F456167

General Info

Members Datasets Scaffolds Average Seq Length
504 279 501 113

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100323617|Ga0075363_1003236172
Length 121
Sequence VYDEDLADRIRELLGVEEGLTEQRMFGGLAFLVSGNMAVAASGRGGLMVRVDPEKSGKLVATSTAEPMVMKGRSMAGWLRVPSEDVRTKRQLSRWVTIGTTYARSLPPKPMKKASPRRRSG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2643221692 Nocardia sp. Root136 Isolate Unclassified
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 1.79
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 12.5
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10003363 3300002459 Bacteria 3225
2 Ga0070658_10281258 3300005327 Unclassified 1416
3 Ga0070658_10427471 3300005327 Bacteria 1140
4 Ga0070683_100018705 3300005329 Bacteria 6140
5 Ga0070690_100204486 3300005330 Bacteria 1376
6 Ga0070670_100292403 3300005331 Bacteria 1424
7 Ga0068869_100097806 3300005334 Bacteria 2216
8 Ga0068869_100176455 3300005334 Bacteria 1672
9 Ga0070680_100030387 3300005336 Bacteria 4340
10 Ga0070680_100157412 3300005336 Bacteria 1909
11 Ga0070680_100219990 3300005336 Bacteria 1603
12 Ga0070680_101355245 3300005336 Bacteria 616
13 Ga0070682_100131843 3300005337 Bacteria 1692
14 Ga0070682_101280666 3300005337 Bacteria 622
15 Ga0068868_100079051 3300005338 Bacteria 2634
16 Ga0068868_100138892 3300005338 Bacteria 1993
17 Ga0068868_100780253 3300005338 Bacteria 861
18 Ga0070660_100016340 3300005339 Bacteria 5386
19 Ga0070689_100047141 3300005340 Bacteria 3323
20 Ga0070689_100401364 3300005340 Bacteria 1159
21 Ga0070691_10372082 3300005341 Bacteria 798
22 Ga0070661_101671388 3300005344 Unclassified 539
23 Ga0070692_10181334 3300005345 Bacteria 1221
24 Ga0070668_100001337 3300005347 Bacteria 17610
25 Ga0070668_101459106 3300005347 Bacteria 625
26 Ga0070675_100506013 3300005354 Bacteria 1089
27 Ga0070675_101434889 3300005354 Bacteria 636
28 Ga0070671_100002936 3300005355 Bacteria 13260
29 Ga0070671_100389013 3300005355 Bacteria 1192
30 Ga0070671_101344034 3300005355 Bacteria 631
31 Ga0070674_100052434 3300005356 Bacteria 2814
32 Ga0070674_100844477 3300005356 Bacteria 794
33 Ga0070673_100048949 3300005364 Bacteria 3298
34 Ga0070673_100529061 3300005364 Bacteria 1069
35 Ga0070688_100274624 3300005365 Bacteria 1208
36 Ga0070688_100568513 3300005365 Bacteria 864
37 Ga0070709_10001282 3300005434 Bacteria 13723
38 Ga0070709_10034816 3300005434 Bacteria 3057
39 Ga0070709_10069322 3300005434 Bacteria 2271
40 Ga0070713_100008375 3300005436 Bacteria 7330
41 Ga0070710_10011337 3300005437 Bacteria 4404
42 Ga0070710_10013389 3300005437 Bacteria 4107
43 Ga0070710_10107240 3300005437 Bacteria 1673
44 Ga0070711_100008659 3300005439 Bacteria 6242
45 Ga0070705_101059368 3300005440 Bacteria 661
46 Ga0070700_100135243 3300005441 Bacteria 1668
47 Ga0070700_100460228 3300005441 Bacteria 970
48 Ga0070700_101944632 3300005441 Bacteria 509
49 Ga0070694_100285322 3300005444 Bacteria 1260
50 Ga0070708_100002445 3300005445 Bacteria 14382
51 Ga0070663_100445501 3300005455 Bacteria 1066
52 Ga0070663_100768856 3300005455 Bacteria 824
53 Ga0070678_100407034 3300005456 Bacteria 1183
54 Ga0070681_10091331 3300005458 Bacteria 2995
55 Ga0070681_10148603 3300005458 Bacteria 2271
56 Ga0070681_10176512 3300005458 Bacteria 2058
57 Ga0070681_10209040 3300005458 Archaea 1868
58 Ga0068867_100163401 3300005459 Bacteria 1757
59 Ga0070685_10095953 3300005466 Bacteria 1803
60 Ga0070706_100003749 3300005467 Bacteria 14850
61 Ga0070707_100069770 3300005468 Bacteria 3384
62 Ga0070707_101224277 3300005468 Bacteria 717
63 Ga0070698_100058228 3300005471 Bacteria 3906
64 Ga0070679_100013997 3300005530 Bacteria 7690
65 Ga0070679_100030192 3300005530 Bacteria 5350
66 Ga0070679_100048059 3300005530 Bacteria 4252
67 Ga0070679_100090827 3300005530 Bacteria 3042
68 Ga0070684_100021205 3300005535 Bacteria 5401
69 Ga0070684_100049325 3300005535 Bacteria 3653
70 Ga0070684_100210573 3300005535 Bacteria 1772
71 Ga0068853_100469225 3300005539 Bacteria 1185
72 Ga0068853_100953755 3300005539 Bacteria 825
73 Ga0068853_102023118 3300005539 Bacteria 559
74 Ga0070686_100205429 3300005544 Bacteria 1415
75 Ga0070695_100561844 3300005545 Bacteria 891
76 Ga0070696_100041938 3300005546 Bacteria 3164
77 Ga0070693_100021688 3300005547 Bacteria 3405
78 Ga0070693_100071398 3300005547 Bacteria 2046
79 Ga0070665_100005421 3300005548 Bacteria 13155
80 Ga0070665_100013445 3300005548 Bacteria 8234
81 Ga0070665_100497668 3300005548 Bacteria 1230
82 Ga0070704_100153965 3300005549 Bacteria 1811
83 Ga0068855_100147820 3300005563 Bacteria 2674
84 Ga0068855_100161010 3300005563 Bacteria 2547
85 Ga0068857_100090400 3300005577 Bacteria 2740
86 Ga0068854_100076164 3300005578 Bacteria 2465
87 Ga0068854_100550352 3300005578 Bacteria 979
88 Ga0070702_100034336 3300005615 Bacteria 2795
89 Ga0070702_100099958 3300005615 Bacteria 1777
90 Ga0070702_100242340 3300005615 Bacteria 1217
91 Ga0070702_100787318 3300005615 Bacteria 734
92 Ga0070702_101071924 3300005615 Bacteria 642
93 Ga0068859_102059857 3300005617 Bacteria 630
94 Ga0068864_100322084 3300005618 Bacteria 1452
95 Ga0068864_100865401 3300005618 Bacteria 891
96 Ga0068864_101187848 3300005618 Bacteria 761
97 Ga0068866_10173016 3300005718 Bacteria 1269
98 Ga0068866_10245550 3300005718 Bacteria 1093
99 Ga0068861_100010457 3300005719 Bacteria 6440
100 Ga0068861_100130486 3300005719 Bacteria 2039
101 Ga0068863_100000121 3300005841 Bacteria 81842
102 Ga0068863_100029655 3300005841 Bacteria 5222
103 Ga0068863_101048135 3300005841 Bacteria 819
104 Ga0068858_100074274 3300005842 Bacteria 3157
105 Ga0068858_100135395 3300005842 Bacteria 2312
106 Ga0068858_100759135 3300005842 Bacteria 945
107 Ga0068858_101046212 3300005842 Bacteria 801
108 Ga0068858_101643156 3300005842 Bacteria 634
109 Ga0068860_100480583 3300005843 Bacteria 1238
110 Ga0068860_100745406 3300005843 Bacteria 991
111 Ga0068862_100000045 3300005844 Bacteria 155641
112 Ga0068862_100303480 3300005844 Bacteria 1469
113 Ga0068862_101039131 3300005844 Bacteria 812
114 Ga0081538_10003325 3300005981 Bacteria 15227
115 Ga0081539_10133019 3300005985 Bacteria 1219
116 Ga0075363_100323617 3300006048 Bacteria 897
117 Ga0070715_10020728 3300006163 Bacteria 2539
118 Ga0070716_100003011 3300006173 Bacteria 7857
119 Ga0070712_100034161 3300006175 Bacteria 3445
120 Ga0070712_100100837 3300006175 Bacteria 2134
121 Ga0070712_100381251 3300006175 Bacteria 1161
122 Ga0070712_100951656 3300006175 Bacteria 742
123 Ga0097621_100053562 3300006237 Bacteria 3289
124 Ga0097621_100293126 3300006237 Bacteria 1435
125 Ga0075433_10405572 3300006852 Bacteria 1202
126 Ga0075434_100215104 3300006871 Bacteria 1942
127 Ga0068865_100045873 3300006881 Bacteria 2997
128 Ga0097620_102058825 3300006931 Bacteria 630
129 Ga0105251_10275079 3300009011 Bacteria 761
130 Ga0105250_10101522 3300009092 Bacteria 1174
131 Ga0105240_10005139 3300009093 Bacteria 19587
132 Ga0105240_10066829 3300009093 Bacteria 4458
133 Ga0105240_10210727 3300009093 Bacteria 2271
