 Ga0501040_0028992_887_2071 378
42 3300049577 Ga0501041_0010224 Ga0501041_0010224_1831_3015 378
43 3300061719 Ga0466962_0024273 Ga0466962_0024273_1150_2289 378
44 3300048925 Ga0496122_0050995 Ga0496122_0050995_579_1754 381
45 3300053090 Ga0500646_0002366 Ga0500646_0002366_392_1546 382
46 3300009093 Ga0105240_10011618 Ga0105240_100116184 383
47 3300009545 Ga0105237_10121197 Ga0105237_101211972 383
48 3300009551 Ga0105238_10000516 Ga0105238_1000051626 383
49 3300013307 Ga0157372_10000422 Ga0157372_1000042222 383
50 3300025914 Ga0207671_10079215 Ga0207671_100792152 383
51 3300045049 Ga0466959_0045232 Ga0466959_0045232_865_2022 383
52 iso_pu_bacteria 8045864390 8045866416 383
53 3300031852 Ga0307410_10108549 Ga0307410_101085492 384
54 3300031995 Ga0307409_100130646 Ga0307409_1001306462 384
55 iso_pu_bacteria 2643221547 2643754536 384
56 iso_pu_bacteria 2643221736 2644743687 384
57 iso_pu_bacteria 2643221736 2644745646 384
58 iso_pu_bacteria 2841760612 2841766743 384
59 iso_pu_bacteria 2841911363 2841911604 384
60 iso_pu_bacteria 2841917233 2841917715 384
61 iso_pu_bacteria 2844104063 2844105201 384
62 iso_pu_bacteria 2851182111 2851184019 384
63 iso_pu_bacteria 2851246043 2851252160 384
64 iso_pu_bacteria 2856320880 2856325248 384
65 iso_pu_bacteria 2874139085 2874139979 384
66 iso_pu_bacteria 2929199973 2929206188 384
67 iso_pu_bacteria 2937972304 2937976334 384
68 iso_pu_bacteria 2958034702 2958038725 384
69 iso_pu_bacteria 2968016561 2968019207 384
70 iso_pu_bacteria 2970469710 2970472568 384
71 iso_pu_bacteria 2996336353 2996341356 384
72 iso_pu_bacteria 2996348954 2996355217 384
73 iso_pu_bacteria 3004275668 3004281751 384
74 iso_pu_bacteria 641228493 641337480 384
75 iso_pu_bacteria 643348555 643392368 384
76 iso_pu_bacteria 8057529695 8057532613 384
77 iso_pu_bacteria 2528768022 2528857975 385
78 iso_pu_bacteria 2824661429 2824669365 385
79 iso_pu_bacteria 2842333319 2842339961 385
80 iso_pu_bacteria 2888388044 2888393367 385
81 iso_pu_bacteria 2889033259 2889033316 385
82 iso_pu_bacteria 2889033259 2889039204 385
83 iso_pu_bacteria 2946787523 2946789141 385
84 iso_pu_bacteria 2990265787 2990269276 385
85 iso_pu_bacteria 2993693658 2993697381 385
86 3300005334 Ga0068869_100040593 Ga0068869_1000405934 386
87 3300005353 Ga0070669_100192666 Ga0070669_1001926662 386
88 3300005441 Ga0070700_100026337 Ga0070700_1000263373 386
89 3300005718 Ga0068866_10001536 Ga0068866_100015369 386
90 3300009553 Ga0105249_10021363 Ga0105249_100213634 386
91 3300010375 Ga0105239_10033790 Ga0105239_100337903 386
92 3300013306 Ga0163162_10112726 Ga0163162_101127264 386
93 3300014968 Ga0157379_10108397 Ga0157379_101083972 386
94 3300025899 Ga0207642_10002915 Ga0207642_100029152 386
95 3300025942 Ga0207689_10027351 Ga0207689_100273512 386
96 3300025972 Ga0207668_10048399 Ga0207668_100483993 386
97 3300005290 Ga0065712_10070823 Ga0065712_100708236 387
98 3300005330 Ga0070690_100059484 Ga0070690_1000594842 387
99 3300005331 Ga0070670_100025846 Ga0070670_1000258462 387
100 3300005334 Ga0068869_100006515 Ga0068869_1000065157 387
101 3300005338 Ga0068868_100023233 Ga0068868_1000232336 387
102 3300005340 Ga0070689_100000555 Ga0070689_10000055514 387
103 3300005343 Ga0070687_100083275 Ga0070687_1000832752 387
104 3300005344 Ga0070661_100010423 Ga0070661_1000104232 387
105 3300005353 Ga0070669_100043513 Ga0070669_1000435133 387
106 3300005354 Ga0070675_100002990 Ga0070675_1000029907 387
107 3300005355 Ga0070671_100015416 Ga0070671_1000154167 387
108 3300005365 Ga0070688_100004603 Ga0070688_1000046036 387
109 3300005406 Ga0070703_10021979 Ga0070703_100219792 387
110 3300005440 Ga0070705_100040004 Ga0070705_1000400043 387
