F456167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 504 | 279 | 501 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300006048|Ga0075363_100323617|Ga0075363_1003236172 |
| Length | 121 |
| Sequence | VYDEDLADRIRELLGVEEGLTEQRMFGGLAFLVSGNMAVAASGRGGLMVRVDPEKSGKLVATSTAEPMVMKGRSMAGWLRVPSEDVRTKRQLSRWVTIGTTYARSLPPKPMKKASPRRRSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 3 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 276 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 277 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 278 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 279 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.62 |
| Metatranscriptomes | 1.79 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0 |
| Rhizoplane | 12.5 |
| Rhizosphere | 82.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10003363 | 3300002459 | Bacteria | 3225 |
| 2 | Ga0070658_10281258 | 3300005327 | Unclassified | 1416 |
| 3 | Ga0070658_10427471 | 3300005327 | Bacteria | 1140 |
| 4 | Ga0070683_100018705 | 3300005329 | Bacteria | 6140 |
| 5 | Ga0070690_100204486 | 3300005330 | Bacteria | 1376 |
| 6 | Ga0070670_100292403 | 3300005331 | Bacteria | 1424 |
| 7 | Ga0068869_100097806 | 3300005334 | Bacteria | 2216 |
| 8 | Ga0068869_100176455 | 3300005334 | Bacteria | 1672 |
| 9 | Ga0070680_100030387 | 3300005336 | Bacteria | 4340 |
| 10 | Ga0070680_100157412 | 3300005336 | Bacteria | 1909 |
| 11 | Ga0070680_100219990 | 3300005336 | Bacteria | 1603 |
| 12 | Ga0070680_101355245 | 3300005336 | Bacteria | 616 |
| 13 | Ga0070682_100131843 | 3300005337 | Bacteria | 1692 |
| 14 | Ga0070682_101280666 | 3300005337 | Bacteria | 622 |
| 15 | Ga0068868_100079051 | 3300005338 | Bacteria | 2634 |
| 16 | Ga0068868_100138892 | 3300005338 | Bacteria | 1993 |
| 17 | Ga0068868_100780253 | 3300005338 | Bacteria | 861 |
| 18 | Ga0070660_100016340 | 3300005339 | Bacteria | 5386 |
| 19 | Ga0070689_100047141 | 3300005340 | Bacteria | 3323 |
| 20 | Ga0070689_100401364 | 3300005340 | Bacteria | 1159 |
| 21 | Ga0070691_10372082 | 3300005341 | Bacteria | 798 |
| 22 | Ga0070661_101671388 | 3300005344 | Unclassified | 539 |
| 23 | Ga0070692_10181334 | 3300005345 | Bacteria | 1221 |
| 24 | Ga0070668_100001337 | 3300005347 | Bacteria | 17610 |
| 25 | Ga0070668_101459106 | 3300005347 | Bacteria | 625 |
| 26 | Ga0070675_100506013 | 3300005354 | Bacteria | 1089 |
| 27 | Ga0070675_101434889 | 3300005354 | Bacteria | 636 |
| 28 | Ga0070671_100002936 | 3300005355 | Bacteria | 13260 |
| 29 | Ga0070671_100389013 | 3300005355 | Bacteria | 1192 |
| 30 | Ga0070671_101344034 | 3300005355 | Bacteria | 631 |
| 31 | Ga0070674_100052434 | 3300005356 | Bacteria | 2814 |
| 32 | Ga0070674_100844477 | 3300005356 | Bacteria | 794 |
| 33 | Ga0070673_100048949 | 3300005364 | Bacteria | 3298 |
| 34 | Ga0070673_100529061 | 3300005364 | Bacteria | 1069 |
| 35 | Ga0070688_100274624 | 3300005365 | Bacteria | 1208 |
| 36 | Ga0070688_100568513 | 3300005365 | Bacteria | 864 |
| 37 | Ga0070709_10001282 | 3300005434 | Bacteria | 13723 |
| 38 | Ga0070709_10034816 | 3300005434 | Bacteria | 3057 |
| 39 | Ga0070709_10069322 | 3300005434 | Bacteria | 2271 |
| 40 | Ga0070713_100008375 | 3300005436 | Bacteria | 7330 |
| 41 | Ga0070710_10011337 | 3300005437 | Bacteria | 4404 |
| 42 | Ga0070710_10013389 | 3300005437 | Bacteria | 4107 |
| 43 | Ga0070710_10107240 | 3300005437 | Bacteria | 1673 |
| 44 | Ga0070711_100008659 | 3300005439 | Bacteria | 6242 |
| 45 | Ga0070705_101059368 | 3300005440 | Bacteria | 661 |
| 46 | Ga0070700_100135243 | 3300005441 | Bacteria | 1668 |
| 47 | Ga0070700_100460228 | 3300005441 | Bacteria | 970 |
| 48 | Ga0070700_101944632 | 3300005441 | Bacteria | 509 |
| 49 | Ga0070694_100285322 | 3300005444 | Bacteria | 1260 |
| 50 | Ga0070708_100002445 | 3300005445 | Bacteria | 14382 |
| 51 | Ga0070663_100445501 | 3300005455 | Bacteria | 1066 |
| 52 | Ga0070663_100768856 | 3300005455 | Bacteria | 824 |
| 53 | Ga0070678_100407034 | 3300005456 | Bacteria | 1183 |
| 54 | Ga0070681_10091331 | 3300005458 | Bacteria | 2995 |
| 55 | Ga0070681_10148603 | 3300005458 | Bacteria | 2271 |
| 56 | Ga0070681_10176512 | 3300005458 | Bacteria | 2058 |
| 57 | Ga0070681_10209040 | 3300005458 | Archaea | 1868 |
| 58 | Ga0068867_100163401 | 3300005459 | Bacteria | 1757 |
| 59 | Ga0070685_10095953 | 3300005466 | Bacteria | 1803 |
| 60 | Ga0070706_100003749 | 3300005467 | Bacteria | 14850 |
| 61 | Ga0070707_100069770 | 3300005468 | Bacteria | 3384 |
| 62 | Ga0070707_101224277 | 3300005468 | Bacteria | 717 |
| 63 | Ga0070698_100058228 | 3300005471 | Bacteria | 3906 |
| 64 | Ga0070679_100013997 | 3300005530 | Bacteria | 7690 |
| 65 | Ga0070679_100030192 | 3300005530 | Bacteria | 5350 |
| 66 | Ga0070679_100048059 | 3300005530 | Bacteria | 4252 |
| 67 | Ga0070679_100090827 | 3300005530 | Bacteria | 3042 |
| 68 | Ga0070684_100021205 | 3300005535 | Bacteria | 5401 |
| 69 | Ga0070684_100049325 | 3300005535 | Bacteria | 3653 |
| 70 | Ga0070684_100210573 | 3300005535 | Bacteria | 1772 |
| 71 | Ga0068853_100469225 | 3300005539 | Bacteria | 1185 |
| 72 | Ga0068853_100953755 | 3300005539 | Bacteria | 825 |
| 73 | Ga0068853_102023118 | 3300005539 | Bacteria | 559 |
| 74 | Ga0070686_100205429 | 3300005544 | Bacteria | 1415 |
| 75 | Ga0070695_100561844 | 3300005545 | Bacteria | 891 |
| 76 | Ga0070696_100041938 | 3300005546 | Bacteria | 3164 |
| 77 | Ga0070693_100021688 | 3300005547 | Bacteria | 3405 |
| 78 | Ga0070693_100071398 | 3300005547 | Bacteria | 2046 |
| 79 | Ga0070665_100005421 | 3300005548 | Bacteria | 13155 |
| 80 | Ga0070665_100013445 | 3300005548 | Bacteria | 8234 |
| 81 | Ga0070665_100497668 | 3300005548 | Bacteria | 1230 |
| 82 | Ga0070704_100153965 | 3300005549 | Bacteria | 1811 |
| 83 | Ga0068855_100147820 | 3300005563 | Bacteria | 2674 |
| 84 | Ga0068855_100161010 | 3300005563 | Bacteria | 2547 |
| 85 | Ga0068857_100090400 | 3300005577 | Bacteria | 2740 |
| 86 | Ga0068854_100076164 | 3300005578 | Bacteria | 2465 |
| 87 | Ga0068854_100550352 | 3300005578 | Bacteria | 979 |
| 88 | Ga0070702_100034336 | 3300005615 | Bacteria | 2795 |
| 89 | Ga0070702_100099958 | 3300005615 | Bacteria | 1777 |
| 90 | Ga0070702_100242340 | 3300005615 | Bacteria | 1217 |
| 91 | Ga0070702_100787318 | 3300005615 | Bacteria | 734 |
| 92 | Ga0070702_101071924 | 3300005615 | Bacteria | 642 |
| 93 | Ga0068859_102059857 | 3300005617 | Bacteria | 630 |
| 94 | Ga0068864_100322084 | 3300005618 | Bacteria | 1452 |
| 95 | Ga0068864_100865401 | 3300005618 | Bacteria | 891 |
| 96 | Ga0068864_101187848 | 3300005618 | Bacteria | 761 |
| 97 | Ga0068866_10173016 | 3300005718 | Bacteria | 1269 |
| 98 | Ga0068866_10245550 | 3300005718 | Bacteria | 1093 |
| 99 | Ga0068861_100010457 | 3300005719 | Bacteria | 6440 |
| 100 | Ga0068861_100130486 | 3300005719 | Bacteria | 2039 |
| 101 | Ga0068863_100000121 | 3300005841 | Bacteria | 81842 |
| 102 | Ga0068863_100029655 | 3300005841 | Bacteria | 5222 |
| 103 | Ga0068863_101048135 | 3300005841 | Bacteria | 819 |
| 104 | Ga0068858_100074274 | 3300005842 | Bacteria | 3157 |
| 105 | Ga0068858_100135395 | 3300005842 | Bacteria | 2312 |
| 106 | Ga0068858_100759135 | 3300005842 | Bacteria | 945 |
| 107 | Ga0068858_101046212 | 3300005842 | Bacteria | 801 |
| 108 | Ga0068858_101643156 | 3300005842 | Bacteria | 634 |
| 109 | Ga0068860_100480583 | 3300005843 | Bacteria | 1238 |
| 110 | Ga0068860_100745406 | 3300005843 | Bacteria | 991 |
| 111 | Ga0068862_100000045 | 3300005844 | Bacteria | 155641 |
| 112 | Ga0068862_100303480 | 3300005844 | Bacteria | 1469 |
| 113 | Ga0068862_101039131 | 3300005844 | Bacteria | 812 |
| 114 | Ga0081538_10003325 | 3300005981 | Bacteria | 15227 |
| 115 | Ga0081539_10133019 | 3300005985 | Bacteria | 1219 |
| 116 | Ga0075363_100323617 | 3300006048 | Bacteria | 897 |
| 117 | Ga0070715_10020728 | 3300006163 | Bacteria | 2539 |
| 118 | Ga0070716_100003011 | 3300006173 | Bacteria | 7857 |
| 119 | Ga0070712_100034161 | 3300006175 | Bacteria | 3445 |
| 120 | Ga0070712_100100837 | 3300006175 | Bacteria | 2134 |
| 121 | Ga0070712_100381251 | 3300006175 | Bacteria | 1161 |
| 122 | Ga0070712_100951656 | 3300006175 | Bacteria | 742 |
| 123 | Ga0097621_100053562 | 3300006237 | Bacteria | 3289 |
| 124 | Ga0097621_100293126 | 3300006237 | Bacteria | 1435 |
| 125 | Ga0075433_10405572 | 3300006852 | Bacteria | 1202 |
| 126 | Ga0075434_100215104 | 3300006871 | Bacteria | 1942 |
| 127 | Ga0068865_100045873 | 3300006881 | Bacteria | 2997 |
| 128 | Ga0097620_102058825 | 3300006931 | Bacteria | 630 |
| 129 | Ga0105251_10275079 | 3300009011 | Bacteria | 761 |