134 Ga0105240_10953666 3300009093 Bacteria 920
135 Ga0111539_10368120 3300009094 Bacteria 1673
136 Ga0105245_10081524 3300009098 Bacteria 2958
137 Ga0105245_10303058 3300009098 Bacteria 1568
138 Ga0105245_10354237 3300009098 Bacteria 1455
139 Ga0105245_10451544 3300009098 Bacteria 1294
140 Ga0105245_10530389 3300009098 Unclassified 1197
141 Ga0105245_10542783 3300009098 Bacteria 1184
142 Ga0105247_10287364 3300009101 Bacteria 1136
143 Ga0105243_10048678 3300009148 Bacteria 3342
144 Ga0105243_10064319 3300009148 Bacteria 2943
145 Ga0105243_10202514 3300009148 Bacteria 1742
146 Ga0105243_11730741 3300009148 Bacteria 655
147 Ga0105242_10072197 3300009176 Bacteria 2866
148 Ga0105242_10194900 3300009176 Bacteria 1796
149 Ga0105242_10655132 3300009176 Bacteria 1022
150 Ga0105248_10093675 3300009177 Bacteria 3383
151 Ga0105248_10281636 3300009177 Bacteria 1872
152 Ga0105248_10544088 3300009177 Bacteria 1310
153 Ga0105237_10065257 3300009545 Bacteria 3637
154 Ga0105237_10153989 3300009545 Bacteria 2295
155 Ga0105237_10667520 3300009545 Bacteria 1046
156 Ga0105238_10030382 3300009551 Bacteria 5499
157 Ga0105238_10130758 3300009551 Bacteria 2488
158 Ga0105238_10562370 3300009551 Bacteria 1146
159 Ga0105239_11627693 3300010375 Bacteria 747
160 Ga0105239_11698649 3300010375 Bacteria 731
161 Ga0105246_10020251 3300011119 Bacteria 4265
162 Ga0105246_10232916 3300011119 Bacteria 1451
163 Ga0105246_10543601 3300011119 Bacteria 994
164 Ga0157373_10328168 3300013100 Bacteria 1089
165 Ga0157370_10087610 3300013104 Bacteria 2924
166 Ga0157369_10003011 3300013105 Bacteria 20152
167 Ga0157369_10373485 3300013105 Bacteria 1480
168 Ga0157374_10061262 3300013296 Bacteria 3524
169 Ga0157378_10011259 3300013297 Bacteria 7825
170 Ga0157378_10019466 3300013297 Bacteria 5967
171 Ga0157378_10443320 3300013297 Bacteria 1287
172 Ga0157378_10605742 3300013297 Bacteria 1107
173 Ga0157372_10116383 3300013307 Bacteria 3065
174 Ga0157375_10023965 3300013308 Bacteria 5640
175 Ga0157375_10397054 3300013308 Bacteria 1546
176 Ga0163163_10461590 3300014325 Bacteria 1330
177 Ga0157380_10409713 3300014326 Bacteria 1289
178 Ga0157380_10867634 3300014326 Bacteria 926
179 Ga0182008_10525138 3300014497 Bacteria 654
180 Ga0157379_10004940 3300014968 Bacteria 11445
181 Ga0157379_10350640 3300014968 Bacteria 1351
182 Ga0157376_10256904 3300014969 Bacteria 1635
183 Ga0163161_10438109 3300017792 Bacteria 1054
184 Ga0197907_10233898 3300020069 Bacteria 1702
185 Ga0197907_11113287 3300020069 Bacteria 508
186 Ga0206356_10104063 3300020070 Bacteria 2077
187 Ga0206356_11181670 3300020070 Bacteria 2355
188 Ga0206354_10192749 3300020081 Bacteria 901
189 Ga0206354_10258447 3300020081 Bacteria 2878
190 Ga0206353_10319123 3300020082 Bacteria 3561
191 Ga0206353_11519024 3300020082 Bacteria 5574
192 Ga0154015_1564700 3300020610 Bacteria 552
193 Ga0207656_10422685 3300025321 Bacteria 672
194 Ga0207653_10000104 3300025885 Bacteria 59204
195 Ga0207692_10050397 3300025898 Bacteria 2105
196 Ga0207642_10094707 3300025899 Bacteria 1484
197 Ga0207642_10370164 3300025899 Bacteria 850
198 Ga0207710_10000028 3300025900 Bacteria 304525
199 Ga0207688_10054627 3300025901 Bacteria 2241
200 Ga0207688_10462781 3300025901 Bacteria 792
201 Ga0207685_10015930 3300025905 Bacteria 2394
202 Ga0207699_10000108 3300025906 Bacteria 58752
203 Ga0207699_10016835 3300025906 Bacteria 3834
204 Ga0207645_10030610 3300025907 Bacteria 3468
205 Ga0207705_10296201 3300025909 Bacteria 1240
206 Ga0207684_10003727 3300025910 Bacteria 14762
207 Ga0207654_10244190 3300025911 Bacteria 1201
208 Ga0207707_10001222 3300025912 Bacteria 24136
209 Ga0207707_10662707 3300025912 Archaea 879
210 Ga0207695_10036594 3300025913 Bacteria 5305
211 Ga0207695_10134284 3300025913 Bacteria 2429
212 Ga0207695_10142269 3300025913 Bacteria 2346
213 Ga0207695_10859692 3300025913 Bacteria 787
214 Ga0207671_10094424 3300025914 Bacteria 2257
215 Ga0207693_10023053 3300025915 Bacteria 4944
216 Ga0207693_10186535 3300025915 Bacteria 1632
217 Ga0207663_10102884 3300025916 Bacteria 1922
218 Ga0207660_10073729 3300025917 Bacteria 2489
219 Ga0207660_10106872 3300025917 Bacteria 2099
220 Ga0207660_10338229 3300025917 Bacteria 1204
221 Ga0207657_10025770 3300025919 Bacteria 5416
222 Ga0207649_10129278 3300025920 Bacteria 1713
223 Ga0207652_10142689 3300025921 Bacteria 2142
224 Ga0207652_10150398 3300025921 Bacteria 2084
225 Ga0207646_10141158 3300025922 Bacteria 2170
226 Ga0207646_11578336 3300025922 Bacteria 567
227 Ga0207681_10018368 3300025923 Bacteria 4406
228 Ga0207694_10199160 3300025924 Bacteria 1629
229 Ga0207650_10423071 3300025925 Bacteria 1105
230 Ga0207659_10071845 3300025926 Bacteria 2528
231 Ga0207659_10201001 3300025926 Bacteria 1592
232 Ga0207687_10128116 3300025927 Bacteria 1909
233 Ga0207687_10156282 3300025927 Bacteria 1745
234 Ga0207687_10214999 3300025927 Bacteria 1510
235 Ga0207687_10400942 3300025927 Bacteria 1128
236 Ga0207700_10044096 3300025928 Bacteria 3281
237 Ga0207664_10165189 3300025929 Bacteria 1891
238 Ga0207664_10802364 3300025929 Bacteria 847
239 Ga0207664_11802116 3300025929 Bacteria 535
240 Ga0207644_10008062 3300025931 Bacteria 6892
241 Ga0207706_11300176 3300025933 Bacteria 601
242 Ga0207686_10709586 3300025934 Bacteria 800
243 Ga0207686_11115240 3300025934 Bacteria 644
244 Ga0207709_10079791 3300025935 Bacteria 2105
245 Ga0207670_10487503 3300025936 Bacteria 999
246 Ga0207669_10044167 3300025937 Bacteria 2616
247 Ga0207704_10041126 3300025938 Bacteria 2707
248 Ga0207665_10021826 3300025939 Bacteria 4210
249 Ga0207665_10144039 3300025939 Bacteria 1702
250 Ga0207711_10000081 3300025941 Bacteria 102547
251 Ga0207711_10055185 3300025941 Bacteria 3411
252 Ga0207711_10322959 3300025941 Bacteria 1427
253 Ga0207689_10020603 3300025942 Bacteria 5547
254 Ga0207689_10045083 3300025942 Bacteria 3647
255 Ga0207689_10112150 3300025942 Bacteria 2242
256 Ga0207661_10000499 3300025944 Bacteria 25254
257 Ga0207661_10113223 3300025944 Bacteria 2298
258 Ga0207661_10271019 3300025944 Bacteria 1515
259 Ga0207667_10121515 3300025949 Bacteria 2691
260 Ga0207667_11542888 3300025949 Bacteria 634
261 Ga0207651_10107259 3300025960 Bacteria 2087
262 Ga0207712_10000016 3300025961 Bacteria 343014
263 Ga0207668_10000577 3300025972 Bacteria 22902
264 Ga0207668_10017793 3300025972 Bacteria 4460
265 Ga0207640_10116545 3300025981 Bacteria 1905
266 Ga0207640_10250273 3300025981 Bacteria 1375
267 Ga0207658_10000237 3300025986 Bacteria 58047
268 Ga0207658_10748526 3300025986 Bacteria 885
269 Ga0207677_10023895 3300026023 Bacteria 3785
270 Ga0207677_10031601 3300026023 Bacteria 3392
271 Ga0207703_10119658 3300026035 Bacteria 2259
272 Ga0207703_10315725 3300026035 Bacteria 1430
273 Ga0207703_10684923 3300026035 Bacteria 974
274 Ga0207678_10460687 3300026067 Bacteria 1106
275 Ga0207678_11167613 3300026067 Bacteria 682
276 Ga0207708_10098346 3300026075 Bacteria 2262
277 Ga0207708_10334825 3300026075 Bacteria 1238
278 Ga0207702_10520093 3300026078 Bacteria 1162
279 Ga0207641_10000284 3300026088 Bacteria 63546