111 3300005456 Ga0070678_100020702 Ga0070678_1000207024 387
112 3300005466 Ga0070685_10002694 Ga0070685_100026945 387
113 3300005535 Ga0070684_100030256 Ga0070684_1000302566 387
114 3300005543 Ga0070672_100009876 Ga0070672_1000098763 387
115 3300005544 Ga0070686_100000521 Ga0070686_1000005216 387
116 3300005548 Ga0070665_100009930 Ga0070665_1000099304 387
117 3300005564 Ga0070664_100001883 Ga0070664_1000018837 387
118 3300005615 Ga0070702_100002227 Ga0070702_1000022276 387
119 3300005617 Ga0068859_100001116 Ga0068859_1000011167 387
120 3300005618 Ga0068864_100021278 Ga0068864_1000212786 387
121 3300005719 Ga0068861_100002300 Ga0068861_10000230011 387
122 3300005842 Ga0068858_100120119 Ga0068858_1001201191 387
123 3300006237 Ga0097621_100012925 Ga0097621_1000129254 387
124 3300006358 Ga0068871_100143978 Ga0068871_1001439782 387
125 3300006931 Ga0097620_100001116 Ga0097620_1000011167 387
126 3300009094 Ga0111539_10204902 Ga0111539_102049023 387
127 3300009148 Ga0105243_10172975 Ga0105243_101729752 387
128 3300009177 Ga0105248_10322701 Ga0105248_103227012 387
129 3300013306 Ga0163162_10030031 Ga0163162_100300315 387
130 3300013306 Ga0163162_10091794 Ga0163162_100917944 387
131 3300014325 Ga0163163_10004475 Ga0163163_100044758 387
132 3300014745 Ga0157377_10001026 Ga0157377_100010266 387
133 3300025923 Ga0207681_10030343 Ga0207681_100303433 387
134 3300025925 Ga0207650_10062024 Ga0207650_100620242 387
135 3300025926 Ga0207659_10005113 Ga0207659_100051134 387
136 3300025931 Ga0207644_10031952 Ga0207644_100319525 387
137 3300025936 Ga0207670_10117506 Ga0207670_101175061 387
138 3300025938 Ga0207704_10255406 Ga0207704_102554061 387
139 3300025940 Ga0207691_10027847 Ga0207691_100278473 387
140 3300025941 Ga0207711_10169331 Ga0207711_101693312 387
141 3300025942 Ga0207689_10005252 Ga0207689_100052527 387
142 3300025945 Ga0207679_10138906 Ga0207679_101389062 387
143 3300025961 Ga0207712_10013229 Ga0207712_100132296 387
144 3300025986 Ga0207658_10018586 Ga0207658_100185866 387
145 3300026023 Ga0207677_10010951 Ga0207677_100109513 387
146 3300026035 Ga0207703_10031421 Ga0207703_100314214 387
147 3300026075 Ga0207708_10063018 Ga0207708_100630181 387
148 3300026088 Ga0207641_10074211 Ga0207641_100742114 387
149 3300026089 Ga0207648_10002549 Ga0207648_1000254912 387
150 3300026095 Ga0207676_10001652 Ga0207676_100016524 387
151 3300026118 Ga0207675_100003854 Ga0207675_10000385412 387
152 3300026121 Ga0207683_10053801 Ga0207683_100538014 387
153 3300026142 Ga0207698_10070029 Ga0207698_100700292 387
154 3300028379 Ga0268266_10100253 Ga0268266_101002532 387
155 3300028380 Ga0268265_10093471 Ga0268265_100934713 387
156 3300028381 Ga0268264_10018135 Ga0268264_100181355 387
157 3300028573 Ga0265334_10019420 Ga0265334_100194202 387
158 3300035691 Ga0373931_0081565 Ga0373931_0081565_479_1645 387
159 3300038443 Ga0395901_0370813 Ga0395901_0370813_144_1313 387
160 3300044656 Ga0466969_0038462 Ga0466969_0038462_1097_2266 387
161 3300045051 Ga0451576_0105608 Ga0451576_0105608_1029_2195 387
162 3300048911 Ga0496108_0291283 Ga0496108_0291283_225_1391 387
163 3300049581 Ga0501047_0144120 Ga0501047_0144120_1059_2225 387
164 3300050511 nmdc:mga08y16_181528_c1 nmdc:mga08y16_181528_c1_312_1478 387
165 3300000549 LJQas_1000088 LJQas_10000889 388
166 3300002987 JGI25159J45721_1000859 JGI25159J45721_10008594 388
167 3300003693 Ga0032354_1083202 Ga0032354_10832022 388
168 3300004803 Ga0058862_12774351 Ga0058862_127743512 388
169 3300005262 Ga0065165_1000044 Ga0065165_100004482 388
170 3300005343 Ga0070687_100142021 Ga0070687_1001420211 388
171 3300005356 Ga0070674_100040051 Ga0070674_1000400512 388
172 3300005466 Ga0070685_10000885 Ga0070685_100008854 388