| 130 | Ga0105250_10101522 | 3300009092 | Bacteria | 1174 |
| 131 | Ga0105240_10005139 | 3300009093 | Bacteria | 19587 |
| 132 | Ga0105240_10066829 | 3300009093 | Bacteria | 4458 |
| 133 | Ga0105240_10210727 | 3300009093 | Bacteria | 2271 |
| 134 | Ga0105240_10953666 | 3300009093 | Bacteria | 920 |
| 135 | Ga0111539_10368120 | 3300009094 | Bacteria | 1673 |
| 136 | Ga0105245_10081524 | 3300009098 | Bacteria | 2958 |
| 137 | Ga0105245_10303058 | 3300009098 | Bacteria | 1568 |
| 138 | Ga0105245_10354237 | 3300009098 | Bacteria | 1455 |
| 139 | Ga0105245_10451544 | 3300009098 | Bacteria | 1294 |
| 140 | Ga0105245_10530389 | 3300009098 | Unclassified | 1197 |
| 141 | Ga0105245_10542783 | 3300009098 | Bacteria | 1184 |
| 142 | Ga0105247_10287364 | 3300009101 | Bacteria | 1136 |
| 143 | Ga0105243_10048678 | 3300009148 | Bacteria | 3342 |
| 144 | Ga0105243_10064319 | 3300009148 | Bacteria | 2943 |
| 145 | Ga0105243_10202514 | 3300009148 | Bacteria | 1742 |
| 146 | Ga0105243_11730741 | 3300009148 | Bacteria | 655 |
| 147 | Ga0105242_10072197 | 3300009176 | Bacteria | 2866 |
| 148 | Ga0105242_10194900 | 3300009176 | Bacteria | 1796 |
| 149 | Ga0105242_10655132 | 3300009176 | Bacteria | 1022 |
| 150 | Ga0105248_10093675 | 3300009177 | Bacteria | 3383 |
| 151 | Ga0105248_10281636 | 3300009177 | Bacteria | 1872 |
| 152 | Ga0105248_10544088 | 3300009177 | Bacteria | 1310 |
| 153 | Ga0105237_10065257 | 3300009545 | Bacteria | 3637 |
| 154 | Ga0105237_10153989 | 3300009545 | Bacteria | 2295 |
| 155 | Ga0105237_10667520 | 3300009545 | Bacteria | 1046 |
| 156 | Ga0105238_10030382 | 3300009551 | Bacteria | 5499 |
| 157 | Ga0105238_10130758 | 3300009551 | Bacteria | 2488 |
| 158 | Ga0105238_10562370 | 3300009551 | Bacteria | 1146 |
| 159 | Ga0105239_11627693 | 3300010375 | Bacteria | 747 |
| 160 | Ga0105239_11698649 | 3300010375 | Bacteria | 731 |
| 161 | Ga0105246_10020251 | 3300011119 | Bacteria | 4265 |
| 162 | Ga0105246_10232916 | 3300011119 | Bacteria | 1451 |
| 163 | Ga0105246_10543601 | 3300011119 | Bacteria | 994 |
| 164 | Ga0157373_10328168 | 3300013100 | Bacteria | 1089 |
| 165 | Ga0157370_10087610 | 3300013104 | Bacteria | 2924 |
| 166 | Ga0157369_10003011 | 3300013105 | Bacteria | 20152 |
| 167 | Ga0157369_10373485 | 3300013105 | Bacteria | 1480 |
| 168 | Ga0157374_10061262 | 3300013296 | Bacteria | 3524 |
| 169 | Ga0157378_10011259 | 3300013297 | Bacteria | 7825 |
| 170 | Ga0157378_10019466 | 3300013297 | Bacteria | 5967 |
| 171 | Ga0157378_10443320 | 3300013297 | Bacteria | 1287 |
| 172 | Ga0157378_10605742 | 3300013297 | Bacteria | 1107 |
| 173 | Ga0157372_10116383 | 3300013307 | Bacteria | 3065 |
| 174 | Ga0157375_10023965 | 3300013308 | Bacteria | 5640 |
| 175 | Ga0157375_10397054 | 3300013308 | Bacteria | 1546 |
| 176 | Ga0163163_10461590 | 3300014325 | Bacteria | 1330 |
| 177 | Ga0157380_10409713 | 3300014326 | Bacteria | 1289 |
| 178 | Ga0157380_10867634 | 3300014326 | Bacteria | 926 |
| 179 | Ga0182008_10525138 | 3300014497 | Bacteria | 654 |
| 180 | Ga0157379_10004940 | 3300014968 | Bacteria | 11445 |
| 181 | Ga0157379_10350640 | 3300014968 | Bacteria | 1351 |
| 182 | Ga0157376_10256904 | 3300014969 | Bacteria | 1635 |
| 183 | Ga0163161_10438109 | 3300017792 | Bacteria | 1054 |
| 184 | Ga0197907_10233898 | 3300020069 | Bacteria | 1702 |
| 185 | Ga0197907_11113287 | 3300020069 | Bacteria | 508 |
| 186 | Ga0206356_10104063 | 3300020070 | Bacteria | 2077 |
| 187 | Ga0206356_11181670 | 3300020070 | Bacteria | 2355 |
| 188 | Ga0206354_10192749 | 3300020081 | Bacteria | 901 |
| 189 | Ga0206354_10258447 | 3300020081 | Bacteria | 2878 |
| 190 | Ga0206353_10319123 | 3300020082 | Bacteria | 3561 |
| 191 | Ga0206353_11519024 | 3300020082 | Bacteria | 5574 |
| 192 | Ga0154015_1564700 | 3300020610 | Bacteria | 552 |
| 193 | Ga0207656_10422685 | 3300025321 | Bacteria | 672 |
| 194 | Ga0207653_10000104 | 3300025885 | Bacteria | 59204 |
| 195 | Ga0207692_10050397 | 3300025898 | Bacteria | 2105 |
| 196 | Ga0207642_10094707 | 3300025899 | Bacteria | 1484 |
| 197 | Ga0207642_10370164 | 3300025899 | Bacteria | 850 |
| 198 | Ga0207710_10000028 | 3300025900 | Bacteria | 304525 |
| 199 | Ga0207688_10054627 | 3300025901 | Bacteria | 2241 |
| 200 | Ga0207688_10462781 | 3300025901 | Bacteria | 792 |
| 201 | Ga0207685_10015930 | 3300025905 | Bacteria | 2394 |
| 202 | Ga0207699_10000108 | 3300025906 | Bacteria | 58752 |
| 203 | Ga0207699_10016835 | 3300025906 | Bacteria | 3834 |
| 204 | Ga0207645_10030610 | 3300025907 | Bacteria | 3468 |
| 205 | Ga0207705_10296201 | 3300025909 | Bacteria | 1240 |
| 206 | Ga0207684_10003727 | 3300025910 | Bacteria | 14762 |
| 207 | Ga0207654_10244190 | 3300025911 | Bacteria | 1201 |
| 208 | Ga0207707_10001222 | 3300025912 | Bacteria | 24136 |
| 209 | Ga0207707_10662707 | 3300025912 | Archaea | 879 |
| 210 | Ga0207695_10036594 | 3300025913 | Bacteria | 5305 |
| 211 | Ga0207695_10134284 | 3300025913 | Bacteria | 2429 |
| 212 | Ga0207695_10142269 | 3300025913 | Bacteria | 2346 |
| 213 | Ga0207695_10859692 | 3300025913 | Bacteria | 787 |
| 214 | Ga0207671_10094424 | 3300025914 | Bacteria | 2257 |
| 215 | Ga0207693_10023053 | 3300025915 | Bacteria | 4944 |
| 216 | Ga0207693_10186535 | 3300025915 | Bacteria | 1632 |
| 217 | Ga0207663_10102884 | 3300025916 | Bacteria | 1922 |
| 218 | Ga0207660_10073729 | 3300025917 | Bacteria | 2489 |
| 219 | Ga0207660_10106872 | 3300025917 | Bacteria | 2099 |
| 220 | Ga0207660_10338229 | 3300025917 | Bacteria | 1204 |
| 221 | Ga0207657_10025770 | 3300025919 | Bacteria | 5416 |
| 222 | Ga0207649_10129278 | 3300025920 | Bacteria | 1713 |
| 223 | Ga0207652_10142689 | 3300025921 | Bacteria | 2142 |
| 224 | Ga0207652_10150398 | 3300025921 | Bacteria | 2084 |
| 225 | Ga0207646_10141158 | 3300025922 | Bacteria | 2170 |
| 226 | Ga0207646_11578336 | 3300025922 | Bacteria | 567 |
| 227 | Ga0207681_10018368 | 3300025923 | Bacteria | 4406 |
| 228 | Ga0207694_10199160 | 3300025924 | Bacteria | 1629 |
| 229 | Ga0207650_10423071 | 3300025925 | Bacteria | 1105 |
| 230 | Ga0207659_10071845 | 3300025926 | Bacteria | 2528 |
| 231 | Ga0207659_10201001 | 3300025926 | Bacteria | 1592 |
| 232 | Ga0207687_10128116 | 3300025927 | Bacteria | 1909 |
| 233 | Ga0207687_10156282 | 3300025927 | Bacteria | 1745 |
| 234 | Ga0207687_10214999 | 3300025927 | Bacteria | 1510 |
| 235 | Ga0207687_10400942 | 3300025927 | Bacteria | 1128 |
| 236 | Ga0207700_10044096 | 3300025928 | Bacteria | 3281 |
| 237 | Ga0207664_10165189 | 3300025929 | Bacteria | 1891 |
| 238 | Ga0207664_10802364 | 3300025929 | Bacteria | 847 |
| 239 | Ga0207664_11802116 | 3300025929 | Bacteria | 535 |
| 240 | Ga0207644_10008062 | 3300025931 | Bacteria | 6892 |
| 241 | Ga0207706_11300176 | 3300025933 | Bacteria | 601 |
| 242 | Ga0207686_10709586 | 3300025934 | Bacteria | 800 |
| 243 | Ga0207686_11115240 | 3300025934 | Bacteria | 644 |
| 244 | Ga0207709_10079791 | 3300025935 | Bacteria | 2105 |
| 245 | Ga0207670_10487503 | 3300025936 | Bacteria | 999 |
| 246 | Ga0207669_10044167 | 3300025937 | Bacteria | 2616 |
| 247 | Ga0207704_10041126 | 3300025938 | Bacteria | 2707 |
| 248 | Ga0207665_10021826 | 3300025939 | Bacteria | 4210 |
| 249 | Ga0207665_10144039 | 3300025939 | Bacteria | 1702 |
| 250 | Ga0207711_10000081 | 3300025941 | Bacteria | 102547 |
| 251 | Ga0207711_10055185 | 3300025941 | Bacteria | 3411 |
| 252 | Ga0207711_10322959 | 3300025941 | Bacteria | 1427 |
| 253 | Ga0207689_10020603 | 3300025942 | Bacteria | 5547 |
| 254 | Ga0207689_10045083 | 3300025942 | Bacteria | 3647 |
| 255 | Ga0207689_10112150 | 3300025942 | Bacteria | 2242 |
| 256 | Ga0207661_10000499 | 3300025944 | Bacteria | 25254 |
| 257 | Ga0207661_10113223 | 3300025944 | Bacteria | 2298 |
| 258 | Ga0207661_10271019 | 3300025944 | Bacteria | 1515 |
| 259 | Ga0207667_10121515 | 3300025949 | Bacteria | 2691 |
| 260 | Ga0207667_11542888 | 3300025949 | Bacteria | 634 |
| 261 | Ga0207651_10107259 | 3300025960 | Bacteria | 2087 |
| 262 | Ga0207712_10000016 | 3300025961 | Bacteria | 343014 |
| 263 | Ga0207668_10000577 | 3300025972 | Bacteria | 22902 |
| 264 | Ga0207668_10017793 | 3300025972 | Bacteria | 4460 |
| 265 | Ga0207640_10116545 | 3300025981 | Bacteria | 1905 |
| 266 | Ga0207640_10250273 | 3300025981 | Bacteria | 1375 |
| 267 | Ga0207658_10000237 | 3300025986 | Bacteria | 58047 |
| 268 | Ga0207658_10748526 | 3300025986 | Bacteria | 885 |
| 269 | Ga0207677_10023895 | 3300026023 | Bacteria | 3785 |
| 270 | Ga0207677_10031601 | 3300026023 | Bacteria | 3392 |
| 271 | Ga0207703_10119658 | 3300026035 | Bacteria | 2259 |
| 272 | Ga0207703_10315725 | 3300026035 | Bacteria | 1430 |