280 Ga0207641_10503428 3300026088 Bacteria 1176
281 Ga0207648_10006140 3300026089 Bacteria 11973
282 Ga0207648_10016599 3300026089 Bacteria 6721
283 Ga0207676_10087037 3300026095 Bacteria 2554
284 Ga0207676_12183681 3300026095 Bacteria 552
285 Ga0207675_100004967 3300026118 Bacteria 12816
286 Ga0207675_100159490 3300026118 Bacteria 2151
287 Ga0207683_10731394 3300026121 Bacteria 918
288 Ga0268266_10003565 3300028379 Bacteria 15420
289 Ga0268266_10056599 3300028379 Bacteria 3373
290 Ga0268266_10271351 3300028379 Bacteria 1575
291 Ga0268265_10000056 3300028380 Bacteria 155720
292 Ga0268265_11864185 3300028380 Bacteria 608
293 Ga0268264_10000053 3300028381 Bacteria 320368
294 Ga0268264_10123073 3300028381 Bacteria 2289
295 Ga0268264_10387377 3300028381 Bacteria 1340
296 Ga0265327_10000001 3300031251 Bacteria 894475
297 Ga0373959_0150522 3300034820 Bacteria 588
298 Ga0373934_0079766 3300035086 Bacteria 1315
299 Ga0373944_0313998 3300035089 Unclassified 590
300 Ga0373923_0016372 3300035111 Bacteria 2815
301 Ga0373936_0018358 3300035113 Bacteria 2701
302 Ga0373939_0180636 3300035114 Bacteria 787
303 Ga0373945_0039037 3300035116 Bacteria 1710
304 Ga0373954_0100182 3300035118 Bacteria 1397
305 Ga0373957_0026746 3300035120 Bacteria 2090
306 Ga0373943_0055449 3300035170 Bacteria 1963
307 Ga0373946_0068693 3300035171 Bacteria 1525
308 Ga0373946_0244470 3300035171 Unclassified 873
309 Ga0373955_0110129 3300035172 Bacteria 1591
310 Ga0373962_0103947 3300035242 Bacteria 889
311 Ga0373924_0012146 3300035410 Bacteria 3213
312 Ga0373924_0054154 3300035410 Bacteria 1667
313 Ga0373931_0675131 3300035691 Unclassified 681
314 Ga0373931_0839572 3300035691 Bacteria 614
315 Ga0373935_0130620 3300035692 Bacteria 1687
316 Ga0373927_0078892 3300035695 Bacteria 2132
317 Ga0373927_0129976 3300035695 Bacteria 1645
318 Ga0373933_0147054 3300035724 Bacteria 1490
319 Ga0373947_0205987 3300035725 Bacteria 1288
320 Ga0373937_0042360 3300036401 Bacteria 4153
321 Ga0373925_0056567 3300037068 Bacteria 2938
322 Ga0373925_0196362 3300037068 Bacteria 1603
323 Ga0373925_0922976 3300037068 Unclassified 719
324 Ga0395900_0009608 3300037418 Bacteria 9917
325 Ga0395898_0299549 3300037466 Bacteria 1534
326 Ga0395898_0611367 3300037466 Bacteria 1033
327 Ga0395905_1395132 3300037471 Bacteria 605
328 Ga0395901_0739014 3300038443 Bacteria 978
329 Ga0436363_1498781 3300039450 Bacteria 548
330 Ga0451843_1168130 3300041509 Bacteria 661
331 Ga0451853_3724327 3300041512 Bacteria 634
332 Ga0466966_0002993 3300044684 Bacteria 11134
333 Ga0466966_0014847 3300044684 Bacteria 5153
334 Ga0466966_0052982 3300044684 Bacteria 2575
335 Ga0466963_0110137 3300044694 Bacteria 1890
336 Ga0466963_0522808 3300044694 Bacteria 838
337 Ga0466964_0648536 3300044706 Bacteria 584
338 Ga0466971_0108571 3300044719 Bacteria 1279
339 Ga0466968_0055809 3300044735 Bacteria 1696
340 Ga0466970_0028286 3300044765 Bacteria 2944
341 Ga0466970_0114454 3300044765 Bacteria 1474
342 Ga0466957_0110848 3300044842 Bacteria 1740
343 Ga0466957_0250273 3300044842 Bacteria 1178
344 Ga0466960_0213703 3300044901 Bacteria 1058
345 Ga0466959_0017611 3300045049 Bacteria 5238
346 Ga0466959_0021115 3300045049 Bacteria 4800
347 Ga0466959_0030433 3300045049 Bacteria 3997
348 Ga0466959_0051116 3300045049 Bacteria 3033
349 Ga0466959_0246902 3300045049 Bacteria 1232
350 Ga0466958_0006102 3300045836 Bacteria 6531
351 Ga0466967_0321370 3300045976 Bacteria 1493
352 Ga0466967_0349085 3300045976 Bacteria 1432
353 Ga0466967_0434873 3300045976 Bacteria 1280
354 Ga0466967_1817323 3300045976 Bacteria 606
355 Ga0495603_0009461 3300046455 Bacteria 5887
356 Ga0495629_0002949 3300046459 Bacteria 12958
357 Ga0495638_0003848 3300046460 Bacteria 11656
358 Ga0495641_0299328 3300046461 Bacteria 725
359 Ga0495580_0073358 3300046472 Bacteria 2389
360 Ga0495639_0024239 3300046475 Bacteria 2670
361 Ga0495662_0000767 3300046476 Bacteria 15477
362 Ga0495664_0025847 3300046477 Bacteria 3419
363 Ga0495664_0033291 3300046477 Bacteria 3028
364 Ga0495594_0351697 3300046499 Bacteria 839
365 Ga0495594_0428273 3300046499 Bacteria 752
366 Ga0495594_0479558 3300046499 Bacteria 707
367 Ga0495583_0453410 3300046506 Bacteria 502
368 Ga0495606_0039786 3300046507 Bacteria 3163
369 Ga0495628_0018564 3300046516 Bacteria 5759
370 Ga0495630_0054874 3300046517 Bacteria 2985
371 Ga0495630_0330960 3300046517 Bacteria 1165
372 Ga0495640_0014734 3300046533 Bacteria 5906
373 Ga0495640_0039803 3300046533 Bacteria 3296
374 Ga0495640_0068642 3300046533 Bacteria 2385
375 Ga0495586_0019193 3300046535 Bacteria 3637
376 Ga0495645_0041072 3300046543 Bacteria 3373
377 Ga0495645_0073813 3300046543 Bacteria 2457
378 Ga0495667_0030481 3300046559 Bacteria 3624
379 Ga0495656_0201303 3300046615 Bacteria 988
380 Ga0495668_0247606 3300046616 Bacteria 976
381 Ga0495634_0112224 3300046642 Bacteria 1752
382 Ga0495634_0433592 3300046642 Bacteria 777
383 Ga0495588_0758129 3300046674 Bacteria 507
384 Ga0495599_0106170 3300046678 Bacteria 1750
385 Ga0495647_0015776 3300046681 Bacteria 2651
386 Ga0495647_0114840 3300046681 Bacteria 1127
387 Ga0495647_0394345 3300046681 Bacteria 635
388 Ga0495658_0056276 3300046683 Bacteria 2242
389 Ga0495613_0020337 3300046689 Bacteria 4949
390 Ga0495624_0204690 3300046690 Bacteria 1198
391 Ga0495649_0410856 3300046694 Bacteria 679
392 Ga0495600_0152649 3300046809 Bacteria 1495
393 Ga0495581_0023954 3300047315 Bacteria 3537
394 Ga0495581_0042845 3300047315 Bacteria 2619
395 Ga0495636_0449273 3300047318 Bacteria 619
396 Ga0495674_0004759 3300047319 Bacteria 13048
397 Ga0495674_0059427 3300047319 Bacteria 3338
398 Ga0495676_0045943 3300047321 Bacteria 3550
399 Ga0495676_0084310 3300047321 Bacteria 2398
400 Ga0495676_0769904 3300047321 Unclassified 621
401 Ga0495680_0380112 3300047322 Bacteria 978
402 Ga0495680_1090499 3300047322 Bacteria 505
403 Ga0495684_0047691 3300047471 Bacteria 3276
404 Ga0495593_0022651 3300047673 Bacteria 3497
405 Ga0495614_0128844 3300048089 Bacteria 1119
406 Ga0496100_0035031 3300048903 Bacteria 3155
407 Ga0496100_0037807 3300048903 Bacteria 3054
408 Ga0496100_0093898 3300048903 Bacteria 2053
409 Ga0496100_0794033 3300048903 Bacteria 741
410 Ga0496100_0916487 3300048903 Bacteria 688
411 Ga0496101_0002562 3300048904 Bacteria 11153
412 Ga0496101_0025473 3300048904 Bacteria 4105
413 Ga0496101_0044662 3300048904 Bacteria 3171
414 Ga0496101_0058031 3300048904 Bacteria 2801
415 Ga0496101_0128129 3300048904 Bacteria 1925
416 Ga0496101_0151578 3300048904 Bacteria 1774
417 Ga0496102_0000070 3300048905 Bacteria 155087
418 Ga0496102_0113732 3300048905 Bacteria 2525
419 Ga0496102_0170984 3300048905 Bacteria 2046
420 Ga0496103_0000484 3300048906 Bacteria 33254
421 Ga0496103_0073887 3300048906 Bacteria 2136
422 Ga0496103_0181376 3300048906 Bacteria 1353
423 Ga0496103_0448726 3300048906 Bacteria 827
424 Ga0496104_0008051 3300048907 Bacteria 9349
425 Ga0496104_0098575 3300048907 Bacteria 2797
426 Ga0496104_0174236 3300048907 Bacteria 2062