173 3300005548 Ga0070665_100000208 Ga0070665_10000020864 388
174 3300005548 Ga0070665_100281256 Ga0070665_1002812562 388
175 3300005841 Ga0068863_100090440 Ga0068863_1000904402 388
176 3300005985 Ga0081539_10000546 Ga0081539_1000054637 388
177 3300006028 Ga0070717_10128268 Ga0070717_101282682 388
178 3300006844 Ga0075428_100040962 Ga0075428_1000409624 388
179 3300006847 Ga0075431_100000768 Ga0075431_10000076816 388
180 3300006880 Ga0075429_100023486 Ga0075429_1000234865 388
181 3300009094 Ga0111539_10036253 Ga0111539_100362532 388
182 3300009147 Ga0114129_10574465 Ga0114129_105744651 388
183 3300009551 Ga0105238_10001173 Ga0105238_1000117313 388
184 3300009551 Ga0105238_10266279 Ga0105238_102662792 388
185 3300010375 Ga0105239_10050132 Ga0105239_100501322 388
186 3300013296 Ga0157374_10078854 Ga0157374_100788542 388
187 3300013297 Ga0157378_10014681 Ga0157378_100146815 388
188 3300014745 Ga0157377_10016387 Ga0157377_100163875 388
189 3300021377 Ga0213874_10000797 Ga0213874_100007973 388
190 3300021384 Ga0213876_10034268 Ga0213876_100342683 388
191 3300021388 Ga0213875_10007213 Ga0213875_100072132 388
192 3300021441 Ga0213871_10011553 Ga0213871_100115532 388
193 3300022467 Ga0224712_10054417 Ga0224712_100544172 388
194 3300025284 Ga0209130_1000089 Ga0209130_100008934 388
195 3300025302 Ga0207426_1014828 Ga0207426_10148283 388
196 3300025924 Ga0207694_10001106 Ga0207694_1000110617 388
197 3300025928 Ga0207700_10375825 Ga0207700_103758251 388
198 3300025936 Ga0207670_10122249 Ga0207670_101222492 388
199 3300025937 Ga0207669_10062472 Ga0207669_100624722 388
200 3300025972 Ga0207668_10082244 Ga0207668_100822441 388
201 3300026088 Ga0207641_10074238 Ga0207641_100742382 388
202 3300028379 Ga0268266_10000325 Ga0268266_1000032545 388
203 3300031251 Ga0265327_10002638 Ga0265327_1000263811 388
204 3300031824 Ga0307413_10225206 Ga0307413_102252061 388
205 3300031903 Ga0307407_10137446 Ga0307407_101374462 388
206 3300039437 Ga0436365_0447799 Ga0436365_0447799_31146_32366 388
207 3300041486 Ga0451807_0379999 Ga0451807_0379999_3136_4308 388
208 3300045049 Ga0466959_0037384 Ga0466959_0037384_1594_2853 388
209 3300046455 Ga0495603_0059947 Ga0495603_0059947_70_1263 388
210 3300046475 Ga0495639_0047669 Ga0495639_0047669_295_1488 388
211 3300046512 Ga0495610_0054941 Ga0495610_0054941_151_1326 388
212 3300046519 Ga0495632_0101772 Ga0495632_0101772_28_1203 388
213 3300046537 Ga0495598_0039668 Ga0495598_0039668_160_1353 388
214 3300046660 Ga0495625_0020908 Ga0495625_0020908_2293_3468 388
215 3300046678 Ga0495599_0109820 Ga0495599_0109820_449_1618 388
216 3300047472 Ga0495686_0008255 Ga0495686_0008255_490_1665 388
217 3300048924 Ga0496121_0142887 Ga0496121_0142887_484_1653 388
218 3300048925 Ga0496122_0000996 Ga0496122_0000996_38099_39274 388
219 3300048926 Ga0496123_0003880 Ga0496123_0003880_12536_13711 388
220 3300049569 Ga0501032_0000154 Ga0501032_0000154_52897_54072 388
221 3300049570 Ga0501033_0005849 Ga0501033_0005849_1449_2624 388
222 3300049571 Ga0501034_0000618 Ga0501034_0000618_53025_54200 388
223 3300049571 Ga0501034_0008528 Ga0501034_0008528_30_1202 388
224 3300049571 Ga0501034_0100967 Ga0501034_0100967_333_1505 388
225 3300049572 Ga0501036_0000894 Ga0501036_0000894_1426_2601 388
226 3300049573 Ga0501037_0000345 Ga0501037_0000345_36485_37660 388
227 3300049574 Ga0501038_0000104 Ga0501038_0000104_1512_2687 388
228 3300049574 Ga0501038_0002397 Ga0501038_0002397_8607_9782 388
229 3300049575 Ga0501039_0000027 Ga0501039_0000027_1512_2687 388
230 3300049579 Ga0501043_0033532 Ga0501043_0033532_1501_2676 388
231 3300049580 Ga0501046_0079591 Ga0501046_0079591_1052_2227 388
232 3300049588 Ga0501072_0011653 Ga0501072_0011653_5286_6458 388