| 273 | Ga0207703_10684923 | 3300026035 | Bacteria | 974 |
| 274 | Ga0207678_10460687 | 3300026067 | Bacteria | 1106 |
| 275 | Ga0207678_11167613 | 3300026067 | Bacteria | 682 |
| 276 | Ga0207708_10098346 | 3300026075 | Bacteria | 2262 |
| 277 | Ga0207708_10334825 | 3300026075 | Bacteria | 1238 |
| 278 | Ga0207702_10520093 | 3300026078 | Bacteria | 1162 |
| 279 | Ga0207641_10000284 | 3300026088 | Bacteria | 63546 |
| 280 | Ga0207641_10503428 | 3300026088 | Bacteria | 1176 |
| 281 | Ga0207648_10006140 | 3300026089 | Bacteria | 11973 |
| 282 | Ga0207648_10016599 | 3300026089 | Bacteria | 6721 |
| 283 | Ga0207676_10087037 | 3300026095 | Bacteria | 2554 |
| 284 | Ga0207676_12183681 | 3300026095 | Bacteria | 552 |
| 285 | Ga0207675_100004967 | 3300026118 | Bacteria | 12816 |
| 286 | Ga0207675_100159490 | 3300026118 | Bacteria | 2151 |
| 287 | Ga0207683_10731394 | 3300026121 | Bacteria | 918 |
| 288 | Ga0268266_10003565 | 3300028379 | Bacteria | 15420 |
| 289 | Ga0268266_10056599 | 3300028379 | Bacteria | 3373 |
| 290 | Ga0268266_10271351 | 3300028379 | Bacteria | 1575 |
| 291 | Ga0268265_10000056 | 3300028380 | Bacteria | 155720 |
| 292 | Ga0268265_11864185 | 3300028380 | Bacteria | 608 |
| 293 | Ga0268264_10000053 | 3300028381 | Bacteria | 320368 |
| 294 | Ga0268264_10123073 | 3300028381 | Bacteria | 2289 |
| 295 | Ga0268264_10387377 | 3300028381 | Bacteria | 1340 |
| 296 | Ga0265327_10000001 | 3300031251 | Bacteria | 894475 |
| 297 | Ga0373959_0150522 | 3300034820 | Bacteria | 588 |
| 298 | Ga0373934_0079766 | 3300035086 | Bacteria | 1315 |
| 299 | Ga0373944_0313998 | 3300035089 | Unclassified | 590 |
| 300 | Ga0373923_0016372 | 3300035111 | Bacteria | 2815 |
| 301 | Ga0373936_0018358 | 3300035113 | Bacteria | 2701 |
| 302 | Ga0373939_0180636 | 3300035114 | Bacteria | 787 |
| 303 | Ga0373945_0039037 | 3300035116 | Bacteria | 1710 |
| 304 | Ga0373954_0100182 | 3300035118 | Bacteria | 1397 |
| 305 | Ga0373957_0026746 | 3300035120 | Bacteria | 2090 |
| 306 | Ga0373943_0055449 | 3300035170 | Bacteria | 1963 |
| 307 | Ga0373946_0068693 | 3300035171 | Bacteria | 1525 |
| 308 | Ga0373946_0244470 | 3300035171 | Unclassified | 873 |
| 309 | Ga0373955_0110129 | 3300035172 | Bacteria | 1591 |
| 310 | Ga0373962_0103947 | 3300035242 | Bacteria | 889 |
| 311 | Ga0373924_0012146 | 3300035410 | Bacteria | 3213 |
| 312 | Ga0373924_0054154 | 3300035410 | Bacteria | 1667 |
| 313 | Ga0373931_0675131 | 3300035691 | Unclassified | 681 |
| 314 | Ga0373931_0839572 | 3300035691 | Bacteria | 614 |
| 315 | Ga0373935_0130620 | 3300035692 | Bacteria | 1687 |
| 316 | Ga0373927_0078892 | 3300035695 | Bacteria | 2132 |
| 317 | Ga0373927_0129976 | 3300035695 | Bacteria | 1645 |
| 318 | Ga0373933_0147054 | 3300035724 | Bacteria | 1490 |
| 319 | Ga0373947_0205987 | 3300035725 | Bacteria | 1288 |
| 320 | Ga0373937_0042360 | 3300036401 | Bacteria | 4153 |
| 321 | Ga0373925_0056567 | 3300037068 | Bacteria | 2938 |
| 322 | Ga0373925_0196362 | 3300037068 | Bacteria | 1603 |
| 323 | Ga0373925_0922976 | 3300037068 | Unclassified | 719 |
| 324 | Ga0395900_0009608 | 3300037418 | Bacteria | 9917 |
| 325 | Ga0395898_0299549 | 3300037466 | Bacteria | 1534 |
| 326 | Ga0395898_0611367 | 3300037466 | Bacteria | 1033 |
| 327 | Ga0395905_1395132 | 3300037471 | Bacteria | 605 |
| 328 | Ga0395901_0739014 | 3300038443 | Bacteria | 978 |
| 329 | Ga0436363_1498781 | 3300039450 | Bacteria | 548 |
| 330 | Ga0451843_1168130 | 3300041509 | Bacteria | 661 |
| 331 | Ga0451853_3724327 | 3300041512 | Bacteria | 634 |
| 332 | Ga0466966_0002993 | 3300044684 | Bacteria | 11134 |
| 333 | Ga0466966_0014847 | 3300044684 | Bacteria | 5153 |
| 334 | Ga0466966_0052982 | 3300044684 | Bacteria | 2575 |
| 335 | Ga0466963_0110137 | 3300044694 | Bacteria | 1890 |
| 336 | Ga0466963_0522808 | 3300044694 | Bacteria | 838 |
| 337 | Ga0466964_0648536 | 3300044706 | Bacteria | 584 |
| 338 | Ga0466971_0108571 | 3300044719 | Bacteria | 1279 |
| 339 | Ga0466968_0055809 | 3300044735 | Bacteria | 1696 |
| 340 | Ga0466970_0028286 | 3300044765 | Bacteria | 2944 |
| 341 | Ga0466970_0114454 | 3300044765 | Bacteria | 1474 |
| 342 | Ga0466957_0110848 | 3300044842 | Bacteria | 1740 |
| 343 | Ga0466957_0250273 | 3300044842 | Bacteria | 1178 |
| 344 | Ga0466960_0213703 | 3300044901 | Bacteria | 1058 |
| 345 | Ga0466959_0017611 | 3300045049 | Bacteria | 5238 |
| 346 | Ga0466959_0021115 | 3300045049 | Bacteria | 4800 |
| 347 | Ga0466959_0030433 | 3300045049 | Bacteria | 3997 |
| 348 | Ga0466959_0051116 | 3300045049 | Bacteria | 3033 |
| 349 | Ga0466959_0246902 | 3300045049 | Bacteria | 1232 |
| 350 | Ga0466958_0006102 | 3300045836 | Bacteria | 6531 |
| 351 | Ga0466967_0321370 | 3300045976 | Bacteria | 1493 |
| 352 | Ga0466967_0349085 | 3300045976 | Bacteria | 1432 |
| 353 | Ga0466967_0434873 | 3300045976 | Bacteria | 1280 |
| 354 | Ga0466967_1817323 | 3300045976 | Bacteria | 606 |
| 355 | Ga0495603_0009461 | 3300046455 | Bacteria | 5887 |
| 356 | Ga0495629_0002949 | 3300046459 | Bacteria | 12958 |
| 357 | Ga0495638_0003848 | 3300046460 | Bacteria | 11656 |
| 358 | Ga0495641_0299328 | 3300046461 | Bacteria | 725 |
| 359 | Ga0495580_0073358 | 3300046472 | Bacteria | 2389 |
| 360 | Ga0495639_0024239 | 3300046475 | Bacteria | 2670 |
| 361 | Ga0495662_0000767 | 3300046476 | Bacteria | 15477 |
| 362 | Ga0495664_0025847 | 3300046477 | Bacteria | 3419 |
| 363 | Ga0495664_0033291 | 3300046477 | Bacteria | 3028 |
| 364 | Ga0495594_0351697 | 3300046499 | Bacteria | 839 |
| 365 | Ga0495594_0428273 | 3300046499 | Bacteria | 752 |
| 366 | Ga0495594_0479558 | 3300046499 | Bacteria | 707 |
| 367 | Ga0495583_0453410 | 3300046506 | Bacteria | 502 |
| 368 | Ga0495606_0039786 | 3300046507 | Bacteria | 3163 |
| 369 | Ga0495628_0018564 | 3300046516 | Bacteria | 5759 |
| 370 | Ga0495630_0054874 | 3300046517 | Bacteria | 2985 |
| 371 | Ga0495630_0330960 | 3300046517 | Bacteria | 1165 |
| 372 | Ga0495640_0014734 | 3300046533 | Bacteria | 5906 |
| 373 | Ga0495640_0039803 | 3300046533 | Bacteria | 3296 |
| 374 | Ga0495640_0068642 | 3300046533 | Bacteria | 2385 |
| 375 | Ga0495586_0019193 | 3300046535 | Bacteria | 3637 |
| 376 | Ga0495645_0041072 | 3300046543 | Bacteria | 3373 |
| 377 | Ga0495645_0073813 | 3300046543 | Bacteria | 2457 |
| 378 | Ga0495667_0030481 | 3300046559 | Bacteria | 3624 |
| 379 | Ga0495656_0201303 | 3300046615 | Bacteria | 988 |
| 380 | Ga0495668_0247606 | 3300046616 | Bacteria | 976 |
| 381 | Ga0495634_0112224 | 3300046642 | Bacteria | 1752 |
| 382 | Ga0495634_0433592 | 3300046642 | Bacteria | 777 |
| 383 | Ga0495588_0758129 | 3300046674 | Bacteria | 507 |
| 384 | Ga0495599_0106170 | 3300046678 | Bacteria | 1750 |
| 385 | Ga0495647_0015776 | 3300046681 | Bacteria | 2651 |
| 386 | Ga0495647_0114840 | 3300046681 | Bacteria | 1127 |
| 387 | Ga0495647_0394345 | 3300046681 | Bacteria | 635 |
| 388 | Ga0495658_0056276 | 3300046683 | Bacteria | 2242 |
| 389 | Ga0495613_0020337 | 3300046689 | Bacteria | 4949 |
| 390 | Ga0495624_0204690 | 3300046690 | Bacteria | 1198 |
| 391 | Ga0495649_0410856 | 3300046694 | Bacteria | 679 |
| 392 | Ga0495600_0152649 | 3300046809 | Bacteria | 1495 |
| 393 | Ga0495581_0023954 | 3300047315 | Bacteria | 3537 |
| 394 | Ga0495581_0042845 | 3300047315 | Bacteria | 2619 |
| 395 | Ga0495636_0449273 | 3300047318 | Bacteria | 619 |
| 396 | Ga0495674_0004759 | 3300047319 | Bacteria | 13048 |
| 397 | Ga0495674_0059427 | 3300047319 | Bacteria | 3338 |
| 398 | Ga0495676_0045943 | 3300047321 | Bacteria | 3550 |
| 399 | Ga0495676_0084310 | 3300047321 | Bacteria | 2398 |
| 400 | Ga0495676_0769904 | 3300047321 | Unclassified | 621 |
| 401 | Ga0495680_0380112 | 3300047322 | Bacteria | 978 |
| 402 | Ga0495680_1090499 | 3300047322 | Bacteria | 505 |
| 403 | Ga0495684_0047691 | 3300047471 | Bacteria | 3276 |
| 404 | Ga0495593_0022651 | 3300047673 | Bacteria | 3497 |
| 405 | Ga0495614_0128844 | 3300048089 | Bacteria | 1119 |
| 406 | Ga0496100_0035031 | 3300048903 | Bacteria | 3155 |
| 407 | Ga0496100_0037807 | 3300048903 | Bacteria | 3054 |
| 408 | Ga0496100_0093898 | 3300048903 | Bacteria | 2053 |
| 409 | Ga0496100_0794033 | 3300048903 | Bacteria | 741 |
| 410 | Ga0496100_0916487 | 3300048903 | Bacteria | 688 |
| 411 | Ga0496101_0002562 | 3300048904 | Bacteria | 11153 |
| 412 | Ga0496101_0025473 | 3300048904 | Bacteria | 4105 |
| 413 | Ga0496101_0044662 | 3300048904 | Bacteria | 3171 |
| 414 | Ga0496101_0058031 | 3300048904 | Bacteria | 2801 |
| 415 | Ga0496101_0128129 | 3300048904 | Bacteria | 1925 |
| 416 | Ga0496101_0151578 | 3300048904 | Bacteria | 1774 |