427 Ga0496104_0474812 3300048907 Bacteria 1162
428 Ga0496105_0012167 3300048908 Bacteria 6813
429 Ga0496105_0042725 3300048908 Bacteria 3738
430 Ga0496105_0071701 3300048908 Bacteria 2863
431 Ga0496105_0236102 3300048908 Bacteria 1485
432 Ga0496106_0015820 3300048909 Bacteria 5579
433 Ga0496106_0056052 3300048909 Bacteria 2979
434 Ga0496106_0164290 3300048909 Bacteria 1757
435 Ga0496106_0227332 3300048909 Bacteria 1489
436 Ga0496106_0395165 3300048909 Bacteria 1111
437 Ga0496107_0005085 3300048910 Bacteria 8966
438 Ga0496107_0019779 3300048910 Bacteria 4753
439 Ga0496107_0039437 3300048910 Bacteria 3388
440 Ga0496107_0811233 3300048910 Bacteria 685
441 Ga0496107_1268105 3300048910 Bacteria 528
442 Ga0496108_0015468 3300048911 Bacteria 6224
443 Ga0496108_0075692 3300048911 Bacteria 2844
444 Ga0496108_0586446 3300048911 Bacteria 972
445 Ga0496109_0103423 3300048912 Bacteria 2643
446 Ga0496109_0208366 3300048912 Bacteria 1838
447 Ga0496109_0292418 3300048912 Bacteria 1536
448 Ga0496109_0840844 3300048912 Bacteria 856
449 Ga0496109_1038582 3300048912 Bacteria 757
450 Ga0496110_0068879 3300048913 Bacteria 3132
451 Ga0496110_0156111 3300048913 Bacteria 2067
452 Ga0496110_0355005 3300048913 Bacteria 1336
453 Ga0496111_0021220 3300048914 Bacteria 4532
454 Ga0496111_0202363 3300048914 Bacteria 1476
455 Ga0496111_0264342 3300048914 Bacteria 1276
456 Ga0496111_0847103 3300048914 Bacteria 660
457 Ga0496112_0417678 3300048915 Bacteria 1280
458 Ga0496113_0351052 3300048916 Bacteria 1183
459 Ga0496113_0803443 3300048916 Bacteria 747
460 Ga0496114_0015447 3300048917 Bacteria 6141
461 Ga0496114_0085445 3300048917 Bacteria 2672
462 Ga0496114_0146168 3300048917 Bacteria 2049
463 Ga0496114_0780187 3300048917 Bacteria 834
464 Ga0496114_0806206 3300048917 Bacteria 818
465 Ga0496114_1395689 3300048917 Bacteria 588
466 Ga0496115_0247707 3300048918 Bacteria 1468
467 Ga0496115_0433115 3300048918 Bacteria 1064
468 Ga0496115_0592319 3300048918 Bacteria 882
469 Ga0496116_0011237 3300048919 Bacteria 7435
470 Ga0496117_0000319 3300048920 Bacteria 84245
471 Ga0496118_0001764 3300048921 Bacteria 31300
472 Ga0496119_0015609 3300048922 Bacteria 5832
473 Ga0496120_0035754 3300048923 Bacteria 2963
474 Ga0496120_0266287 3300048923 Bacteria 798
475 Ga0496121_0002593 3300048924 Bacteria 27292
476 Ga0496125_0120921 3300048928 Bacteria 1868
477 Ga0496125_0172481 3300048928 Bacteria 1452
478 Ga0496126_0065474 3300048929 Bacteria 3252
479 Ga0501034_0437485 3300049571 Bacteria 1227
480 Ga0501069_0068600 3300049585 Bacteria 1984
481 Ga0501070_0013545 3300049586 Bacteria 6875
482 Ga0501070_0474849 3300049586 Bacteria 1006
483 Ga0501071_0308198 3300049587 Bacteria 1201
484 Ga0501073_0786025 3300049589 Bacteria 656
485 Ga0501074_0053967 3300049590 Bacteria 2899
486 nmdc:mga07m45_578453_c1 3300050496 Bacteria 649
487 nmdc:mga0n895_1089794_c1 3300050512 Bacteria 776
488 nmdc:mga0n895_149110_c1 3300050512 Bacteria 2368
489 nmdc:mga0n895_437385_c1 3300050512 Bacteria 1321
490 nmdc:mga0rr50_350699_c1 3300050513 Bacteria 1241
491 nmdc:mga0a205_1333364_c1 3300050515 Bacteria 565
492 nmdc:mga0a205_412192_c1 3300050515 Bacteria 1214
493 nmdc:mga0sz30_50787_c2 3300050516 Bacteria 806
494 Ga0495601_0031681 3300053077 Bacteria 3287
495 Ga0495612_0051091 3300053078 Bacteria 1698
496 Ga0495612_0137468 3300053078 Bacteria 1058
497 Ga0500568_0182718 3300053139 Bacteria 771
498 Ga0500588_0141757 3300053146 Bacteria 864
499 Ga0500616_0040117 3300053153 Bacteria 2520
500 Ga0500637_0526571 3300053178 Bacteria 579
501 Ga0500645_000006 3300053730 Bacteria 276677

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10287364 Ga0105247_102873643 84
2 3300046476 Ga0495662_0000767 Ga0495662_0000767_20_316 84
3 3300005437 Ga0070710_10013389 Ga0070710_100133896 85
4 3300009148 Ga0105243_11730741 Ga0105243_117307411 85
5 3300005327 Ga0070658_10427471 Ga0070658_104274712 90
6 3300005336 Ga0070680_100219990 Ga0070680_1002199902 90
7 3300005339 Ga0070660_100016340 Ga0070660_1000163409 90
8 3300005458 Ga0070681_10148603 Ga0070681_101486032 90
9 3300005530 Ga0070679_100090827 Ga0070679_1000908273 90
10 3300005563 Ga0068855_100161010 Ga0068855_1001610104 90
11 3300009093 Ga0105240_10005139 Ga0105240_100051394 90
12 3300013100 Ga0157373_10328168 Ga0157373_103281682 90
13 3300013104 Ga0157370_10087610 Ga0157370_100876105 90
14 3300020069 Ga0197907_10233898 Ga0197907_102338981 90
15 3300020070 Ga0206356_10104063 Ga0206356_101040634 90
16 3300020081 Ga0206354_10258447 Ga0206354_102584475 90
17 3300020082 Ga0206353_10319123 Ga0206353_103191235 90
18 3300025913 Ga0207695_10036594 Ga0207695_100365947 90
19 3300025917 Ga0207660_10338229 Ga0207660_103382292 90
20 3300025919 Ga0207657_10025770 Ga0207657_100257702 90
21 3300025920 Ga0207649_10129278 Ga0207649_101292785 90
22 3300025921 Ga0207652_10142689 Ga0207652_101426894 90
23 3300025929 Ga0207664_10165189 Ga0207664_101651894 90
24 3300025949 Ga0207667_11542888 Ga0207667_115428881 90
25 3300037466 Ga0395898_0611367 Ga0395898_0611367_350_661 90
26 3300009093 Ga0105240_10210727 Ga0105240_102107272 92
27 3300025913 Ga0207695_10859692 Ga0207695_108596922 92
28 3300037466 Ga0395898_0299549 Ga0395898_0299549_740_1057 92
29 3300038443 Ga0395901_0739014 Ga0395901_0739014_432_749 92
30 3300005336 Ga0070680_101355245 Ga0070680_1013552451 93
31 3300044684 Ga0466966_0052982 Ga0466966_0052982_656_979 93
32 3300045049 Ga0466959_0021115 Ga0466959_0021115_3271_3594 93
33 iso_pu_bacteria 2547132424 2548693693 93
34 iso_pu_bacteria 2643221692 2644513458 93
35 iso_pu_bacteria 2902792274 2902798149 93
36 3300039450 Ga0436363_1498781 Ga0436363_1498781_170_496 94
37 3300005434 Ga0070709_10069322 Ga0070709_100693222 95
38 3300031251 Ga0265327_10000001 Ga0265327_10000001278 95
39 3300035086 Ga0373934_0079766 Ga0373934_0079766_326_739 95
40 3300035089 Ga0373944_0313998 Ga0373944_0313998_42_455 95
41 3300035111 Ga0373923_0016372 Ga0373923_0016372_1115_1540 95
42 3300035113 Ga0373936_0018358 Ga0373936_0018358_2099_2524 95
43 3300035116 Ga0373945_0039037 Ga0373945_0039037_514_951 95
44 3300035118 Ga0373954_0100182 Ga0373954_0100182_98_535 95
45 3300035120 Ga0373957_0026746 Ga0373957_0026746_564_989 95
46 3300035170 Ga0373943_0055449 Ga0373943_0055449_657_1082 95
47 3300035171 Ga0373946_0244470 Ga0373946_0244470_325_750 95
48 3300035172 Ga0373955_0110129 Ga0373955_0110129_327_752 95
49 3300035410 Ga0373924_0012146 Ga0373924_0012146_2504_2929 95
50 3300035410 Ga0373924_0054154 Ga0373924_0054154_110_547 95
51 3300035692 Ga0373935_0130620 Ga0373935_0130620_326_751 95
52 3300035695 Ga0373927_0078892 Ga0373927_0078892_1480_1905 95
53 3300035724 Ga0373933_0147054 Ga0373933_0147054_201_626 95
54 3300035725 Ga0373947_0205987 Ga0373947_0205987_327_752 95
55 3300036401 Ga0373937_0042360 Ga0373937_0042360_2573_3010 95
56 3300037068 Ga0373925_0056567 Ga0373925_0056567_1017_1442 95
57 3300037068 Ga0373925_0922976 Ga0373925_0922976_186_518 95
58 3300045976 Ga0466967_1817323 Ga0466967_1817323_245_574 95
59 3300046472 Ga0495580_0073358 Ga0495580_0073358_1827_2252 95