233 3300049822 Ga0501035_0000217 Ga0501035_0000217_65981_67156 388
234 3300049822 Ga0501035_0069040 Ga0501035_0069040_149_1324 388
235 3300049823 Ga0501044_0107092 Ga0501044_0107092_726_1901 388
236 3300049823 Ga0501044_0110300 Ga0501044_0110300_113_1288 388
237 3300050508 nmdc:mga09592_31300_c1 nmdc:mga09592_31300_c1_1336_2508 388
238 3300050510 nmdc:mga06r32_1672_c1 nmdc:mga06r32_1672_c1_8973_10145 388
239 3300053077 Ga0495601_0005610 Ga0495601_0005610_6095_7264 388
240 3300053085 Ga0495619_0011619 Ga0495619_0011619_4346_5515 388
241 3300053134 Ga0500658_0008281 Ga0500658_0008281_2102_3277 388
242 3300053153 Ga0500616_0000761 Ga0500616_0000761_33523_34692 388
243 3300053160 Ga0500633_0003205 Ga0500633_0003205_887_2056 388
244 3300053727 Ga0500611_000549 Ga0500611_000549_475_1650 388
245 3300054114 Ga0501084_0013932 Ga0501084_0013932_1400_2572 388
246 3300002244 JGI24742J22300_10001183 JGI24742J22300_100011833 389
247 3300003215 JGI25153J46596_10015410 JGI25153J46596_100154102 389
248 3300003693 Ga0032354_1050675 Ga0032354_10506751 389
249 3300003693 Ga0032354_1067747 Ga0032354_10677472 389
250 3300005331 Ga0070670_100023937 Ga0070670_1000239376 389
251 3300005331 Ga0070670_100157602 Ga0070670_1001576022 389
252 3300005334 Ga0068869_100064256 Ga0068869_1000642562 389
253 3300005336 Ga0070680_100009120 Ga0070680_1000091204 389
254 3300005336 Ga0070680_100105163 Ga0070680_1001051632 389
255 3300005337 Ga0070682_100201261 Ga0070682_1002012611 389
256 3300005338 Ga0068868_100108773 Ga0068868_1001087731 389
257 3300005340 Ga0070689_100029557 Ga0070689_1000295572 389
258 3300005344 Ga0070661_100055408 Ga0070661_1000554083 389
259 3300005347 Ga0070668_100009307 Ga0070668_1000093078 389
260 3300005354 Ga0070675_100025740 Ga0070675_1000257403 389
261 3300005354 Ga0070675_100156175 Ga0070675_1001561752 389
262 3300005355 Ga0070671_100117591 Ga0070671_1001175912 389
263 3300005356 Ga0070674_100006620 Ga0070674_1000066202 389
264 3300005356 Ga0070674_100079208 Ga0070674_1000792082 389
265 3300005364 Ga0070673_100041523 Ga0070673_1000415233 389
266 3300005366 Ga0070659_100076281 Ga0070659_1000762812 389
267 3300005438 Ga0070701_10021629 Ga0070701_100216294 389
268 3300005455 Ga0070663_100185899 Ga0070663_1001858991 389
269 3300005456 Ga0070678_100106314 Ga0070678_1001063143 389
270 3300005456 Ga0070678_100139813 Ga0070678_1001398131 389
271 3300005456 Ga0070678_100267487 Ga0070678_1002674871 389
272 3300005457 Ga0070662_100001353 Ga0070662_10000135319 389
273 3300005457 Ga0070662_100001949 Ga0070662_10000194911 389
274 3300005458 Ga0070681_10006359 Ga0070681_100063596 389
275 3300005459 Ga0068867_100016933 Ga0068867_1000169334 389
276 3300005466 Ga0070685_10001062 Ga0070685_100010626 389
277 3300005466 Ga0070685_10025161 Ga0070685_100251612 389
278 3300005530 Ga0070679_100007317 Ga0070679_1000073174 389
279 3300005530 Ga0070679_100148179 Ga0070679_1001481792 389
280 3300005539 Ga0068853_100001675 Ga0068853_1000016757 389
281 3300005543 Ga0070672_100033730 Ga0070672_1000337304 389
282 3300005544 Ga0070686_100000052 Ga0070686_10000005237 389
283 3300005548 Ga0070665_100040148 Ga0070665_1000401482 389
284 3300005548 Ga0070665_100116139 Ga0070665_1001161394 389
285 3300005548 Ga0070665_100119459 Ga0070665_1001194591 389
286 3300005548 Ga0070665_100182501 Ga0070665_1001825012 389
287 3300005548 Ga0070665_100234766 Ga0070665_1002347661 389
288 3300005548 Ga0070665_100270751 Ga0070665_1002707512 389
289 3300005577 Ga0068857_100028704 Ga0068857_1000287042 389
290 3300005577 Ga0068857_100111415 Ga0068857_1001114152 389
291 3300005614 Ga0068856_100212526 Ga0068856_1002125262 389
292 3300005615 Ga0070702_100104204 Ga0070702_1001042042 389