| 417 | Ga0496102_0000070 | 3300048905 | Bacteria | 155087 |
| 418 | Ga0496102_0113732 | 3300048905 | Bacteria | 2525 |
| 419 | Ga0496102_0170984 | 3300048905 | Bacteria | 2046 |
| 420 | Ga0496103_0000484 | 3300048906 | Bacteria | 33254 |
| 421 | Ga0496103_0073887 | 3300048906 | Bacteria | 2136 |
| 422 | Ga0496103_0181376 | 3300048906 | Bacteria | 1353 |
| 423 | Ga0496103_0448726 | 3300048906 | Bacteria | 827 |
| 424 | Ga0496104_0008051 | 3300048907 | Bacteria | 9349 |
| 425 | Ga0496104_0098575 | 3300048907 | Bacteria | 2797 |
| 426 | Ga0496104_0174236 | 3300048907 | Bacteria | 2062 |
| 427 | Ga0496104_0474812 | 3300048907 | Bacteria | 1162 |
| 428 | Ga0496105_0012167 | 3300048908 | Bacteria | 6813 |
| 429 | Ga0496105_0042725 | 3300048908 | Bacteria | 3738 |
| 430 | Ga0496105_0071701 | 3300048908 | Bacteria | 2863 |
| 431 | Ga0496105_0236102 | 3300048908 | Bacteria | 1485 |
| 432 | Ga0496106_0015820 | 3300048909 | Bacteria | 5579 |
| 433 | Ga0496106_0056052 | 3300048909 | Bacteria | 2979 |
| 434 | Ga0496106_0164290 | 3300048909 | Bacteria | 1757 |
| 435 | Ga0496106_0227332 | 3300048909 | Bacteria | 1489 |
| 436 | Ga0496106_0395165 | 3300048909 | Bacteria | 1111 |
| 437 | Ga0496107_0005085 | 3300048910 | Bacteria | 8966 |
| 438 | Ga0496107_0019779 | 3300048910 | Bacteria | 4753 |
| 439 | Ga0496107_0039437 | 3300048910 | Bacteria | 3388 |
| 440 | Ga0496107_0811233 | 3300048910 | Bacteria | 685 |
| 441 | Ga0496107_1268105 | 3300048910 | Bacteria | 528 |
| 442 | Ga0496108_0015468 | 3300048911 | Bacteria | 6224 |
| 443 | Ga0496108_0075692 | 3300048911 | Bacteria | 2844 |
| 444 | Ga0496108_0586446 | 3300048911 | Bacteria | 972 |
| 445 | Ga0496109_0103423 | 3300048912 | Bacteria | 2643 |
| 446 | Ga0496109_0208366 | 3300048912 | Bacteria | 1838 |
| 447 | Ga0496109_0292418 | 3300048912 | Bacteria | 1536 |
| 448 | Ga0496109_0840844 | 3300048912 | Bacteria | 856 |
| 449 | Ga0496109_1038582 | 3300048912 | Bacteria | 757 |
| 450 | Ga0496110_0068879 | 3300048913 | Bacteria | 3132 |
| 451 | Ga0496110_0156111 | 3300048913 | Bacteria | 2067 |
| 452 | Ga0496110_0355005 | 3300048913 | Bacteria | 1336 |
| 453 | Ga0496111_0021220 | 3300048914 | Bacteria | 4532 |
| 454 | Ga0496111_0202363 | 3300048914 | Bacteria | 1476 |
| 455 | Ga0496111_0264342 | 3300048914 | Bacteria | 1276 |
| 456 | Ga0496111_0847103 | 3300048914 | Bacteria | 660 |
| 457 | Ga0496112_0417678 | 3300048915 | Bacteria | 1280 |
| 458 | Ga0496113_0351052 | 3300048916 | Bacteria | 1183 |
| 459 | Ga0496113_0803443 | 3300048916 | Bacteria | 747 |
| 460 | Ga0496114_0015447 | 3300048917 | Bacteria | 6141 |
| 461 | Ga0496114_0085445 | 3300048917 | Bacteria | 2672 |
| 462 | Ga0496114_0146168 | 3300048917 | Bacteria | 2049 |
| 463 | Ga0496114_0780187 | 3300048917 | Bacteria | 834 |
| 464 | Ga0496114_0806206 | 3300048917 | Bacteria | 818 |
| 465 | Ga0496114_1395689 | 3300048917 | Bacteria | 588 |
| 466 | Ga0496115_0247707 | 3300048918 | Bacteria | 1468 |
| 467 | Ga0496115_0433115 | 3300048918 | Bacteria | 1064 |
| 468 | Ga0496115_0592319 | 3300048918 | Bacteria | 882 |
| 469 | Ga0496116_0011237 | 3300048919 | Bacteria | 7435 |
| 470 | Ga0496117_0000319 | 3300048920 | Bacteria | 84245 |
| 471 | Ga0496118_0001764 | 3300048921 | Bacteria | 31300 |
| 472 | Ga0496119_0015609 | 3300048922 | Bacteria | 5832 |
| 473 | Ga0496120_0035754 | 3300048923 | Bacteria | 2963 |
| 474 | Ga0496120_0266287 | 3300048923 | Bacteria | 798 |
| 475 | Ga0496121_0002593 | 3300048924 | Bacteria | 27292 |
| 476 | Ga0496125_0120921 | 3300048928 | Bacteria | 1868 |
| 477 | Ga0496125_0172481 | 3300048928 | Bacteria | 1452 |
| 478 | Ga0496126_0065474 | 3300048929 | Bacteria | 3252 |
| 479 | Ga0501034_0437485 | 3300049571 | Bacteria | 1227 |
| 480 | Ga0501069_0068600 | 3300049585 | Bacteria | 1984 |
| 481 | Ga0501070_0013545 | 3300049586 | Bacteria | 6875 |
| 482 | Ga0501070_0474849 | 3300049586 | Bacteria | 1006 |
| 483 | Ga0501071_0308198 | 3300049587 | Bacteria | 1201 |
| 484 | Ga0501073_0786025 | 3300049589 | Bacteria | 656 |
| 485 | Ga0501074_0053967 | 3300049590 | Bacteria | 2899 |
| 486 | nmdc:mga07m45_578453_c1 | 3300050496 | Bacteria | 649 |
| 487 | nmdc:mga0n895_1089794_c1 | 3300050512 | Bacteria | 776 |
| 488 | nmdc:mga0n895_149110_c1 | 3300050512 | Bacteria | 2368 |
| 489 | nmdc:mga0n895_437385_c1 | 3300050512 | Bacteria | 1321 |
| 490 | nmdc:mga0rr50_350699_c1 | 3300050513 | Bacteria | 1241 |
| 491 | nmdc:mga0a205_1333364_c1 | 3300050515 | Bacteria | 565 |
| 492 | nmdc:mga0a205_412192_c1 | 3300050515 | Bacteria | 1214 |
| 493 | nmdc:mga0sz30_50787_c2 | 3300050516 | Bacteria | 806 |
| 494 | Ga0495601_0031681 | 3300053077 | Bacteria | 3287 |
| 495 | Ga0495612_0051091 | 3300053078 | Bacteria | 1698 |
| 496 | Ga0495612_0137468 | 3300053078 | Bacteria | 1058 |
| 497 | Ga0500568_0182718 | 3300053139 | Bacteria | 771 |
| 498 | Ga0500588_0141757 | 3300053146 | Bacteria | 864 |
| 499 | Ga0500616_0040117 | 3300053153 | Bacteria | 2520 |
| 500 | Ga0500637_0526571 | 3300053178 | Bacteria | 579 |
| 501 | Ga0500645_000006 | 3300053730 | Bacteria | 276677 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009101 | Ga0105247_10287364 | Ga0105247_102873643 | 84 |
| 2 | 3300046476 | Ga0495662_0000767 | Ga0495662_0000767_20_316 | 84 |
| 3 | 3300005437 | Ga0070710_10013389 | Ga0070710_100133896 | 85 |
| 4 | 3300009148 | Ga0105243_11730741 | Ga0105243_117307411 | 85 |
| 5 | 3300005327 | Ga0070658_10427471 | Ga0070658_104274712 | 90 |
| 6 | 3300005336 | Ga0070680_100219990 | Ga0070680_1002199902 | 90 |
| 7 | 3300005339 | Ga0070660_100016340 | Ga0070660_1000163409 | 90 |
| 8 | 3300005458 | Ga0070681_10148603 | Ga0070681_101486032 | 90 |
| 9 | 3300005530 | Ga0070679_100090827 | Ga0070679_1000908273 | 90 |
| 10 | 3300005563 | Ga0068855_100161010 | Ga0068855_1001610104 | 90 |
| 11 | 3300009093 | Ga0105240_10005139 | Ga0105240_100051394 | 90 |
| 12 | 3300013100 | Ga0157373_10328168 | Ga0157373_103281682 | 90 |
| 13 | 3300013104 | Ga0157370_10087610 | Ga0157370_100876105 | 90 |
| 14 | 3300020069 | Ga0197907_10233898 | Ga0197907_102338981 | 90 |
| 15 | 3300020070 | Ga0206356_10104063 | Ga0206356_101040634 | 90 |
| 16 | 3300020081 | Ga0206354_10258447 | Ga0206354_102584475 | 90 |
| 17 | 3300020082 | Ga0206353_10319123 | Ga0206353_103191235 | 90 |
| 18 | 3300025913 | Ga0207695_10036594 | Ga0207695_100365947 | 90 |
| 19 | 3300025917 | Ga0207660_10338229 | Ga0207660_103382292 | 90 |
| 20 | 3300025919 | Ga0207657_10025770 | Ga0207657_100257702 | 90 |
| 21 | 3300025920 | Ga0207649_10129278 | Ga0207649_101292785 | 90 |
| 22 | 3300025921 | Ga0207652_10142689 | Ga0207652_101426894 | 90 |
| 23 | 3300025929 | Ga0207664_10165189 | Ga0207664_101651894 | 90 |
| 24 | 3300025949 | Ga0207667_11542888 | Ga0207667_115428881 | 90 |
| 25 | 3300037466 | Ga0395898_0611367 | Ga0395898_0611367_350_661 | 90 |
| 26 | 3300009093 | Ga0105240_10210727 | Ga0105240_102107272 | 92 |
| 27 | 3300025913 | Ga0207695_10859692 | Ga0207695_108596922 | 92 |
| 28 | 3300037466 | Ga0395898_0299549 | Ga0395898_0299549_740_1057 | 92 |
| 29 | 3300038443 | Ga0395901_0739014 | Ga0395901_0739014_432_749 | 92 |
| 30 | 3300005336 | Ga0070680_101355245 | Ga0070680_1013552451 | 93 |
| 31 | 3300044684 | Ga0466966_0052982 | Ga0466966_0052982_656_979 | 93 |
| 32 | 3300045049 | Ga0466959_0021115 | Ga0466959_0021115_3271_3594 | 93 |
| 33 | iso_pu_bacteria | 2547132424 | 2548693693 | 93 |
| 34 | iso_pu_bacteria | 2643221692 | 2644513458 | 93 |
| 35 | iso_pu_bacteria | 2902792274 | 2902798149 | 93 |
| 36 | 3300039450 | Ga0436363_1498781 | Ga0436363_1498781_170_496 | 94 |
| 37 | 3300005434 | Ga0070709_10069322 | Ga0070709_100693222 | 95 |
| 38 | 3300031251 | Ga0265327_10000001 | Ga0265327_10000001278 | 95 |
| 39 | 3300035086 | Ga0373934_0079766 | Ga0373934_0079766_326_739 | 95 |
| 40 | 3300035089 | Ga0373944_0313998 | Ga0373944_0313998_42_455 | 95 |
| 41 | 3300035111 | Ga0373923_0016372 | Ga0373923_0016372_1115_1540 | 95 |
| 42 | 3300035113 | Ga0373936_0018358 | Ga0373936_0018358_2099_2524 | 95 |
| 43 | 3300035116 | Ga0373945_0039037 | Ga0373945_0039037_514_951 | 95 |
| 44 | 3300035118 | Ga0373954_0100182 | Ga0373954_0100182_98_535 | 95 |
| 45 | 3300035120 | Ga0373957_0026746 | Ga0373957_0026746_564_989 | 95 |
| 46 | 3300035170 | Ga0373943_0055449 | Ga0373943_0055449_657_1082 | 95 |
| 47 | 3300035171 | Ga0373946_0244470 | Ga0373946_0244470_325_750 | 95 |
| 48 | 3300035172 | Ga0373955_0110129 | Ga0373955_0110129_327_752 | 95 |
| 49 | 3300035410 | Ga0373924_0012146 | Ga0373924_0012146_2504_2929 | 95 |
| 50 | 3300035410 | Ga0373924_0054154 | Ga0373924_0054154_110_547 | 95 |