60 3300046475 Ga0495639_0024239 Ga0495639_0024239_1042_1467 95
61 3300046477 Ga0495664_0033291 Ga0495664_0033291_138_563 95
62 3300046499 Ga0495594_0351697 Ga0495594_0351697_20_457 95
63 3300046516 Ga0495628_0018564 Ga0495628_0018564_4179_4604 95
64 3300046517 Ga0495630_0054874 Ga0495630_0054874_1049_1474 95
65 3300046533 Ga0495640_0039803 Ga0495640_0039803_2194_2619 95
66 3300046543 Ga0495645_0073813 Ga0495645_0073813_1913_2338 95
67 3300046642 Ga0495634_0112224 Ga0495634_0112224_279_704 95
68 3300046678 Ga0495599_0106170 Ga0495599_0106170_685_1110 95
69 3300046681 Ga0495647_0015776 Ga0495647_0015776_125_550 95
70 3300046683 Ga0495658_0056276 Ga0495658_0056276_813_1238 95
71 3300046689 Ga0495613_0020337 Ga0495613_0020337_2402_2827 95
72 3300046690 Ga0495624_0204690 Ga0495624_0204690_627_1064 95
73 3300046809 Ga0495600_0152649 Ga0495600_0152649_753_1166 95
74 3300047315 Ga0495581_0042845 Ga0495581_0042845_900_1325 95
75 3300047319 Ga0495674_0059427 Ga0495674_0059427_526_951 95
76 3300047321 Ga0495676_0769904 Ga0495676_0769904_54_467 95
77 3300047471 Ga0495684_0047691 Ga0495684_0047691_1168_1593 95
78 3300047673 Ga0495593_0022651 Ga0495593_0022651_29_442 95
79 3300048089 Ga0495614_0128844 Ga0495614_0128844_508_933 95
80 3300048917 Ga0496114_1395689 Ga0496114_1395689_181_507 95
81 3300053078 Ga0495612_0137468 Ga0495612_0137468_549_974 95
82 3300005336 Ga0070680_100030387 Ga0070680_1000303872 96
83 3300005344 Ga0070661_101671388 Ga0070661_1016713881 96
84 3300005347 Ga0070668_101459106 Ga0070668_1014591062 96
85 3300005456 Ga0070678_100407034 Ga0070678_1004070341 96
86 3300005458 Ga0070681_10176512 Ga0070681_101765123 96
87 3300005468 Ga0070707_101224277 Ga0070707_1012242772 96
88 3300005530 Ga0070679_100048059 Ga0070679_1000480594 96
89 3300005535 Ga0070684_100049325 Ga0070684_1000493252 96
90 3300005539 Ga0068853_100469225 Ga0068853_1004692252 96
91 3300005547 Ga0070693_100071398 Ga0070693_1000713982 96
92 3300005548 Ga0070665_100497668 Ga0070665_1004976682 96
93 3300005577 Ga0068857_100090400 Ga0068857_1000904003 96
94 3300005615 Ga0070702_101071924 Ga0070702_1010719241 96
95 3300005618 Ga0068864_100865401 Ga0068864_1008654012 96
96 3300005841 Ga0068863_101048135 Ga0068863_1010481352 96
97 3300005842 Ga0068858_101643156 Ga0068858_1016431562 96
98 3300006048 Ga0075363_100323617 Ga0075363_1003236172 96
99 3300009176 Ga0105242_10194900 Ga0105242_101949001 96
100 3300009177 Ga0105248_10281636 Ga0105248_102816363 96
101 3300009545 Ga0105237_10153989 Ga0105237_101539893 96
102 3300009551 Ga0105238_10562370 Ga0105238_105623702 96
103 3300011119 Ga0105246_10543601 Ga0105246_105436012 96
104 3300013105 Ga0157369_10373485 Ga0157369_103734852 96
105 3300013308 Ga0157375_10397054 Ga0157375_103970543 96
106 3300014326 Ga0157380_10867634 Ga0157380_108676342 96
107 3300014968 Ga0157379_10350640 Ga0157379_103506402 96
108 3300017792 Ga0163161_10438109 Ga0163161_104381092 96
109 3300025917 Ga0207660_10073729 Ga0207660_100737293 96
110 3300025922 Ga0207646_11578336 Ga0207646_115783362 96
111 3300025929 Ga0207664_10802364 Ga0207664_108023642 96
112 3300025934 Ga0207686_11115240 Ga0207686_111152402 96
113 3300025937 Ga0207669_10044167 Ga0207669_100441672 96
114 3300025944 Ga0207661_10113223 Ga0207661_101132232 96
115 3300025986 Ga0207658_10748526 Ga0207658_107485262 96
116 3300026095 Ga0207676_12183681 Ga0207676_121836811 96
117 3300026121 Ga0207683_10731394 Ga0207683_107313942 96
118 3300028379 Ga0268266_10271351 Ga0268266_102713512 96
119 3300037418 Ga0395900_0009608 Ga0395900_0009608_2402_2731 96
120 3300037471 Ga0395905_1395132 Ga0395905_1395132_171_500 96
121 3300044694 Ga0466963_0110137 Ga0466963_0110137_1070_1399 96
122 3300044694 Ga0466963_0522808 Ga0466963_0522808_223_552 96
123 3300045976 Ga0466967_0434873 Ga0466967_0434873_500_838 96
124 3300048903 Ga0496100_0093898 Ga0496100_0093898_208_537 96
125 3300048904 Ga0496101_0025473 Ga0496101_0025473_1069_1398 96
126 3300048907 Ga0496104_0008051 Ga0496104_0008051_165_494 96
127 3300048908 Ga0496105_0012167 Ga0496105_0012167_608_937 96
128 3300048908 Ga0496105_0236102 Ga0496105_0236102_166_519 96
129 3300048909 Ga0496106_0056052 Ga0496106_0056052_2329_2658 96
130 3300048910 Ga0496107_0019779 Ga0496107_0019779_920_1249 96
131 3300048911 Ga0496108_0015468 Ga0496108_0015468_1688_2041 96
132 3300048912 Ga0496109_0208366 Ga0496109_0208366_648_1001 96
133 3300048912 Ga0496109_1038582 Ga0496109_1038582_70_399 96
134 3300048914 Ga0496111_0847103 Ga0496111_0847103_245_598 96
135 3300048916 Ga0496113_0803443 Ga0496113_0803443_279_632 96
136 3300048917 Ga0496114_0146168 Ga0496114_0146168_1069_1398 96
137 3300050512 nmdc:mga0n895_1089794_c1 nmdc:mga0n895_1089794_c1_299_628 96
138 3300002459 JGI24751J29686_10003363 JGI24751J29686_100033633 97
139 3300005327 Ga0070658_10281258 Ga0070658_102812581 97
140 3300005329 Ga0070683_100018705 Ga0070683_1000187054 97
141 3300005330 Ga0070690_100204486 Ga0070690_1002044863 97
142 3300005331 Ga0070670_100292403 Ga0070670_1002924032 97
143 3300005334 Ga0068869_100097806 Ga0068869_1000978064 97
144 3300005334 Ga0068869_100176455 Ga0068869_1001764552 97
145 3300005336 Ga0070680_100157412 Ga0070680_1001574122 97
146 3300005337 Ga0070682_100131843 Ga0070682_1001318431 97
147 3300005337 Ga0070682_101280666 Ga0070682_1012806661 97
148 3300005338 Ga0068868_100079051 Ga0068868_1000790513 97
149 3300005338 Ga0068868_100138892 Ga0068868_1001388922 97
150 3300005338 Ga0068868_100780253 Ga0068868_1007802532 97
151 3300005340 Ga0070689_100047141 Ga0070689_1000471414 97
152 3300005340 Ga0070689_100401364 Ga0070689_1004013642 97
153 3300005341 Ga0070691_10372082 Ga0070691_103720821 97
154 3300005345 Ga0070692_10181334 Ga0070692_101813342 97
155 3300005347 Ga0070668_100001337 Ga0070668_10000133713 97
156 3300005354 Ga0070675_100506013 Ga0070675_1005060132 97
157 3300005354 Ga0070675_101434889 Ga0070675_1014348892 97
158 3300005355 Ga0070671_100002936 Ga0070671_1000029364 97
159 3300005355 Ga0070671_100389013 Ga0070671_1003890132 97
160 3300005355 Ga0070671_101344034 Ga0070671_1013440341 97
161 3300005356 Ga0070674_100052434 Ga0070674_1000524343 97
162 3300005356 Ga0070674_100844477 Ga0070674_1008444772 97
163 3300005364 Ga0070673_100048949 Ga0070673_1000489493 97
164 3300005364 Ga0070673_100529061 Ga0070673_1005290612 97
165 3300005365 Ga0070688_100274624 Ga0070688_1002746242 97
166 3300005365 Ga0070688_100568513 Ga0070688_1005685132 97
167 3300005434 Ga0070709_10001282 Ga0070709_100012826 97
168 3300005434 Ga0070709_10034816 Ga0070709_100348163 97
169 3300005436 Ga0070713_100008375 Ga0070713_1000083758 97
170 3300005437 Ga0070710_10011337 Ga0070710_100113373 97
171 3300005437 Ga0070710_10107240 Ga0070710_101072403 97
172 3300005439 Ga0070711_100008659 Ga0070711_1000086595 97
173 3300005440 Ga0070705_101059368 Ga0070705_1010593681 97
174 3300005441 Ga0070700_100135243 Ga0070700_1001352432 97
175 3300005441 Ga0070700_100460228 Ga0070700_1004602282 97