293 3300005616 Ga0068852_100065942 Ga0068852_1000659421 389
294 3300005616 Ga0068852_100173241 Ga0068852_1001732412 389
295 3300005617 Ga0068859_100099873 Ga0068859_1000998731 389
296 3300005618 Ga0068864_100100479 Ga0068864_1001004792 389
297 3300005618 Ga0068864_100103397 Ga0068864_1001033972 389
298 3300005719 Ga0068861_100026433 Ga0068861_1000264336 389
299 3300005719 Ga0068861_100071991 Ga0068861_1000719913 389
300 3300005841 Ga0068863_100037211 Ga0068863_1000372112 389
301 3300005842 Ga0068858_100048619 Ga0068858_1000486196 389
302 3300005843 Ga0068860_100302884 Ga0068860_1003028842 389
303 3300005844 Ga0068862_100032202 Ga0068862_1000322026 389
304 3300006028 Ga0070717_10294301 Ga0070717_102943011 389
305 3300006038 Ga0075365_10001088 Ga0075365_100010889 389
306 3300006038 Ga0075365_10020310 Ga0075365_100203104 389
307 3300006042 Ga0075368_10031157 Ga0075368_100311571 389
308 3300006048 Ga0075363_100069488 Ga0075363_1000694881 389
309 3300006048 Ga0075363_100069639 Ga0075363_1000696392 389
310 3300006048 Ga0075363_100151249 Ga0075363_1001512491 389
311 3300006051 Ga0075364_10016232 Ga0075364_100162323 389
312 3300006177 Ga0075362_10022238 Ga0075362_100222382 389
313 3300006178 Ga0075367_10003189 Ga0075367_100031899 389
314 3300006178 Ga0075367_10046491 Ga0075367_100464912 389
315 3300006195 Ga0075366_10001041 Ga0075366_100010417 389
316 3300006195 Ga0075366_10027282 Ga0075366_100272821 389
317 3300006195 Ga0075366_10044796 Ga0075366_100447962 389
318 3300006195 Ga0075366_10163101 Ga0075366_101631011 389
319 3300006353 Ga0075370_10008744 Ga0075370_100087449 389
320 3300006353 Ga0075370_10019769 Ga0075370_100197693 389
321 3300006353 Ga0075370_10035162 Ga0075370_100351625 389
322 3300006358 Ga0068871_100078580 Ga0068871_1000785802 389
323 3300006881 Ga0068865_100017812 Ga0068865_1000178128 389
324 3300006881 Ga0068865_100200981 Ga0068865_1002009812 389
325 3300006931 Ga0097620_100099875 Ga0097620_1000998751 389
326 3300006931 Ga0097620_100174983 Ga0097620_1001749832 389
327 3300009093 Ga0105240_10003711 Ga0105240_1000371124 389
328 3300009093 Ga0105240_10005551 Ga0105240_100055519 389
329 3300009093 Ga0105240_10038506 Ga0105240_100385064 389
330 3300009098 Ga0105245_10032949 Ga0105245_100329494 389
331 3300009098 Ga0105245_10133468 Ga0105245_101334682 389
332 3300009148 Ga0105243_10008657 Ga0105243_100086574 389
333 3300009148 Ga0105243_10032897 Ga0105243_100328973 389
334 3300009176 Ga0105242_10023570 Ga0105242_100235702 389
335 3300009176 Ga0105242_10303010 Ga0105242_103030101 389
336 3300009551 Ga0105238_10000043 Ga0105238_1000004340 389
337 3300010375 Ga0105239_10000507 Ga0105239_1000050748 389
338 3300010375 Ga0105239_10116941 Ga0105239_101169412 389
339 3300010375 Ga0105239_10143800 Ga0105239_101438002 389
340 3300011119 Ga0105246_10099593 Ga0105246_100995931 389
341 3300013102 Ga0157371_10067973 Ga0157371_100679731 389
342 3300013297 Ga0157378_10008114 Ga0157378_100081146 389
343 3300013297 Ga0157378_10094509 Ga0157378_100945094 389
344 3300013297 Ga0157378_10316277 Ga0157378_103162771 389
345 3300013306 Ga0163162_10140217 Ga0163162_101402172 389
346 3300013307 Ga0157372_10086278 Ga0157372_100862782 389
347 3300013307 Ga0157372_10602929 Ga0157372_106029291 389
348 3300013308 Ga0157375_10057145 Ga0157375_100571452 389
349 3300013308 Ga0157375_10108050 Ga0157375_101080503 389
350 3300014325 Ga0163163_10162351 Ga0163163_101623512 389
351 3300014326 Ga0157380_10024894 Ga0157380_100248944 389
352 3300014326 Ga0157380_10259328 Ga0157380_102593282 389
353 3300014745 Ga0157377_10164332 Ga0157377_101643321 389
354 3300014969 Ga0157376_10035524 Ga0157376_100355243 389