| 51 | 3300035692 | Ga0373935_0130620 | Ga0373935_0130620_326_751 | 95 |
| 52 | 3300035695 | Ga0373927_0078892 | Ga0373927_0078892_1480_1905 | 95 |
| 53 | 3300035724 | Ga0373933_0147054 | Ga0373933_0147054_201_626 | 95 |
| 54 | 3300035725 | Ga0373947_0205987 | Ga0373947_0205987_327_752 | 95 |
| 55 | 3300036401 | Ga0373937_0042360 | Ga0373937_0042360_2573_3010 | 95 |
| 56 | 3300037068 | Ga0373925_0056567 | Ga0373925_0056567_1017_1442 | 95 |
| 57 | 3300037068 | Ga0373925_0922976 | Ga0373925_0922976_186_518 | 95 |
| 58 | 3300045976 | Ga0466967_1817323 | Ga0466967_1817323_245_574 | 95 |
| 59 | 3300046472 | Ga0495580_0073358 | Ga0495580_0073358_1827_2252 | 95 |
| 60 | 3300046475 | Ga0495639_0024239 | Ga0495639_0024239_1042_1467 | 95 |
| 61 | 3300046477 | Ga0495664_0033291 | Ga0495664_0033291_138_563 | 95 |
| 62 | 3300046499 | Ga0495594_0351697 | Ga0495594_0351697_20_457 | 95 |
| 63 | 3300046516 | Ga0495628_0018564 | Ga0495628_0018564_4179_4604 | 95 |
| 64 | 3300046517 | Ga0495630_0054874 | Ga0495630_0054874_1049_1474 | 95 |
| 65 | 3300046533 | Ga0495640_0039803 | Ga0495640_0039803_2194_2619 | 95 |
| 66 | 3300046543 | Ga0495645_0073813 | Ga0495645_0073813_1913_2338 | 95 |
| 67 | 3300046642 | Ga0495634_0112224 | Ga0495634_0112224_279_704 | 95 |
| 68 | 3300046678 | Ga0495599_0106170 | Ga0495599_0106170_685_1110 | 95 |
| 69 | 3300046681 | Ga0495647_0015776 | Ga0495647_0015776_125_550 | 95 |
| 70 | 3300046683 | Ga0495658_0056276 | Ga0495658_0056276_813_1238 | 95 |
| 71 | 3300046689 | Ga0495613_0020337 | Ga0495613_0020337_2402_2827 | 95 |
| 72 | 3300046690 | Ga0495624_0204690 | Ga0495624_0204690_627_1064 | 95 |
| 73 | 3300046809 | Ga0495600_0152649 | Ga0495600_0152649_753_1166 | 95 |
| 74 | 3300047315 | Ga0495581_0042845 | Ga0495581_0042845_900_1325 | 95 |
| 75 | 3300047319 | Ga0495674_0059427 | Ga0495674_0059427_526_951 | 95 |
| 76 | 3300047321 | Ga0495676_0769904 | Ga0495676_0769904_54_467 | 95 |
| 77 | 3300047471 | Ga0495684_0047691 | Ga0495684_0047691_1168_1593 | 95 |
| 78 | 3300047673 | Ga0495593_0022651 | Ga0495593_0022651_29_442 | 95 |
| 79 | 3300048089 | Ga0495614_0128844 | Ga0495614_0128844_508_933 | 95 |
| 80 | 3300048917 | Ga0496114_1395689 | Ga0496114_1395689_181_507 | 95 |
| 81 | 3300053078 | Ga0495612_0137468 | Ga0495612_0137468_549_974 | 95 |
| 82 | 3300005336 | Ga0070680_100030387 | Ga0070680_1000303872 | 96 |
| 83 | 3300005344 | Ga0070661_101671388 | Ga0070661_1016713881 | 96 |
| 84 | 3300005347 | Ga0070668_101459106 | Ga0070668_1014591062 | 96 |
| 85 | 3300005456 | Ga0070678_100407034 | Ga0070678_1004070341 | 96 |
| 86 | 3300005458 | Ga0070681_10176512 | Ga0070681_101765123 | 96 |
| 87 | 3300005468 | Ga0070707_101224277 | Ga0070707_1012242772 | 96 |
| 88 | 3300005530 | Ga0070679_100048059 | Ga0070679_1000480594 | 96 |
| 89 | 3300005535 | Ga0070684_100049325 | Ga0070684_1000493252 | 96 |
| 90 | 3300005539 | Ga0068853_100469225 | Ga0068853_1004692252 | 96 |
| 91 | 3300005547 | Ga0070693_100071398 | Ga0070693_1000713982 | 96 |
| 92 | 3300005548 | Ga0070665_100497668 | Ga0070665_1004976682 | 96 |
| 93 | 3300005577 | Ga0068857_100090400 | Ga0068857_1000904003 | 96 |
| 94 | 3300005615 | Ga0070702_101071924 | Ga0070702_1010719241 | 96 |
| 95 | 3300005618 | Ga0068864_100865401 | Ga0068864_1008654012 | 96 |
| 96 | 3300005841 | Ga0068863_101048135 | Ga0068863_1010481352 | 96 |
| 97 | 3300005842 | Ga0068858_101643156 | Ga0068858_1016431562 | 96 |
| 98 | 3300006048 | Ga0075363_100323617 | Ga0075363_1003236172 | 96 |
| 99 | 3300009176 | Ga0105242_10194900 | Ga0105242_101949001 | 96 |
| 100 | 3300009177 | Ga0105248_10281636 | Ga0105248_102816363 | 96 |
| 101 | 3300009545 | Ga0105237_10153989 | Ga0105237_101539893 | 96 |
| 102 | 3300009551 | Ga0105238_10562370 | Ga0105238_105623702 | 96 |
| 103 | 3300011119 | Ga0105246_10543601 | Ga0105246_105436012 | 96 |
| 104 | 3300013105 | Ga0157369_10373485 | Ga0157369_103734852 | 96 |
| 105 | 3300013308 | Ga0157375_10397054 | Ga0157375_103970543 | 96 |
| 106 | 3300014326 | Ga0157380_10867634 | Ga0157380_108676342 | 96 |
| 107 | 3300014968 | Ga0157379_10350640 | Ga0157379_103506402 | 96 |
| 108 | 3300017792 | Ga0163161_10438109 | Ga0163161_104381092 | 96 |
| 109 | 3300025917 | Ga0207660_10073729 | Ga0207660_100737293 | 96 |
| 110 | 3300025922 | Ga0207646_11578336 | Ga0207646_115783362 | 96 |
| 111 | 3300025929 | Ga0207664_10802364 | Ga0207664_108023642 | 96 |
| 112 | 3300025934 | Ga0207686_11115240 | Ga0207686_111152402 | 96 |
| 113 | 3300025937 | Ga0207669_10044167 | Ga0207669_100441672 | 96 |
| 114 | 3300025944 | Ga0207661_10113223 | Ga0207661_101132232 | 96 |
| 115 | 3300025986 | Ga0207658_10748526 | Ga0207658_107485262 | 96 |
| 116 | 3300026095 | Ga0207676_12183681 | Ga0207676_121836811 | 96 |
| 117 | 3300026121 | Ga0207683_10731394 | Ga0207683_107313942 | 96 |
| 118 | 3300028379 | Ga0268266_10271351 | Ga0268266_102713512 | 96 |
| 119 | 3300037418 | Ga0395900_0009608 | Ga0395900_0009608_2402_2731 | 96 |
| 120 | 3300037471 | Ga0395905_1395132 | Ga0395905_1395132_171_500 | 96 |
| 121 | 3300044694 | Ga0466963_0110137 | Ga0466963_0110137_1070_1399 | 96 |
| 122 | 3300044694 | Ga0466963_0522808 | Ga0466963_0522808_223_552 | 96 |
| 123 | 3300045976 | Ga0466967_0434873 | Ga0466967_0434873_500_838 | 96 |
| 124 | 3300048903 | Ga0496100_0093898 | Ga0496100_0093898_208_537 | 96 |
| 125 | 3300048904 | Ga0496101_0025473 | Ga0496101_0025473_1069_1398 | 96 |
| 126 | 3300048907 | Ga0496104_0008051 | Ga0496104_0008051_165_494 | 96 |
| 127 | 3300048908 | Ga0496105_0012167 | Ga0496105_0012167_608_937 | 96 |
| 128 | 3300048908 | Ga0496105_0236102 | Ga0496105_0236102_166_519 | 96 |
| 129 | 3300048909 | Ga0496106_0056052 | Ga0496106_0056052_2329_2658 | 96 |
| 130 | 3300048910 | Ga0496107_0019779 | Ga0496107_0019779_920_1249 | 96 |
| 131 | 3300048911 | Ga0496108_0015468 | Ga0496108_0015468_1688_2041 | 96 |
| 132 | 3300048912 | Ga0496109_0208366 | Ga0496109_0208366_648_1001 | 96 |
| 133 | 3300048912 | Ga0496109_1038582 | Ga0496109_1038582_70_399 | 96 |
| 134 | 3300048914 | Ga0496111_0847103 | Ga0496111_0847103_245_598 | 96 |
| 135 | 3300048916 | Ga0496113_0803443 | Ga0496113_0803443_279_632 | 96 |
| 136 | 3300048917 | Ga0496114_0146168 | Ga0496114_0146168_1069_1398 | 96 |
| 137 | 3300050512 | nmdc:mga0n895_1089794_c1 | nmdc:mga0n895_1089794_c1_299_628 | 96 |
| 138 | 3300002459 | JGI24751J29686_10003363 | JGI24751J29686_100033633 | 97 |
| 139 | 3300005327 | Ga0070658_10281258 | Ga0070658_102812581 | 97 |
| 140 | 3300005329 | Ga0070683_100018705 | Ga0070683_1000187054 | 97 |
| 141 | 3300005330 | Ga0070690_100204486 | Ga0070690_1002044863 | 97 |
| 142 | 3300005331 | Ga0070670_100292403 | Ga0070670_1002924032 | 97 |
| 143 | 3300005334 | Ga0068869_100097806 | Ga0068869_1000978064 | 97 |
| 144 | 3300005334 | Ga0068869_100176455 | Ga0068869_1001764552 | 97 |
| 145 | 3300005336 | Ga0070680_100157412 | Ga0070680_1001574122 | 97 |
| 146 | 3300005337 | Ga0070682_100131843 | Ga0070682_1001318431 | 97 |
| 147 | 3300005337 | Ga0070682_101280666 | Ga0070682_1012806661 | 97 |
| 148 | 3300005338 | Ga0068868_100079051 | Ga0068868_1000790513 | 97 |
| 149 | 3300005338 | Ga0068868_100138892 | Ga0068868_1001388922 | 97 |
| 150 | 3300005338 | Ga0068868_100780253 | Ga0068868_1007802532 | 97 |
| 151 | 3300005340 | Ga0070689_100047141 | Ga0070689_1000471414 | 97 |
| 152 | 3300005340 | Ga0070689_100401364 | Ga0070689_1004013642 | 97 |
| 153 | 3300005341 | Ga0070691_10372082 | Ga0070691_103720821 | 97 |
| 154 | 3300005345 | Ga0070692_10181334 | Ga0070692_101813342 | 97 |
| 155 | 3300005347 | Ga0070668_100001337 | Ga0070668_10000133713 | 97 |
| 156 | 3300005354 | Ga0070675_100506013 | Ga0070675_1005060132 | 97 |
| 157 | 3300005354 | Ga0070675_101434889 | Ga0070675_1014348892 | 97 |
| 158 | 3300005355 | Ga0070671_100002936 | Ga0070671_1000029364 | 97 |
| 159 | 3300005355 | Ga0070671_100389013 | Ga0070671_1003890132 | 97 |
| 160 | 3300005355 | Ga0070671_101344034 | Ga0070671_1013440341 | 97 |
| 161 | 3300005356 | Ga0070674_100052434 | Ga0070674_1000524343 | 97 |
| 162 | 3300005356 | Ga0070674_100844477 | Ga0070674_1008444772 | 97 |
| 163 | 3300005364 | Ga0070673_100048949 | Ga0070673_1000489493 | 97 |
| 164 | 3300005364 | Ga0070673_100529061 | Ga0070673_1005290612 | 97 |
| 165 | 3300005365 | Ga0070688_100274624 | Ga0070688_1002746242 | 97 |
| 166 | 3300005365 | Ga0070688_100568513 | Ga0070688_1005685132 | 97 |
| 167 | 3300005434 | Ga0070709_10001282 | Ga0070709_100012826 | 97 |
| 168 | 3300005434 | Ga0070709_10034816 | Ga0070709_100348163 | 97 |
| 169 | 3300005436 | Ga0070713_100008375 | Ga0070713_1000083758 | 97 |