176 3300005441 Ga0070700_101944632 Ga0070700_1019446321 97
177 3300005444 Ga0070694_100285322 Ga0070694_1002853222 97
178 3300005445 Ga0070708_100002445 Ga0070708_10000244515 97
179 3300005455 Ga0070663_100445501 Ga0070663_1004455012 97
180 3300005455 Ga0070663_100768856 Ga0070663_1007688562 97
181 3300005458 Ga0070681_10091331 Ga0070681_100913312 97
182 3300005458 Ga0070681_10209040 Ga0070681_102090402 97
183 3300005459 Ga0068867_100163401 Ga0068867_1001634012 97
184 3300005466 Ga0070685_10095953 Ga0070685_100959533 97
185 3300005467 Ga0070706_100003749 Ga0070706_10000374915 97
186 3300005468 Ga0070707_100069770 Ga0070707_1000697702 97
187 3300005471 Ga0070698_100058228 Ga0070698_1000582285 97
188 3300005530 Ga0070679_100013997 Ga0070679_1000139971 97
189 3300005530 Ga0070679_100030192 Ga0070679_1000301924 97
190 3300005535 Ga0070684_100021205 Ga0070684_1000212056 97
191 3300005535 Ga0070684_100210573 Ga0070684_1002105732 97
192 3300005539 Ga0068853_100953755 Ga0068853_1009537551 97
193 3300005539 Ga0068853_102023118 Ga0068853_1020231181 97
194 3300005544 Ga0070686_100205429 Ga0070686_1002054292 97
195 3300005545 Ga0070695_100561844 Ga0070695_1005618442 97
196 3300005546 Ga0070696_100041938 Ga0070696_1000419382 97
197 3300005547 Ga0070693_100021688 Ga0070693_1000216881 97
198 3300005548 Ga0070665_100005421 Ga0070665_1000054216 97
199 3300005548 Ga0070665_100013445 Ga0070665_1000134452 97
200 3300005549 Ga0070704_100153965 Ga0070704_1001539652 97
201 3300005563 Ga0068855_100147820 Ga0068855_1001478203 97
202 3300005578 Ga0068854_100076164 Ga0068854_1000761641 97
203 3300005578 Ga0068854_100550352 Ga0068854_1005503522 97
204 3300005615 Ga0070702_100034336 Ga0070702_1000343363 97
205 3300005615 Ga0070702_100099958 Ga0070702_1000999581 97
206 3300005615 Ga0070702_100242340 Ga0070702_1002423402 97
207 3300005615 Ga0070702_100787318 Ga0070702_1007873181 97
208 3300005617 Ga0068859_102059857 Ga0068859_1020598571 97
209 3300005618 Ga0068864_100322084 Ga0068864_1003220842 97
210 3300005618 Ga0068864_101187848 Ga0068864_1011878481 97
211 3300005718 Ga0068866_10173016 Ga0068866_101730161 97
212 3300005718 Ga0068866_10245550 Ga0068866_102455503 97
213 3300005719 Ga0068861_100010457 Ga0068861_1000104576 97
214 3300005719 Ga0068861_100130486 Ga0068861_1001304863 97
215 3300005841 Ga0068863_100000121 Ga0068863_10000012173 97
216 3300005841 Ga0068863_100029655 Ga0068863_1000296553 97
217 3300005842 Ga0068858_100074274 Ga0068858_1000742742 97
218 3300005842 Ga0068858_100135395 Ga0068858_1001353952 97
219 3300005842 Ga0068858_100759135 Ga0068858_1007591353 97
220 3300005842 Ga0068858_101046212 Ga0068858_1010462122 97
221 3300005843 Ga0068860_100480583 Ga0068860_1004805832 97
222 3300005843 Ga0068860_100745406 Ga0068860_1007454061 97
223 3300005844 Ga0068862_100000045 Ga0068862_100000045125 97
224 3300005844 Ga0068862_100303480 Ga0068862_1003034803 97
225 3300005844 Ga0068862_101039131 Ga0068862_1010391312 97
226 3300005981 Ga0081538_10003325 Ga0081538_100033253 97
227 3300005985 Ga0081539_10133019 Ga0081539_101330193 97
228 3300006163 Ga0070715_10020728 Ga0070715_100207283 97
229 3300006173 Ga0070716_100003011 Ga0070716_10000301110 97
230 3300006175 Ga0070712_100034161 Ga0070712_1000341613 97
231 3300006175 Ga0070712_100100837 Ga0070712_1001008372 97
232 3300006175 Ga0070712_100381251 Ga0070712_1003812512 97
233 3300006175 Ga0070712_100951656 Ga0070712_1009516562 97
234 3300006237 Ga0097621_100053562 Ga0097621_1000535625 97
235 3300006237 Ga0097621_100293126 Ga0097621_1002931264 97
236 3300006852 Ga0075433_10405572 Ga0075433_104055721 97
237 3300006871 Ga0075434_100215104 Ga0075434_1002151042 97
238 3300006881 Ga0068865_100045873 Ga0068865_1000458732 97
239 3300006931 Ga0097620_102058825 Ga0097620_1020588252 97
240 3300009011 Ga0105251_10275079 Ga0105251_102750792 97
241 3300009092 Ga0105250_10101522 Ga0105250_101015222 97
242 3300009093 Ga0105240_10066829 Ga0105240_100668294 97
243 3300009093 Ga0105240_10953666 Ga0105240_109536662 97
244 3300009094 Ga0111539_10368120 Ga0111539_103681203 97
245 3300009098 Ga0105245_10081524 Ga0105245_100815243 97
246 3300009098 Ga0105245_10303058 Ga0105245_103030582 97
247 3300009098 Ga0105245_10354237 Ga0105245_103542372 97
248 3300009098 Ga0105245_10451544 Ga0105245_104515442 97
249 3300009098 Ga0105245_10530389 Ga0105245_105303892 97
250 3300009098 Ga0105245_10542783 Ga0105245_105427833 97
251 3300009148 Ga0105243_10048678 Ga0105243_100486783 97
252 3300009148 Ga0105243_10064319 Ga0105243_100643193 97
253 3300009148 Ga0105243_10202514 Ga0105243_102025142 97
254 3300009176 Ga0105242_10072197 Ga0105242_100721974 97
255 3300009176 Ga0105242_10655132 Ga0105242_106551322 97
256 3300009177 Ga0105248_10093675 Ga0105248_100936753 97
257 3300009177 Ga0105248_10544088 Ga0105248_105440883 97
258 3300009545 Ga0105237_10065257 Ga0105237_100652573 97
259 3300009545 Ga0105237_10667520 Ga0105237_106675202 97
260 3300009551 Ga0105238_10030382 Ga0105238_100303826 97
261 3300009551 Ga0105238_10130758 Ga0105238_101307584 97
262 3300010375 Ga0105239_11627693 Ga0105239_116276931 97
263 3300010375 Ga0105239_11698649 Ga0105239_116986491 97
264 3300011119 Ga0105246_10020251 Ga0105246_100202512 97
265 3300011119 Ga0105246_10232916 Ga0105246_102329162 97
266 3300013105 Ga0157369_10003011 Ga0157369_100030117 97
267 3300013296 Ga0157374_10061262 Ga0157374_100612624 97
268 3300013297 Ga0157378_10011259 Ga0157378_1001125911 97
269 3300013297 Ga0157378_10019466 Ga0157378_100194664 97
270 3300013297 Ga0157378_10443320 Ga0157378_104433202 97
271 3300013297 Ga0157378_10605742 Ga0157378_106057423 97
272 3300013307 Ga0157372_10116383 Ga0157372_101163832 97
273 3300013308 Ga0157375_10023965 Ga0157375_100239655 97
274 3300014325 Ga0163163_10461590 Ga0163163_104615901 97
275 3300014326 Ga0157380_10409713 Ga0157380_104097133 97
276 3300014497 Ga0182008_10525138 Ga0182008_105251382 97
277 3300014968 Ga0157379_10004940 Ga0157379_100049405 97
278 3300014969 Ga0157376_10256904 Ga0157376_102569043 97
279 3300020069 Ga0197907_11113287 Ga0197907_111132871 97
280 3300020070 Ga0206356_11181670 Ga0206356_111816703 97
281 3300020081 Ga0206354_10192749 Ga0206354_101927492 97
282 3300020082 Ga0206353_11519024 Ga0206353_115190241 97
283 3300020610 Ga0154015_1564700 Ga0154015_15647001 97
284 3300025321 Ga0207656_10422685 Ga0207656_104226852 97
285 3300025885 Ga0207653_10000104 Ga0207653_100001043 97
286 3300025898 Ga0207692_10050397 Ga0207692_100503971 97
287 3300025899 Ga0207642_10094707 Ga0207642_100947073 97
288 3300025899 Ga0207642_10370164 Ga0207642_103701643 97
289 3300025900 Ga0207710_10000028 Ga0207710_10000028211 97
290 3300025901 Ga0207688_10054627 Ga0207688_100546273 97
291 3300025901 Ga0207688_10462781 Ga0207688_104627812 97
292 3300025905 Ga0207685_10015930 Ga0207685_100159301 97
293 3300025906 Ga0207699_10000108 Ga0207699_1000010820 97
294 3300025906 Ga0207699_10016835 Ga0207699_100168352 97
295 3300025907 Ga0207645_10030610 Ga0207645_100306102 97