355 3300014969 Ga0157376_10115024 Ga0157376_101150242 389
356 3300017792 Ga0163161_10028044 Ga0163161_100280444 389
357 3300020069 Ga0197907_10018712 Ga0197907_100187124 389
358 3300020081 Ga0206354_10790096 Ga0206354_107900963 389
359 3300021441 Ga0213871_10005270 Ga0213871_100052701 389
360 3300022467 Ga0224712_10005547 Ga0224712_100055472 389
361 3300025292 Ga0209676_1000049 Ga0209676_1000049176 389
362 3300025298 Ga0209050_1005983 Ga0209050_10059838 389
363 3300025901 Ga0207688_10029085 Ga0207688_100290853 389
364 3300025912 Ga0207707_10007087 Ga0207707_100070874 389
365 3300025913 Ga0207695_10003576 Ga0207695_1000357620 389
366 3300025913 Ga0207695_10006107 Ga0207695_1000610712 389
367 3300025913 Ga0207695_10037694 Ga0207695_100376946 389
368 3300025919 Ga0207657_10014670 Ga0207657_100146703 389
369 3300025919 Ga0207657_10103620 Ga0207657_101036202 389
370 3300025920 Ga0207649_10125191 Ga0207649_101251912 389
371 3300025921 Ga0207652_10031955 Ga0207652_100319553 389
372 3300025921 Ga0207652_10128601 Ga0207652_101286012 389
373 3300025924 Ga0207694_10000065 Ga0207694_10000065117 389
374 3300025924 Ga0207694_10003606 Ga0207694_100036063 389
375 3300025927 Ga0207687_10032614 Ga0207687_100326142 389
376 3300025927 Ga0207687_10054483 Ga0207687_100544833 389
377 3300025929 Ga0207664_10053209 Ga0207664_100532092 389
378 3300025931 Ga0207644_10100910 Ga0207644_101009101 389
379 3300025931 Ga0207644_10141657 Ga0207644_101416571 389
380 3300025933 Ga0207706_10000659 Ga0207706_1000065922 389
381 3300025933 Ga0207706_10006694 Ga0207706_100066949 389
382 3300025934 Ga0207686_10149868 Ga0207686_101498682 389
383 3300025936 Ga0207670_10059575 Ga0207670_100595752 389
384 3300025937 Ga0207669_10039309 Ga0207669_100393092 389
385 3300025937 Ga0207669_10040827 Ga0207669_100408272 389
386 3300025937 Ga0207669_10205222 Ga0207669_102052221 389
387 3300025939 Ga0207665_10018952 Ga0207665_100189522 389
388 3300025940 Ga0207691_10041938 Ga0207691_100419384 389
389 3300025942 Ga0207689_10049488 Ga0207689_100494882 389
390 3300025942 Ga0207689_10098612 Ga0207689_100986122 389
391 3300025944 Ga0207661_10004492 Ga0207661_100044922 389
392 3300025944 Ga0207661_10181410 Ga0207661_101814103 389
393 3300025949 Ga0207667_10000056 Ga0207667_1000005679 389
394 3300025961 Ga0207712_10067515 Ga0207712_100675152 389
395 3300025972 Ga0207668_10138581 Ga0207668_101385812 389
396 3300025972 Ga0207668_10236597 Ga0207668_102365971 389
397 3300026035 Ga0207703_10175939 Ga0207703_101759391 389
398 3300026041 Ga0207639_10069246 Ga0207639_100692462 389
399 3300026067 Ga0207678_10006159 Ga0207678_100061599 389
400 3300026067 Ga0207678_10021942 Ga0207678_100219424 389
401 3300026067 Ga0207678_10220713 Ga0207678_102207133 389
402 3300026075 Ga0207708_10024288 Ga0207708_100242884 389
403 3300026078 Ga0207702_10130445 Ga0207702_101304453 389
404 3300026089 Ga0207648_10002727 Ga0207648_1000272719 389
405 3300026095 Ga0207676_10092826 Ga0207676_100928262 389
406 3300026116 Ga0207674_10036894 Ga0207674_100368942 389
407 3300026118 Ga0207675_100031589 Ga0207675_1000315897 389
408 3300026118 Ga0207675_100085899 Ga0207675_1000858992 389
409 3300026121 Ga0207683_10035490 Ga0207683_100354904 389
410 3300026121 Ga0207683_10049193 Ga0207683_100491932 389
411 3300026121 Ga0207683_10074377 Ga0207683_100743775 389
412 3300026121 Ga0207683_10077977 Ga0207683_100779772 389
413 3300026121 Ga0207683_10136818 Ga0207683_101368182 389
414 3300026142 Ga0207698_10039280 Ga0207698_100392804 389
415 3300026142 Ga0207698_10138478 Ga0207698_101384782 389
416 3300026142 Ga0207698_10221331 Ga0207698_102213311 389
417 3300028379 Ga0268266_10125417 Ga0268266_101254172 389
418 3300028380 Ga0268265_10008874 Ga0268265_100088743 389