| 170 | 3300005437 | Ga0070710_10011337 | Ga0070710_100113373 | 97 |
| 171 | 3300005437 | Ga0070710_10107240 | Ga0070710_101072403 | 97 |
| 172 | 3300005439 | Ga0070711_100008659 | Ga0070711_1000086595 | 97 |
| 173 | 3300005440 | Ga0070705_101059368 | Ga0070705_1010593681 | 97 |
| 174 | 3300005441 | Ga0070700_100135243 | Ga0070700_1001352432 | 97 |
| 175 | 3300005441 | Ga0070700_100460228 | Ga0070700_1004602282 | 97 |
| 176 | 3300005441 | Ga0070700_101944632 | Ga0070700_1019446321 | 97 |
| 177 | 3300005444 | Ga0070694_100285322 | Ga0070694_1002853222 | 97 |
| 178 | 3300005445 | Ga0070708_100002445 | Ga0070708_10000244515 | 97 |
| 179 | 3300005455 | Ga0070663_100445501 | Ga0070663_1004455012 | 97 |
| 180 | 3300005455 | Ga0070663_100768856 | Ga0070663_1007688562 | 97 |
| 181 | 3300005458 | Ga0070681_10091331 | Ga0070681_100913312 | 97 |
| 182 | 3300005458 | Ga0070681_10209040 | Ga0070681_102090402 | 97 |
| 183 | 3300005459 | Ga0068867_100163401 | Ga0068867_1001634012 | 97 |
| 184 | 3300005466 | Ga0070685_10095953 | Ga0070685_100959533 | 97 |
| 185 | 3300005467 | Ga0070706_100003749 | Ga0070706_10000374915 | 97 |
| 186 | 3300005468 | Ga0070707_100069770 | Ga0070707_1000697702 | 97 |
| 187 | 3300005471 | Ga0070698_100058228 | Ga0070698_1000582285 | 97 |
| 188 | 3300005530 | Ga0070679_100013997 | Ga0070679_1000139971 | 97 |
| 189 | 3300005530 | Ga0070679_100030192 | Ga0070679_1000301924 | 97 |
| 190 | 3300005535 | Ga0070684_100021205 | Ga0070684_1000212056 | 97 |
| 191 | 3300005535 | Ga0070684_100210573 | Ga0070684_1002105732 | 97 |
| 192 | 3300005539 | Ga0068853_100953755 | Ga0068853_1009537551 | 97 |
| 193 | 3300005539 | Ga0068853_102023118 | Ga0068853_1020231181 | 97 |
| 194 | 3300005544 | Ga0070686_100205429 | Ga0070686_1002054292 | 97 |
| 195 | 3300005545 | Ga0070695_100561844 | Ga0070695_1005618442 | 97 |
| 196 | 3300005546 | Ga0070696_100041938 | Ga0070696_1000419382 | 97 |
| 197 | 3300005547 | Ga0070693_100021688 | Ga0070693_1000216881 | 97 |
| 198 | 3300005548 | Ga0070665_100005421 | Ga0070665_1000054216 | 97 |
| 199 | 3300005548 | Ga0070665_100013445 | Ga0070665_1000134452 | 97 |
| 200 | 3300005549 | Ga0070704_100153965 | Ga0070704_1001539652 | 97 |
| 201 | 3300005563 | Ga0068855_100147820 | Ga0068855_1001478203 | 97 |
| 202 | 3300005578 | Ga0068854_100076164 | Ga0068854_1000761641 | 97 |
| 203 | 3300005578 | Ga0068854_100550352 | Ga0068854_1005503522 | 97 |
| 204 | 3300005615 | Ga0070702_100034336 | Ga0070702_1000343363 | 97 |
| 205 | 3300005615 | Ga0070702_100099958 | Ga0070702_1000999581 | 97 |
| 206 | 3300005615 | Ga0070702_100242340 | Ga0070702_1002423402 | 97 |
| 207 | 3300005615 | Ga0070702_100787318 | Ga0070702_1007873181 | 97 |
| 208 | 3300005617 | Ga0068859_102059857 | Ga0068859_1020598571 | 97 |
| 209 | 3300005618 | Ga0068864_100322084 | Ga0068864_1003220842 | 97 |
| 210 | 3300005618 | Ga0068864_101187848 | Ga0068864_1011878481 | 97 |
| 211 | 3300005718 | Ga0068866_10173016 | Ga0068866_101730161 | 97 |
| 212 | 3300005718 | Ga0068866_10245550 | Ga0068866_102455503 | 97 |
| 213 | 3300005719 | Ga0068861_100010457 | Ga0068861_1000104576 | 97 |
| 214 | 3300005719 | Ga0068861_100130486 | Ga0068861_1001304863 | 97 |
| 215 | 3300005841 | Ga0068863_100000121 | Ga0068863_10000012173 | 97 |
| 216 | 3300005841 | Ga0068863_100029655 | Ga0068863_1000296553 | 97 |
| 217 | 3300005842 | Ga0068858_100074274 | Ga0068858_1000742742 | 97 |
| 218 | 3300005842 | Ga0068858_100135395 | Ga0068858_1001353952 | 97 |
| 219 | 3300005842 | Ga0068858_100759135 | Ga0068858_1007591353 | 97 |
| 220 | 3300005842 | Ga0068858_101046212 | Ga0068858_1010462122 | 97 |
| 221 | 3300005843 | Ga0068860_100480583 | Ga0068860_1004805832 | 97 |
| 222 | 3300005843 | Ga0068860_100745406 | Ga0068860_1007454061 | 97 |
| 223 | 3300005844 | Ga0068862_100000045 | Ga0068862_100000045125 | 97 |
| 224 | 3300005844 | Ga0068862_100303480 | Ga0068862_1003034803 | 97 |
| 225 | 3300005844 | Ga0068862_101039131 | Ga0068862_1010391312 | 97 |
| 226 | 3300005981 | Ga0081538_10003325 | Ga0081538_100033253 | 97 |
| 227 | 3300005985 | Ga0081539_10133019 | Ga0081539_101330193 | 97 |
| 228 | 3300006163 | Ga0070715_10020728 | Ga0070715_100207283 | 97 |
| 229 | 3300006173 | Ga0070716_100003011 | Ga0070716_10000301110 | 97 |
| 230 | 3300006175 | Ga0070712_100034161 | Ga0070712_1000341613 | 97 |
| 231 | 3300006175 | Ga0070712_100100837 | Ga0070712_1001008372 | 97 |
| 232 | 3300006175 | Ga0070712_100381251 | Ga0070712_1003812512 | 97 |
| 233 | 3300006175 | Ga0070712_100951656 | Ga0070712_1009516562 | 97 |
| 234 | 3300006237 | Ga0097621_100053562 | Ga0097621_1000535625 | 97 |
| 235 | 3300006237 | Ga0097621_100293126 | Ga0097621_1002931264 | 97 |
| 236 | 3300006852 | Ga0075433_10405572 | Ga0075433_104055721 | 97 |
| 237 | 3300006871 | Ga0075434_100215104 | Ga0075434_1002151042 | 97 |
| 238 | 3300006881 | Ga0068865_100045873 | Ga0068865_1000458732 | 97 |
| 239 | 3300006931 | Ga0097620_102058825 | Ga0097620_1020588252 | 97 |
| 240 | 3300009011 | Ga0105251_10275079 | Ga0105251_102750792 | 97 |
| 241 | 3300009092 | Ga0105250_10101522 | Ga0105250_101015222 | 97 |
| 242 | 3300009093 | Ga0105240_10066829 | Ga0105240_100668294 | 97 |
| 243 | 3300009093 | Ga0105240_10953666 | Ga0105240_109536662 | 97 |
| 244 | 3300009094 | Ga0111539_10368120 | Ga0111539_103681203 | 97 |
| 245 | 3300009098 | Ga0105245_10081524 | Ga0105245_100815243 | 97 |
| 246 | 3300009098 | Ga0105245_10303058 | Ga0105245_103030582 | 97 |
| 247 | 3300009098 | Ga0105245_10354237 | Ga0105245_103542372 | 97 |
| 248 | 3300009098 | Ga0105245_10451544 | Ga0105245_104515442 | 97 |
| 249 | 3300009098 | Ga0105245_10530389 | Ga0105245_105303892 | 97 |
| 250 | 3300009098 | Ga0105245_10542783 | Ga0105245_105427833 | 97 |
| 251 | 3300009148 | Ga0105243_10048678 | Ga0105243_100486783 | 97 |
| 252 | 3300009148 | Ga0105243_10064319 | Ga0105243_100643193 | 97 |
| 253 | 3300009148 | Ga0105243_10202514 | Ga0105243_102025142 | 97 |
| 254 | 3300009176 | Ga0105242_10072197 | Ga0105242_100721974 | 97 |
| 255 | 3300009176 | Ga0105242_10655132 | Ga0105242_106551322 | 97 |
| 256 | 3300009177 | Ga0105248_10093675 | Ga0105248_100936753 | 97 |
| 257 | 3300009177 | Ga0105248_10544088 | Ga0105248_105440883 | 97 |
| 258 | 3300009545 | Ga0105237_10065257 | Ga0105237_100652573 | 97 |
| 259 | 3300009545 | Ga0105237_10667520 | Ga0105237_106675202 | 97 |
| 260 | 3300009551 | Ga0105238_10030382 | Ga0105238_100303826 | 97 |
| 261 | 3300009551 | Ga0105238_10130758 | Ga0105238_101307584 | 97 |
| 262 | 3300010375 | Ga0105239_11627693 | Ga0105239_116276931 | 97 |
| 263 | 3300010375 | Ga0105239_11698649 | Ga0105239_116986491 | 97 |
| 264 | 3300011119 | Ga0105246_10020251 | Ga0105246_100202512 | 97 |
| 265 | 3300011119 | Ga0105246_10232916 | Ga0105246_102329162 | 97 |
| 266 | 3300013105 | Ga0157369_10003011 | Ga0157369_100030117 | 97 |
| 267 | 3300013296 | Ga0157374_10061262 | Ga0157374_100612624 | 97 |
| 268 | 3300013297 | Ga0157378_10011259 | Ga0157378_1001125911 | 97 |
| 269 | 3300013297 | Ga0157378_10019466 | Ga0157378_100194664 | 97 |
| 270 | 3300013297 | Ga0157378_10443320 | Ga0157378_104433202 | 97 |
| 271 | 3300013297 | Ga0157378_10605742 | Ga0157378_106057423 | 97 |
| 272 | 3300013307 | Ga0157372_10116383 | Ga0157372_101163832 | 97 |
| 273 | 3300013308 | Ga0157375_10023965 | Ga0157375_100239655 | 97 |
| 274 | 3300014325 | Ga0163163_10461590 | Ga0163163_104615901 | 97 |
| 275 | 3300014326 | Ga0157380_10409713 | Ga0157380_104097133 | 97 |
| 276 | 3300014497 | Ga0182008_10525138 | Ga0182008_105251382 | 97 |
| 277 | 3300014968 | Ga0157379_10004940 | Ga0157379_100049405 | 97 |
| 278 | 3300014969 | Ga0157376_10256904 | Ga0157376_102569043 | 97 |
| 279 | 3300020069 | Ga0197907_11113287 | Ga0197907_111132871 | 97 |
| 280 | 3300020070 | Ga0206356_11181670 | Ga0206356_111816703 | 97 |
| 281 | 3300020081 | Ga0206354_10192749 | Ga0206354_101927492 | 97 |
| 282 | 3300020082 | Ga0206353_11519024 | Ga0206353_115190241 | 97 |
| 283 | 3300020610 | Ga0154015_1564700 | Ga0154015_15647001 | 97 |
| 284 | 3300025321 | Ga0207656_10422685 | Ga0207656_104226852 | 97 |
| 285 | 3300025885 | Ga0207653_10000104 | Ga0207653_100001043 | 97 |
| 286 | 3300025898 | Ga0207692_10050397 | Ga0207692_100503971 | 97 |
| 287 | 3300025899 | Ga0207642_10094707 | Ga0207642_100947073 | 97 |
| 288 | 3300025899 | Ga0207642_10370164 | Ga0207642_103701643 | 97 |
| 289 | 3300025900 | Ga0207710_10000028 | Ga0207710_10000028211 | 97 |
| 290 | 3300025901 | Ga0207688_10054627 | Ga0207688_100546273 | 97 |
| 291 | 3300025901 | Ga0207688_10462781 | Ga0207688_104627812 | 97 |
| 292 | 3300025905 | Ga0207685_10015930 | Ga0207685_100159301 | 97 |