296 3300025909 Ga0207705_10296201 Ga0207705_102962012 97
297 3300025910 Ga0207684_10003727 Ga0207684_100037273 97
298 3300025911 Ga0207654_10244190 Ga0207654_102441902 97
299 3300025912 Ga0207707_10001222 Ga0207707_100012228 97
300 3300025912 Ga0207707_10662707 Ga0207707_106627072 97
301 3300025913 Ga0207695_10134284 Ga0207695_101342843 97
302 3300025913 Ga0207695_10142269 Ga0207695_101422691 97
303 3300025914 Ga0207671_10094424 Ga0207671_100944242 97
304 3300025915 Ga0207693_10023053 Ga0207693_100230531 97
305 3300025915 Ga0207693_10186535 Ga0207693_101865352 97
306 3300025916 Ga0207663_10102884 Ga0207663_101028843 97
307 3300025917 Ga0207660_10106872 Ga0207660_101068723 97
308 3300025921 Ga0207652_10150398 Ga0207652_101503984 97
309 3300025922 Ga0207646_10141158 Ga0207646_101411582 97
310 3300025923 Ga0207681_10018368 Ga0207681_100183685 97
311 3300025924 Ga0207694_10199160 Ga0207694_101991602 97
312 3300025925 Ga0207650_10423071 Ga0207650_104230712 97
313 3300025926 Ga0207659_10071845 Ga0207659_100718452 97
314 3300025926 Ga0207659_10201001 Ga0207659_102010013 97
315 3300025927 Ga0207687_10128116 Ga0207687_101281162 97
316 3300025927 Ga0207687_10156282 Ga0207687_101562822 97
317 3300025927 Ga0207687_10214999 Ga0207687_102149992 97
318 3300025927 Ga0207687_10400942 Ga0207687_104009422 97
319 3300025928 Ga0207700_10044096 Ga0207700_100440963 97
320 3300025929 Ga0207664_11802116 Ga0207664_118021162 97
321 3300025931 Ga0207644_10008062 Ga0207644_100080623 97
322 3300025933 Ga0207706_11300176 Ga0207706_113001762 97
323 3300025934 Ga0207686_10709586 Ga0207686_107095861 97
324 3300025935 Ga0207709_10079791 Ga0207709_100797912 97
325 3300025936 Ga0207670_10487503 Ga0207670_104875032 97
326 3300025938 Ga0207704_10041126 Ga0207704_100411264 97
327 3300025939 Ga0207665_10021826 Ga0207665_100218266 97
328 3300025939 Ga0207665_10144039 Ga0207665_101440393 97
329 3300025941 Ga0207711_10000081 Ga0207711_100000817 97
330 3300025941 Ga0207711_10055185 Ga0207711_100551852 97
331 3300025941 Ga0207711_10322959 Ga0207711_103229593 97
332 3300025942 Ga0207689_10020603 Ga0207689_100206033 97
333 3300025942 Ga0207689_10045083 Ga0207689_100450832 97
334 3300025942 Ga0207689_10112150 Ga0207689_101121503 97
335 3300025944 Ga0207661_10000499 Ga0207661_1000049929 97
336 3300025944 Ga0207661_10271019 Ga0207661_102710192 97
337 3300025949 Ga0207667_10121515 Ga0207667_101215152 97
338 3300025960 Ga0207651_10107259 Ga0207651_101072593 97
339 3300025961 Ga0207712_10000016 Ga0207712_10000016205 97
340 3300025972 Ga0207668_10000577 Ga0207668_100005777 97
341 3300025972 Ga0207668_10017793 Ga0207668_100177932 97
342 3300025981 Ga0207640_10116545 Ga0207640_101165451 97
343 3300025981 Ga0207640_10250273 Ga0207640_102502731 97
344 3300025986 Ga0207658_10000237 Ga0207658_1000023746 97
345 3300026023 Ga0207677_10023895 Ga0207677_100238954 97
346 3300026023 Ga0207677_10031601 Ga0207677_100316014 97
347 3300026035 Ga0207703_10119658 Ga0207703_101196583 97
348 3300026035 Ga0207703_10315725 Ga0207703_103157251 97
349 3300026035 Ga0207703_10684923 Ga0207703_106849233 97
350 3300026067 Ga0207678_10460687 Ga0207678_104606872 97
351 3300026067 Ga0207678_11167613 Ga0207678_111676131 97
352 3300026075 Ga0207708_10098346 Ga0207708_100983463 97
353 3300026075 Ga0207708_10334825 Ga0207708_103348252 97
354 3300026078 Ga0207702_10520093 Ga0207702_105200932 97
355 3300026088 Ga0207641_10000284 Ga0207641_1000028454 97
356 3300026088 Ga0207641_10503428 Ga0207641_105034282 97
357 3300026089 Ga0207648_10006140 Ga0207648_1000614010 97
358 3300026089 Ga0207648_10016599 Ga0207648_100165992 97
359 3300026095 Ga0207676_10087037 Ga0207676_100870374 97
360 3300026118 Ga0207675_100004967 Ga0207675_10000496711 97
361 3300026118 Ga0207675_100159490 Ga0207675_1001594902 97
362 3300028379 Ga0268266_10003565 Ga0268266_1000356512 97
363 3300028379 Ga0268266_10056599 Ga0268266_100565992 97
364 3300028380 Ga0268265_10000056 Ga0268265_10000056119 97
365 3300028380 Ga0268265_11864185 Ga0268265_118641852 97
366 3300028381 Ga0268264_10000053 Ga0268264_10000053149 97
367 3300028381 Ga0268264_10123073 Ga0268264_101230733 97
368 3300028381 Ga0268264_10387377 Ga0268264_103873772 97
369 3300034820 Ga0373959_0150522 Ga0373959_0150522_195_530 97
370 3300035114 Ga0373939_0180636 Ga0373939_0180636_274_609 97
371 3300035171 Ga0373946_0068693 Ga0373946_0068693_572_907 97
372 3300035242 Ga0373962_0103947 Ga0373962_0103947_489_824 97
373 3300035691 Ga0373931_0675131 Ga0373931_0675131_279_614 97
374 3300035691 Ga0373931_0839572 Ga0373931_0839572_64_399 97
375 3300035695 Ga0373927_0129976 Ga0373927_0129976_145_555 97
376 3300037068 Ga0373925_0196362 Ga0373925_0196362_192_602 97
377 3300041509 Ga0451843_1168130 Ga0451843_1168130_287_619 97
378 3300041512 Ga0451853_3724327 Ga0451853_3724327_36_371 97
379 3300044684 Ga0466966_0002993 Ga0466966_0002993_8668_9033 97
380 3300044684 Ga0466966_0014847 Ga0466966_0014847_2357_2689 97
381 3300044706 Ga0466964_0648536 Ga0466964_0648536_161_550 97
382 3300044719 Ga0466971_0108571 Ga0466971_0108571_13_402 97
383 3300044735 Ga0466968_0055809 Ga0466968_0055809_1138_1473 97
384 3300044765 Ga0466970_0028286 Ga0466970_0028286_2127_2468 97
385 3300044765 Ga0466970_0114454 Ga0466970_0114454_469_858 97
386 3300044842 Ga0466957_0110848 Ga0466957_0110848_952_1341 97
387 3300044842 Ga0466957_0250273 Ga0466957_0250273_793_1128 97
388 3300044901 Ga0466960_0213703 Ga0466960_0213703_646_978 97
389 3300045049 Ga0466959_0017611 Ga0466959_0017611_3391_3732 97
390 3300045049 Ga0466959_0030433 Ga0466959_0030433_3397_3729 97
391 3300045049 Ga0466959_0051116 Ga0466959_0051116_302_691 97
392 3300045049 Ga0466959_0246902 Ga0466959_0246902_585_920 97
393 3300045836 Ga0466958_0006102 Ga0466958_0006102_3406_3741 97
394 3300045976 Ga0466967_0321370 Ga0466967_0321370_571_960 97
395 3300045976 Ga0466967_0349085 Ga0466967_0349085_723_1055 97
396 3300046455 Ga0495603_0009461 Ga0495603_0009461_658_993 97
397 3300046459 Ga0495629_0002949 Ga0495629_0002949_3209_3544 97
398 3300046460 Ga0495638_0003848 Ga0495638_0003848_5358_5690 97
399 3300046461 Ga0495641_0299328 Ga0495641_0299328_191_523 97
400 3300046477 Ga0495664_0025847 Ga0495664_0025847_2266_2649 97
401 3300046499 Ga0495594_0428273 Ga0495594_0428273_92_427 97
402 3300046499 Ga0495594_0479558 Ga0495594_0479558_272_607 97
403 3300046506 Ga0495583_0453410 Ga0495583_0453410_23_355 97
404 3300046507 Ga0495606_0039786 Ga0495606_0039786_2566_2898 97
405 3300046517 Ga0495630_0330960 Ga0495630_0330960_392_748 97
406 3300046533 Ga0495640_0014734 Ga0495640_0014734_1256_1591 97
407 3300046533 Ga0495640_0068642 Ga0495640_0068642_1180_1524 97
408 3300046535 Ga0495586_0019193 Ga0495586_0019193_1947_2291 97
409 3300046543 Ga0495645_0041072 Ga0495645_0041072_1742_2125 97
410 3300046559 Ga0495667_0030481 Ga0495667_0030481_376_711 97
411 3300046615 Ga0495656_0201303 Ga0495656_0201303_277_609 97
412 3300046616 Ga0495668_0247606 Ga0495668_0247606_60_392 97
413 3300046642 Ga0495634_0433592 Ga0495634_0433592_227_571 97