419 3300028381 Ga0268264_10367151 Ga0268264_103671512 389
420 3300031238 Ga0265332_10013593 Ga0265332_100135934 389
421 3300031731 Ga0307405_10216759 Ga0307405_102167592 389
422 3300031995 Ga0307409_100112665 Ga0307409_1001126651 389
423 3300031995 Ga0307409_100325436 Ga0307409_1003254361 389
424 3300032005 Ga0307411_10116576 Ga0307411_101165761 389
425 3300037312 Ga0395899_0043803 Ga0395899_0043803_1062_2240 389
426 3300037418 Ga0395900_0025109 Ga0395900_0025109_4816_5994 389
427 3300037471 Ga0395905_0143764 Ga0395905_0143764_50_1228 389
428 3300037853 Ga0436364_0460242 Ga0436364_0460242_237_1421 389
429 3300038443 Ga0395901_0014517 Ga0395901_0014517_6369_7547 389
430 3300039437 Ga0436365_0000363 Ga0436365_0000363_119_1294 389
431 3300041408 Ga0439453_0003761 Ga0439453_0003761_711_1886 389
432 3300044693 Ga0466961_0041063 Ga0466961_0041063_267_1466 389
433 3300044706 Ga0466964_0000867 Ga0466964_0000867_2347_3519 389
434 3300046454 Ga0495592_0156040 Ga0495592_0156040_346_1521 389
435 3300046500 Ga0495596_0045958 Ga0495596_0045958_190_1380 389
436 3300046511 Ga0495608_0025729 Ga0495608_0025729_2508_3683 389
437 3300046516 Ga0495628_0018271 Ga0495628_0018271_3643_4818 389
438 3300046522 Ga0495643_0000203 Ga0495643_0000203_62957_64135 389
439 3300046524 Ga0495648_0108801 Ga0495648_0108801_218_1393 389
440 3300046529 Ga0495652_0010521 Ga0495652_0010521_3944_5119 389
441 3300046536 Ga0495587_0018269 Ga0495587_0018269_116_1300 389
442 3300046539 Ga0495621_0000077 Ga0495621_0000077_12895_14109 389
443 3300046559 Ga0495667_0008837 Ga0495667_0008837_3205_4380 389
444 3300046663 Ga0495635_0014600 Ga0495635_0014600_534_1709 389
445 3300046674 Ga0495588_0002342 Ga0495588_0002342_6764_7963 389
446 3300046675 Ga0495657_0001221 Ga0495657_0001221_271_1446 389
447 3300046678 Ga0495599_0008694 Ga0495599_0008694_2732_3907 389
448 3300046680 Ga0495646_0004704 Ga0495646_0004704_2598_3773 389
449 3300046684 Ga0495669_0067490 Ga0495669_0067490_43_1218 389
450 3300046794 Ga0495589_0046824 Ga0495589_0046824_694_1992 389
451 3300046809 Ga0495600_0001187 Ga0495600_0001187_2646_3821 389
452 3300046810 Ga0495660_0108198 Ga0495660_0108198_110_1408 389
453 3300047317 Ga0495604_0001041 Ga0495604_0001041_10659_11834 389
454 3300047319 Ga0495674_0029094 Ga0495674_0029094_2273_3448 389
455 3300047322 Ga0495680_0000463 Ga0495680_0000463_3218_4393 389
456 3300048088 Ga0495602_0004605 Ga0495602_0004605_9170_10345 389
457 3300048904 Ga0496101_0140826 Ga0496101_0140826_592_1767 389
458 3300048905 Ga0496102_0082274 Ga0496102_0082274_1044_2219 389
459 3300048906 Ga0496103_0076978 Ga0496103_0076978_61_1251 389
460 3300048908 Ga0496105_0126237 Ga0496105_0126237_345_1559 389
461 3300048909 Ga0496106_0109074 Ga0496106_0109074_833_2008 389
462 3300048910 Ga0496107_0148881 Ga0496107_0148881_160_1335 389
463 3300048911 Ga0496108_0015427 Ga0496108_0015427_1427_2602 389
464 3300048913 Ga0496110_0208741 Ga0496110_0208741_304_1479 389
465 3300048914 Ga0496111_0116719 Ga0496111_0116719_567_1895 389
466 3300048915 Ga0496112_0014070 Ga0496112_0014070_952_2127 389
467 3300048918 Ga0496115_0309470 Ga0496115_0309470_26_1240 389
468 3300048924 Ga0496121_0007011 Ga0496121_0007011_8546_9757 389
469 3300048929 Ga0496126_0054382 Ga0496126_0054382_1064_2254 389
470 3300048929 Ga0496126_0079755 Ga0496126_0079755_1035_2207 389
471 3300048929 Ga0496126_0099985 Ga0496126_0099985_141_1316 389
472 3300049571 Ga0501034_0072987 Ga0501034_0072987_1858_3033 389
473 3300049672 Ga0501239_002424 Ga0501239_002424_492_1670 389
474 3300049765 Ga0501268_002125 Ga0501268_002125_240_1415 389
475 3300050489 nmdc:mga03683_64846_c1 nmdc:mga03683_64846_c1_249_1424 389