| 293 | 3300025906 | Ga0207699_10000108 | Ga0207699_1000010820 | 97 |
| 294 | 3300025906 | Ga0207699_10016835 | Ga0207699_100168352 | 97 |
| 295 | 3300025907 | Ga0207645_10030610 | Ga0207645_100306102 | 97 |
| 296 | 3300025909 | Ga0207705_10296201 | Ga0207705_102962012 | 97 |
| 297 | 3300025910 | Ga0207684_10003727 | Ga0207684_100037273 | 97 |
| 298 | 3300025911 | Ga0207654_10244190 | Ga0207654_102441902 | 97 |
| 299 | 3300025912 | Ga0207707_10001222 | Ga0207707_100012228 | 97 |
| 300 | 3300025912 | Ga0207707_10662707 | Ga0207707_106627072 | 97 |
| 301 | 3300025913 | Ga0207695_10134284 | Ga0207695_101342843 | 97 |
| 302 | 3300025913 | Ga0207695_10142269 | Ga0207695_101422691 | 97 |
| 303 | 3300025914 | Ga0207671_10094424 | Ga0207671_100944242 | 97 |
| 304 | 3300025915 | Ga0207693_10023053 | Ga0207693_100230531 | 97 |
| 305 | 3300025915 | Ga0207693_10186535 | Ga0207693_101865352 | 97 |
| 306 | 3300025916 | Ga0207663_10102884 | Ga0207663_101028843 | 97 |
| 307 | 3300025917 | Ga0207660_10106872 | Ga0207660_101068723 | 97 |
| 308 | 3300025921 | Ga0207652_10150398 | Ga0207652_101503984 | 97 |
| 309 | 3300025922 | Ga0207646_10141158 | Ga0207646_101411582 | 97 |
| 310 | 3300025923 | Ga0207681_10018368 | Ga0207681_100183685 | 97 |
| 311 | 3300025924 | Ga0207694_10199160 | Ga0207694_101991602 | 97 |
| 312 | 3300025925 | Ga0207650_10423071 | Ga0207650_104230712 | 97 |
| 313 | 3300025926 | Ga0207659_10071845 | Ga0207659_100718452 | 97 |
| 314 | 3300025926 | Ga0207659_10201001 | Ga0207659_102010013 | 97 |
| 315 | 3300025927 | Ga0207687_10128116 | Ga0207687_101281162 | 97 |
| 316 | 3300025927 | Ga0207687_10156282 | Ga0207687_101562822 | 97 |
| 317 | 3300025927 | Ga0207687_10214999 | Ga0207687_102149992 | 97 |
| 318 | 3300025927 | Ga0207687_10400942 | Ga0207687_104009422 | 97 |
| 319 | 3300025928 | Ga0207700_10044096 | Ga0207700_100440963 | 97 |
| 320 | 3300025929 | Ga0207664_11802116 | Ga0207664_118021162 | 97 |
| 321 | 3300025931 | Ga0207644_10008062 | Ga0207644_100080623 | 97 |
| 322 | 3300025933 | Ga0207706_11300176 | Ga0207706_113001762 | 97 |
| 323 | 3300025934 | Ga0207686_10709586 | Ga0207686_107095861 | 97 |
| 324 | 3300025935 | Ga0207709_10079791 | Ga0207709_100797912 | 97 |
| 325 | 3300025936 | Ga0207670_10487503 | Ga0207670_104875032 | 97 |
| 326 | 3300025938 | Ga0207704_10041126 | Ga0207704_100411264 | 97 |
| 327 | 3300025939 | Ga0207665_10021826 | Ga0207665_100218266 | 97 |
| 328 | 3300025939 | Ga0207665_10144039 | Ga0207665_101440393 | 97 |
| 329 | 3300025941 | Ga0207711_10000081 | Ga0207711_100000817 | 97 |
| 330 | 3300025941 | Ga0207711_10055185 | Ga0207711_100551852 | 97 |
| 331 | 3300025941 | Ga0207711_10322959 | Ga0207711_103229593 | 97 |
| 332 | 3300025942 | Ga0207689_10020603 | Ga0207689_100206033 | 97 |
| 333 | 3300025942 | Ga0207689_10045083 | Ga0207689_100450832 | 97 |
| 334 | 3300025942 | Ga0207689_10112150 | Ga0207689_101121503 | 97 |
| 335 | 3300025944 | Ga0207661_10000499 | Ga0207661_1000049929 | 97 |
| 336 | 3300025944 | Ga0207661_10271019 | Ga0207661_102710192 | 97 |
| 337 | 3300025949 | Ga0207667_10121515 | Ga0207667_101215152 | 97 |
| 338 | 3300025960 | Ga0207651_10107259 | Ga0207651_101072593 | 97 |
| 339 | 3300025961 | Ga0207712_10000016 | Ga0207712_10000016205 | 97 |
| 340 | 3300025972 | Ga0207668_10000577 | Ga0207668_100005777 | 97 |
| 341 | 3300025972 | Ga0207668_10017793 | Ga0207668_100177932 | 97 |
| 342 | 3300025981 | Ga0207640_10116545 | Ga0207640_101165451 | 97 |
| 343 | 3300025981 | Ga0207640_10250273 | Ga0207640_102502731 | 97 |
| 344 | 3300025986 | Ga0207658_10000237 | Ga0207658_1000023746 | 97 |
| 345 | 3300026023 | Ga0207677_10023895 | Ga0207677_100238954 | 97 |
| 346 | 3300026023 | Ga0207677_10031601 | Ga0207677_100316014 | 97 |
| 347 | 3300026035 | Ga0207703_10119658 | Ga0207703_101196583 | 97 |
| 348 | 3300026035 | Ga0207703_10315725 | Ga0207703_103157251 | 97 |
| 349 | 3300026035 | Ga0207703_10684923 | Ga0207703_106849233 | 97 |
| 350 | 3300026067 | Ga0207678_10460687 | Ga0207678_104606872 | 97 |
| 351 | 3300026067 | Ga0207678_11167613 | Ga0207678_111676131 | 97 |
| 352 | 3300026075 | Ga0207708_10098346 | Ga0207708_100983463 | 97 |
| 353 | 3300026075 | Ga0207708_10334825 | Ga0207708_103348252 | 97 |
| 354 | 3300026078 | Ga0207702_10520093 | Ga0207702_105200932 | 97 |
| 355 | 3300026088 | Ga0207641_10000284 | Ga0207641_1000028454 | 97 |
| 356 | 3300026088 | Ga0207641_10503428 | Ga0207641_105034282 | 97 |
| 357 | 3300026089 | Ga0207648_10006140 | Ga0207648_1000614010 | 97 |
| 358 | 3300026089 | Ga0207648_10016599 | Ga0207648_100165992 | 97 |
| 359 | 3300026095 | Ga0207676_10087037 | Ga0207676_100870374 | 97 |
| 360 | 3300026118 | Ga0207675_100004967 | Ga0207675_10000496711 | 97 |
| 361 | 3300026118 | Ga0207675_100159490 | Ga0207675_1001594902 | 97 |
| 362 | 3300028379 | Ga0268266_10003565 | Ga0268266_1000356512 | 97 |
| 363 | 3300028379 | Ga0268266_10056599 | Ga0268266_100565992 | 97 |
| 364 | 3300028380 | Ga0268265_10000056 | Ga0268265_10000056119 | 97 |
| 365 | 3300028380 | Ga0268265_11864185 | Ga0268265_118641852 | 97 |
| 366 | 3300028381 | Ga0268264_10000053 | Ga0268264_10000053149 | 97 |
| 367 | 3300028381 | Ga0268264_10123073 | Ga0268264_101230733 | 97 |
| 368 | 3300028381 | Ga0268264_10387377 | Ga0268264_103873772 | 97 |
| 369 | 3300034820 | Ga0373959_0150522 | Ga0373959_0150522_195_530 | 97 |
| 370 | 3300035114 | Ga0373939_0180636 | Ga0373939_0180636_274_609 | 97 |
| 371 | 3300035171 | Ga0373946_0068693 | Ga0373946_0068693_572_907 | 97 |
| 372 | 3300035242 | Ga0373962_0103947 | Ga0373962_0103947_489_824 | 97 |
| 373 | 3300035691 | Ga0373931_0675131 | Ga0373931_0675131_279_614 | 97 |
| 374 | 3300035691 | Ga0373931_0839572 | Ga0373931_0839572_64_399 | 97 |
| 375 | 3300035695 | Ga0373927_0129976 | Ga0373927_0129976_145_555 | 97 |
| 376 | 3300037068 | Ga0373925_0196362 | Ga0373925_0196362_192_602 | 97 |
| 377 | 3300041509 | Ga0451843_1168130 | Ga0451843_1168130_287_619 | 97 |
| 378 | 3300041512 | Ga0451853_3724327 | Ga0451853_3724327_36_371 | 97 |
| 379 | 3300044684 | Ga0466966_0002993 | Ga0466966_0002993_8668_9033 | 97 |
| 380 | 3300044684 | Ga0466966_0014847 | Ga0466966_0014847_2357_2689 | 97 |
| 381 | 3300044706 | Ga0466964_0648536 | Ga0466964_0648536_161_550 | 97 |
| 382 | 3300044719 | Ga0466971_0108571 | Ga0466971_0108571_13_402 | 97 |
| 383 | 3300044735 | Ga0466968_0055809 | Ga0466968_0055809_1138_1473 | 97 |
| 384 | 3300044765 | Ga0466970_0028286 | Ga0466970_0028286_2127_2468 | 97 |
| 385 | 3300044765 | Ga0466970_0114454 | Ga0466970_0114454_469_858 | 97 |
| 386 | 3300044842 | Ga0466957_0110848 | Ga0466957_0110848_952_1341 | 97 |
| 387 | 3300044842 | Ga0466957_0250273 | Ga0466957_0250273_793_1128 | 97 |
| 388 | 3300044901 | Ga0466960_0213703 | Ga0466960_0213703_646_978 | 97 |
| 389 | 3300045049 | Ga0466959_0017611 | Ga0466959_0017611_3391_3732 | 97 |
| 390 | 3300045049 | Ga0466959_0030433 | Ga0466959_0030433_3397_3729 | 97 |
| 391 | 3300045049 | Ga0466959_0051116 | Ga0466959_0051116_302_691 | 97 |
| 392 | 3300045049 | Ga0466959_0246902 | Ga0466959_0246902_585_920 | 97 |
| 393 | 3300045836 | Ga0466958_0006102 | Ga0466958_0006102_3406_3741 | 97 |
| 394 | 3300045976 | Ga0466967_0321370 | Ga0466967_0321370_571_960 | 97 |
| 395 | 3300045976 | Ga0466967_0349085 | Ga0466967_0349085_723_1055 | 97 |
| 396 | 3300046455 | Ga0495603_0009461 | Ga0495603_0009461_658_993 | 97 |
| 397 | 3300046459 | Ga0495629_0002949 | Ga0495629_0002949_3209_3544 | 97 |
| 398 | 3300046460 | Ga0495638_0003848 | Ga0495638_0003848_5358_5690 | 97 |
| 399 | 3300046461 | Ga0495641_0299328 | Ga0495641_0299328_191_523 | 97 |
| 400 | 3300046477 | Ga0495664_0025847 | Ga0495664_0025847_2266_2649 | 97 |
| 401 | 3300046499 | Ga0495594_0428273 | Ga0495594_0428273_92_427 | 97 |
| 402 | 3300046499 | Ga0495594_0479558 | Ga0495594_0479558_272_607 | 97 |
| 403 | 3300046506 | Ga0495583_0453410 | Ga0495583_0453410_23_355 | 97 |
| 404 | 3300046507 | Ga0495606_0039786 | Ga0495606_0039786_2566_2898 | 97 |
| 405 | 3300046517 | Ga0495630_0330960 | Ga0495630_0330960_392_748 | 97 |
| 406 | 3300046533 | Ga0495640_0014734 | Ga0495640_0014734_1256_1591 | 97 |
| 407 | 3300046533 | Ga0495640_0068642 | Ga0495640_0068642_1180_1524 | 97 |
| 408 | 3300046535 | Ga0495586_0019193 | Ga0495586_0019193_1947_2291 | 97 |
| 409 | 3300046543 | Ga0495645_0041072 | Ga0495645_0041072_1742_2125 | 97 |
| 410 | 3300046559 | Ga0495667_0030481 | Ga0495667_0030481_376_711 | 97 |
| 411 | 3300046615 | Ga0495656_0201303 | Ga0495656_0201303_277_609 | 97 |
| 412 | 3300046616 | Ga0495668_0247606 | Ga0495668_0247606_60_392 | 97 |