414 3300046674 Ga0495588_0758129 Ga0495588_0758129_130_465 97
415 3300046681 Ga0495647_0114840 Ga0495647_0114840_683_1015 97
416 3300046681 Ga0495647_0394345 Ga0495647_0394345_51_395 97
417 3300046694 Ga0495649_0410856 Ga0495649_0410856_150_482 97
418 3300047315 Ga0495581_0023954 Ga0495581_0023954_1688_2032 97
419 3300047318 Ga0495636_0449273 Ga0495636_0449273_128_463 97
420 3300047319 Ga0495674_0004759 Ga0495674_0004759_12566_12901 97
421 3300047321 Ga0495676_0045943 Ga0495676_0045943_2520_2852 97
422 3300047321 Ga0495676_0084310 Ga0495676_0084310_1811_2146 97
423 3300047322 Ga0495680_0380112 Ga0495680_0380112_126_482 97
424 3300047322 Ga0495680_1090499 Ga0495680_1090499_53_409 97
425 3300048903 Ga0496100_0035031 Ga0496100_0035031_2124_2480 97
426 3300048903 Ga0496100_0037807 Ga0496100_0037807_1170_1505 97
427 3300048903 Ga0496100_0794033 Ga0496100_0794033_117_461 97
428 3300048903 Ga0496100_0916487 Ga0496100_0916487_232_564 97
429 3300048904 Ga0496101_0002562 Ga0496101_0002562_9213_9569 97
430 3300048904 Ga0496101_0044662 Ga0496101_0044662_1012_1356 97
431 3300048904 Ga0496101_0058031 Ga0496101_0058031_2427_2762 97
432 3300048904 Ga0496101_0128129 Ga0496101_0128129_380_712 97
433 3300048904 Ga0496101_0151578 Ga0496101_0151578_1168_1503 97
434 3300048905 Ga0496102_0000070 Ga0496102_0000070_110303_110659 97
435 3300048905 Ga0496102_0113732 Ga0496102_0113732_219_554 97
436 3300048905 Ga0496102_0170984 Ga0496102_0170984_921_1265 97
437 3300048906 Ga0496103_0000484 Ga0496103_0000484_13425_13781 97
438 3300048906 Ga0496103_0073887 Ga0496103_0073887_64_396 97
439 3300048906 Ga0496103_0181376 Ga0496103_0181376_918_1253 97
440 3300048906 Ga0496103_0448726 Ga0496103_0448726_137_481 97
441 3300048907 Ga0496104_0098575 Ga0496104_0098575_585_917 97
442 3300048907 Ga0496104_0174236 Ga0496104_0174236_34_369 97
443 3300048907 Ga0496104_0474812 Ga0496104_0474812_134_478 97
444 3300048908 Ga0496105_0042725 Ga0496105_0042725_1435_1767 97
445 3300048908 Ga0496105_0071701 Ga0496105_0071701_1489_1833 97
446 3300048909 Ga0496106_0015820 Ga0496106_0015820_2225_2560 97
447 3300048909 Ga0496106_0164290 Ga0496106_0164290_205_561 97
448 3300048909 Ga0496106_0227332 Ga0496106_0227332_124_468 97
449 3300048909 Ga0496106_0395165 Ga0496106_0395165_91_423 97
450 3300048910 Ga0496107_0005085 Ga0496107_0005085_7062_7397 97
451 3300048910 Ga0496107_0039437 Ga0496107_0039437_1189_1545 97
452 3300048910 Ga0496107_0811233 Ga0496107_0811233_180_512 97
453 3300048910 Ga0496107_1268105 Ga0496107_1268105_23_355 97
454 3300048911 Ga0496108_0075692 Ga0496108_0075692_2182_2517 97
455 3300048911 Ga0496108_0586446 Ga0496108_0586446_358_702 97
456 3300048912 Ga0496109_0103423 Ga0496109_0103423_595_930 97
457 3300048912 Ga0496109_0292418 Ga0496109_0292418_1174_1518 97
458 3300048912 Ga0496109_0840844 Ga0496109_0840844_92_424 97
459 3300048913 Ga0496110_0068879 Ga0496110_0068879_1156_1491 97
460 3300048913 Ga0496110_0156111 Ga0496110_0156111_969_1301 97
461 3300048913 Ga0496110_0355005 Ga0496110_0355005_284_619 97
462 3300048914 Ga0496111_0021220 Ga0496111_0021220_1477_1812 97
463 3300048914 Ga0496111_0202363 Ga0496111_0202363_308_640 97
464 3300048914 Ga0496111_0264342 Ga0496111_0264342_548_892 97
465 3300048915 Ga0496112_0417678 Ga0496112_0417678_223_558 97
466 3300048916 Ga0496113_0351052 Ga0496113_0351052_793_1128 97
467 3300048917 Ga0496114_0015447 Ga0496114_0015447_4354_4689 97
468 3300048917 Ga0496114_0085445 Ga0496114_0085445_2028_2372 97
469 3300048917 Ga0496114_0780187 Ga0496114_0780187_251_583 97
470 3300048917 Ga0496114_0806206 Ga0496114_0806206_267_623 97
471 3300048918 Ga0496115_0247707 Ga0496115_0247707_864_1226 97
472 3300048918 Ga0496115_0433115 Ga0496115_0433115_459_791 97
473 3300048918 Ga0496115_0592319 Ga0496115_0592319_35_370 97
474 3300048919 Ga0496116_0011237 Ga0496116_0011237_5933_6289 97
475 3300048920 Ga0496117_0000319 Ga0496117_0000319_8479_8835 97
476 3300048921 Ga0496118_0001764 Ga0496118_0001764_7159_7515 97
477 3300048922 Ga0496119_0015609 Ga0496119_0015609_595_951 97
478 3300048923 Ga0496120_0035754 Ga0496120_0035754_289_645 97
479 3300048923 Ga0496120_0266287 Ga0496120_0266287_83_415 97
480 3300048924 Ga0496121_0002593 Ga0496121_0002593_20069_20425 97
481 3300048928 Ga0496125_0120921 Ga0496125_0120921_657_1013 97
482 3300048928 Ga0496125_0172481 Ga0496125_0172481_1108_1440 97
483 3300048929 Ga0496126_0065474 Ga0496126_0065474_1053_1385 97
484 3300049571 Ga0501034_0437485 Ga0501034_0437485_426_758 97
485 3300049585 Ga0501069_0068600 Ga0501069_0068600_694_1032 97
486 3300049586 Ga0501070_0013545 Ga0501070_0013545_5381_5719 97
487 3300049586 Ga0501070_0474849 Ga0501070_0474849_477_809 97
488 3300049587 Ga0501071_0308198 Ga0501071_0308198_754_1092 97
489 3300049589 Ga0501073_0786025 Ga0501073_0786025_67_405 97
490 3300049590 Ga0501074_0053967 Ga0501074_0053967_1931_2269 97
491 3300050496 nmdc:mga07m45_578453_c1 nmdc:mga07m45_578453_c1_29_361 97
492 3300050512 nmdc:mga0n895_149110_c1 nmdc:mga0n895_149110_c1_1205_1543 97
493 3300050512 nmdc:mga0n895_437385_c1 nmdc:mga0n895_437385_c1_767_1102 97
494 3300050513 nmdc:mga0rr50_350699_c1 nmdc:mga0rr50_350699_c1_346_684 97
495 3300050515 nmdc:mga0a205_1333364_c1 nmdc:mga0a205_1333364_c1_206_541 97
496 3300050515 nmdc:mga0a205_412192_c1 nmdc:mga0a205_412192_c1_722_1060 97
497 3300050516 nmdc:mga0sz30_50787_c2 nmdc:mga0sz30_50787_c2_231_563 97
498 3300053077 Ga0495601_0031681 Ga0495601_0031681_2885_3268 97
499 3300053078 Ga0495612_0051091 Ga0495612_0051091_1115_1498 97
500 3300053139 Ga0500568_0182718 Ga0500568_0182718_160_492 97
501 3300053146 Ga0500588_0141757 Ga0500588_0141757_268_600 97
502 3300053153 Ga0500616_0040117 Ga0500616_0040117_1404_1736 97
503 3300053178 Ga0500637_0526571 Ga0500637_0526571_63_395 97
504 3300053730 Ga0500645_000006 Ga0500645_000006_82296_82628 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

12

103

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7633 8 89
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6891 9 86
2od0-assembly1.cif.gz_B the crystal structure of gene product vp1028 from vibrio parahaemolyticus 0.6781 6 85
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6549 8 89
6aii-assembly1.cif.gz_A catalytic domain of pdagac 0.6127 29 53
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7633 8 89 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.687 5 82 3.90.1150.30
3h9xA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6858 9 86 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6791 9 95 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6549 8 89 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9868 3 89
AF-A0A4R8J6C8-F1-model_v4 deleted 0.9818 5 89
AF-A0A100X675-F1-model_v4 deleted 0.9732 3 89
AF-A0A413RIH2-F1-model_v4 TfoX family protein 0.972 3 89
AF-A0A1H0PB70-F1-model_v4 TfoX N-terminal domain-containing protein 0.9707 1 89

Feature Viewer

pLDDT pTM Quality
89.57 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map