476 3300050492 nmdc:mga0yw44_128347_c1 nmdc:mga0yw44_128347_c1_302_1477 389
477 3300050492 nmdc:mga0yw44_213774_c1 nmdc:mga0yw44_213774_c1_53_1228 389
478 3300050492 nmdc:mga0yw44_259_c1 nmdc:mga0yw44_259_c1_11974_13149 389
479 3300050492 nmdc:mga0yw44_49670_c1 nmdc:mga0yw44_49670_c1_1160_2335 389
480 3300050492 nmdc:mga0yw44_55554_c1 nmdc:mga0yw44_55554_c1_146_1321 389
481 3300050493 nmdc:mga0k408_865_c1 nmdc:mga0k408_865_c1_6021_7196 389
482 3300050494 nmdc:mga06z11_147946_c1 nmdc:mga06z11_147946_c1_130_1305 389
483 3300050494 nmdc:mga06z11_16743_c1 nmdc:mga06z11_16743_c1_268_1443 389
484 3300050494 nmdc:mga06z11_7187_c1 nmdc:mga06z11_7187_c1_1298_2473 389
485 3300050494 nmdc:mga06z11_7510_c1 nmdc:mga06z11_7510_c1_3282_4457 389
486 3300050494 nmdc:mga06z11_79246_c1 nmdc:mga06z11_79246_c1_360_1535 389
487 3300050496 nmdc:mga07m45_122686_c1 nmdc:mga07m45_122686_c1_135_1310 389
488 3300050496 nmdc:mga07m45_35640_c1 nmdc:mga07m45_35640_c1_231_1406 389
489 3300050496 nmdc:mga07m45_44417_c1 nmdc:mga07m45_44417_c1_507_1682 389
490 3300050496 nmdc:mga07m45_998_c1 nmdc:mga07m45_998_c1_8017_9192 389
491 3300050507 nmdc:mga05p37_6679_c1 nmdc:mga05p37_6679_c1_2582_3793 389
492 3300050510 nmdc:mga06r32_102312_c1 nmdc:mga06r32_102312_c1_161_1369 389
493 3300053078 Ga0495612_0003363 Ga0495612_0003363_5220_6395 389
494 3300053085 Ga0495619_0025750 Ga0495619_0025750_978_2153 389
495 3300053085 Ga0495619_0053546 Ga0495619_0053546_825_2000 389
496 3300053096 Ga0500641_0008270 Ga0500641_0008270_2115_3290 389
497 3300053129 Ga0500628_001228 Ga0500628_001228_1520_2698 389
498 3300053142 Ga0500577_0094156 Ga0500577_0094156_11_1186 389
499 3300055283 Ga0500661_000297 Ga0500661_000297_3778_4956 389
500 iso_pu_bacteria 2941531003 2941533264 389
501 2162886007 SwRhRL2b_contig_2694069 SwRhRL2b_0375.00011180 391
502 3300005289 Ga0065704_10070132 Ga0065704_10070132857 391
503 3300048913 Ga0496110_0013129 Ga0496110_0013129_3154_4329 391
504 3300048927 Ga0496124_0000003 Ga0496124_0000003_1001027_1002202 391

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

253

336

0.91

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

81

214

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9532 1 391
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.9505 1 391
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.9493 1 391
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.9466 1 391
5yln-assembly2.cif.gz_D zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form 0.9394 1 389
ID Description Score Start End Superfamily
af_Q9P6I8_35_189_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9716 1 153 3.90.180.10
af_P77316_1_168_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9571 1 166 3.90.180.10
af_P77316_175_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9568 175 334 3.40.50.720
af_Q9P6I8_35_189_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9532 1 153 3.90.180.10
af_Q9P6I8_210_365_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9452 175 334 3.40.50.720
ID Description Score Start End GO Terms
AF-M5EN42-F1-model_v4 Putative oxidoreductase, Zn-dependent and NAD(P)-binding 0.9902 1 109 GO:0008270
GO:0016491
AF-A0A6N8NGZ3-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9875 1 96 GO:0008270
GO:0016491
AF-A0A2V7Y5U5-F1-model_v4 Glutathione-dependent formaldehyde dehydrogenase 0.9863 1 390 GO:0008270
GO:0016491
AF-A0A2V7Y5U5-F1-model_v4 Glutathione-dependent formaldehyde dehydrogenase 0.9836 1 390 GO:0008270
GO:0016491
AF-A0A0G4NAK1-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9833 1 215 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
91.74 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map