| 413 | 3300046642 | Ga0495634_0433592 | Ga0495634_0433592_227_571 | 97 |
| 414 | 3300046674 | Ga0495588_0758129 | Ga0495588_0758129_130_465 | 97 |
| 415 | 3300046681 | Ga0495647_0114840 | Ga0495647_0114840_683_1015 | 97 |
| 416 | 3300046681 | Ga0495647_0394345 | Ga0495647_0394345_51_395 | 97 |
| 417 | 3300046694 | Ga0495649_0410856 | Ga0495649_0410856_150_482 | 97 |
| 418 | 3300047315 | Ga0495581_0023954 | Ga0495581_0023954_1688_2032 | 97 |
| 419 | 3300047318 | Ga0495636_0449273 | Ga0495636_0449273_128_463 | 97 |
| 420 | 3300047319 | Ga0495674_0004759 | Ga0495674_0004759_12566_12901 | 97 |
| 421 | 3300047321 | Ga0495676_0045943 | Ga0495676_0045943_2520_2852 | 97 |
| 422 | 3300047321 | Ga0495676_0084310 | Ga0495676_0084310_1811_2146 | 97 |
| 423 | 3300047322 | Ga0495680_0380112 | Ga0495680_0380112_126_482 | 97 |
| 424 | 3300047322 | Ga0495680_1090499 | Ga0495680_1090499_53_409 | 97 |
| 425 | 3300048903 | Ga0496100_0035031 | Ga0496100_0035031_2124_2480 | 97 |
| 426 | 3300048903 | Ga0496100_0037807 | Ga0496100_0037807_1170_1505 | 97 |
| 427 | 3300048903 | Ga0496100_0794033 | Ga0496100_0794033_117_461 | 97 |
| 428 | 3300048903 | Ga0496100_0916487 | Ga0496100_0916487_232_564 | 97 |
| 429 | 3300048904 | Ga0496101_0002562 | Ga0496101_0002562_9213_9569 | 97 |
| 430 | 3300048904 | Ga0496101_0044662 | Ga0496101_0044662_1012_1356 | 97 |
| 431 | 3300048904 | Ga0496101_0058031 | Ga0496101_0058031_2427_2762 | 97 |
| 432 | 3300048904 | Ga0496101_0128129 | Ga0496101_0128129_380_712 | 97 |
| 433 | 3300048904 | Ga0496101_0151578 | Ga0496101_0151578_1168_1503 | 97 |
| 434 | 3300048905 | Ga0496102_0000070 | Ga0496102_0000070_110303_110659 | 97 |
| 435 | 3300048905 | Ga0496102_0113732 | Ga0496102_0113732_219_554 | 97 |
| 436 | 3300048905 | Ga0496102_0170984 | Ga0496102_0170984_921_1265 | 97 |
| 437 | 3300048906 | Ga0496103_0000484 | Ga0496103_0000484_13425_13781 | 97 |
| 438 | 3300048906 | Ga0496103_0073887 | Ga0496103_0073887_64_396 | 97 |
| 439 | 3300048906 | Ga0496103_0181376 | Ga0496103_0181376_918_1253 | 97 |
| 440 | 3300048906 | Ga0496103_0448726 | Ga0496103_0448726_137_481 | 97 |
| 441 | 3300048907 | Ga0496104_0098575 | Ga0496104_0098575_585_917 | 97 |
| 442 | 3300048907 | Ga0496104_0174236 | Ga0496104_0174236_34_369 | 97 |
| 443 | 3300048907 | Ga0496104_0474812 | Ga0496104_0474812_134_478 | 97 |
| 444 | 3300048908 | Ga0496105_0042725 | Ga0496105_0042725_1435_1767 | 97 |
| 445 | 3300048908 | Ga0496105_0071701 | Ga0496105_0071701_1489_1833 | 97 |
| 446 | 3300048909 | Ga0496106_0015820 | Ga0496106_0015820_2225_2560 | 97 |
| 447 | 3300048909 | Ga0496106_0164290 | Ga0496106_0164290_205_561 | 97 |
| 448 | 3300048909 | Ga0496106_0227332 | Ga0496106_0227332_124_468 | 97 |
| 449 | 3300048909 | Ga0496106_0395165 | Ga0496106_0395165_91_423 | 97 |
| 450 | 3300048910 | Ga0496107_0005085 | Ga0496107_0005085_7062_7397 | 97 |
| 451 | 3300048910 | Ga0496107_0039437 | Ga0496107_0039437_1189_1545 | 97 |
| 452 | 3300048910 | Ga0496107_0811233 | Ga0496107_0811233_180_512 | 97 |
| 453 | 3300048910 | Ga0496107_1268105 | Ga0496107_1268105_23_355 | 97 |
| 454 | 3300048911 | Ga0496108_0075692 | Ga0496108_0075692_2182_2517 | 97 |
| 455 | 3300048911 | Ga0496108_0586446 | Ga0496108_0586446_358_702 | 97 |
| 456 | 3300048912 | Ga0496109_0103423 | Ga0496109_0103423_595_930 | 97 |
| 457 | 3300048912 | Ga0496109_0292418 | Ga0496109_0292418_1174_1518 | 97 |
| 458 | 3300048912 | Ga0496109_0840844 | Ga0496109_0840844_92_424 | 97 |
| 459 | 3300048913 | Ga0496110_0068879 | Ga0496110_0068879_1156_1491 | 97 |
| 460 | 3300048913 | Ga0496110_0156111 | Ga0496110_0156111_969_1301 | 97 |
| 461 | 3300048913 | Ga0496110_0355005 | Ga0496110_0355005_284_619 | 97 |
| 462 | 3300048914 | Ga0496111_0021220 | Ga0496111_0021220_1477_1812 | 97 |
| 463 | 3300048914 | Ga0496111_0202363 | Ga0496111_0202363_308_640 | 97 |
| 464 | 3300048914 | Ga0496111_0264342 | Ga0496111_0264342_548_892 | 97 |
| 465 | 3300048915 | Ga0496112_0417678 | Ga0496112_0417678_223_558 | 97 |
| 466 | 3300048916 | Ga0496113_0351052 | Ga0496113_0351052_793_1128 | 97 |
| 467 | 3300048917 | Ga0496114_0015447 | Ga0496114_0015447_4354_4689 | 97 |
| 468 | 3300048917 | Ga0496114_0085445 | Ga0496114_0085445_2028_2372 | 97 |
| 469 | 3300048917 | Ga0496114_0780187 | Ga0496114_0780187_251_583 | 97 |
| 470 | 3300048917 | Ga0496114_0806206 | Ga0496114_0806206_267_623 | 97 |
| 471 | 3300048918 | Ga0496115_0247707 | Ga0496115_0247707_864_1226 | 97 |
| 472 | 3300048918 | Ga0496115_0433115 | Ga0496115_0433115_459_791 | 97 |
| 473 | 3300048918 | Ga0496115_0592319 | Ga0496115_0592319_35_370 | 97 |
| 474 | 3300048919 | Ga0496116_0011237 | Ga0496116_0011237_5933_6289 | 97 |
| 475 | 3300048920 | Ga0496117_0000319 | Ga0496117_0000319_8479_8835 | 97 |
| 476 | 3300048921 | Ga0496118_0001764 | Ga0496118_0001764_7159_7515 | 97 |
| 477 | 3300048922 | Ga0496119_0015609 | Ga0496119_0015609_595_951 | 97 |
| 478 | 3300048923 | Ga0496120_0035754 | Ga0496120_0035754_289_645 | 97 |
| 479 | 3300048923 | Ga0496120_0266287 | Ga0496120_0266287_83_415 | 97 |
| 480 | 3300048924 | Ga0496121_0002593 | Ga0496121_0002593_20069_20425 | 97 |
| 481 | 3300048928 | Ga0496125_0120921 | Ga0496125_0120921_657_1013 | 97 |
| 482 | 3300048928 | Ga0496125_0172481 | Ga0496125_0172481_1108_1440 | 97 |
| 483 | 3300048929 | Ga0496126_0065474 | Ga0496126_0065474_1053_1385 | 97 |
| 484 | 3300049571 | Ga0501034_0437485 | Ga0501034_0437485_426_758 | 97 |
| 485 | 3300049585 | Ga0501069_0068600 | Ga0501069_0068600_694_1032 | 97 |
| 486 | 3300049586 | Ga0501070_0013545 | Ga0501070_0013545_5381_5719 | 97 |
| 487 | 3300049586 | Ga0501070_0474849 | Ga0501070_0474849_477_809 | 97 |
| 488 | 3300049587 | Ga0501071_0308198 | Ga0501071_0308198_754_1092 | 97 |
| 489 | 3300049589 | Ga0501073_0786025 | Ga0501073_0786025_67_405 | 97 |
| 490 | 3300049590 | Ga0501074_0053967 | Ga0501074_0053967_1931_2269 | 97 |
| 491 | 3300050496 | nmdc:mga07m45_578453_c1 | nmdc:mga07m45_578453_c1_29_361 | 97 |
| 492 | 3300050512 | nmdc:mga0n895_149110_c1 | nmdc:mga0n895_149110_c1_1205_1543 | 97 |
| 493 | 3300050512 | nmdc:mga0n895_437385_c1 | nmdc:mga0n895_437385_c1_767_1102 | 97 |
| 494 | 3300050513 | nmdc:mga0rr50_350699_c1 | nmdc:mga0rr50_350699_c1_346_684 | 97 |
| 495 | 3300050515 | nmdc:mga0a205_1333364_c1 | nmdc:mga0a205_1333364_c1_206_541 | 97 |
| 496 | 3300050515 | nmdc:mga0a205_412192_c1 | nmdc:mga0a205_412192_c1_722_1060 | 97 |
| 497 | 3300050516 | nmdc:mga0sz30_50787_c2 | nmdc:mga0sz30_50787_c2_231_563 | 97 |
| 498 | 3300053077 | Ga0495601_0031681 | Ga0495601_0031681_2885_3268 | 97 |
| 499 | 3300053078 | Ga0495612_0051091 | Ga0495612_0051091_1115_1498 | 97 |
| 500 | 3300053139 | Ga0500568_0182718 | Ga0500568_0182718_160_492 | 97 |
| 501 | 3300053146 | Ga0500588_0141757 | Ga0500588_0141757_268_600 | 97 |
| 502 | 3300053153 | Ga0500616_0040117 | Ga0500616_0040117_1404_1736 | 97 |
| 503 | 3300053178 | Ga0500637_0526571 | Ga0500637_0526571_63_395 | 97 |
| 504 | 3300053730 | Ga0500645_000006 | Ga0500645_000006_82296_82628 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a1v-assembly1.cif.gz_A | crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 | 0.7633 | 8 | 89 |
| 3h9x-assembly1.cif.gz_A | crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 | 0.6891 | 9 | 86 |
| 2od0-assembly1.cif.gz_B | the crystal structure of gene product vp1028 from vibrio parahaemolyticus | 0.6781 | 6 | 85 |
| 2a1v-assembly1.cif.gz_A | crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 | 0.6549 | 8 | 89 |
| 6aii-assembly1.cif.gz_A | catalytic domain of pdagac | 0.6127 | 29 | 53 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2a1vA00 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7633 | 8 | 89 | 3.90.1150.30 |
| af_P0AAT2_2_121_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.687 | 5 | 82 | 3.90.1150.30 |
| 3h9xA00 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6858 | 9 | 86 | 3.90.1150.30 |
| af_P0AF50_1_117_3.90.1150.30 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6791 | 9 | 95 | 3.90.1150.30 |
| 2a1vA00 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6549 | 8 | 89 | 3.90.1150.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I7WJ16-F1-model_v4 | TfoX N-terminal domain-containing protein | 0.9868 | 3 | 89 |
|
| AF-A0A4R8J6C8-F1-model_v4 | deleted | 0.9818 | 5 | 89 |
|
| AF-A0A100X675-F1-model_v4 | deleted | 0.9732 | 3 | 89 |
|
| AF-A0A413RIH2-F1-model_v4 | TfoX family protein | 0.972 | 3 | 89 |
|
| AF-A0A1H0PB70-F1-model_v4 | TfoX N-terminal domain-containing protein | 0.9707 | 1 | 89 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar