F456172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 504 | 242 | 504 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10219077|Ga0075433_102190772 |
| Length | 278 |
| Sequence | MPTFDIVTIFPAMIEQSLAAGIIGRAVASRLIDVRIRDLRDFTTDRHRVVDDVPYGGGPGMVLKPDPIFRALDAIEAERGAPLTVVLTSPQGRRFTQSEAQRLSGLDHLVLLCGRYEGFDDRVRARVTEELSIGDYVLTGGELPALVILDAVARFVPGVVGDEQSVAEDSFSRGLLDFPQFTRPAEISVRSTSGSEESSGANAKQEAGSAEAFSGRVLKVPDVLLSGNHAEIRRWRKREALSRTLDRRPDLLTGASLDEEERQILRELQDGRTAGKGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 147 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 148 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 149 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 156 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 175 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 225 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 228 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.17 |
| Rhizosphere | 95.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10001548 | 3300005290 | Bacteria | 12566 |
| 2 | Ga0070690_100065962 | 3300005330 | Bacteria | 2342 |
| 3 | Ga0070690_100145033 | 3300005330 | Bacteria | 1614 |
| 4 | Ga0070690_100356119 | 3300005330 | Bacteria | 1064 |
| 5 | Ga0070690_100433701 | 3300005330 | Bacteria | 971 |
| 6 | Ga0070670_100440621 | 3300005331 | Unclassified | 1153 |
| 7 | Ga0070677_10212121 | 3300005333 | Bacteria | 941 |
| 8 | Ga0068869_100040162 | 3300005334 | Bacteria | 3345 |
| 9 | Ga0068869_100093811 | 3300005334 | Bacteria | 2262 |
| 10 | Ga0070666_10004561 | 3300005335 | Bacteria | 8448 |
| 11 | Ga0070666_10224331 | 3300005335 | Bacteria | 1326 |
| 12 | Ga0070680_100533887 | 3300005336 | Bacteria | 1005 |
| 13 | Ga0068868_100072543 | 3300005338 | Bacteria | 2747 |
| 14 | Ga0068868_100239854 | 3300005338 | Bacteria | 1523 |
| 15 | Ga0068868_100600362 | 3300005338 | Bacteria | 975 |
| 16 | Ga0070660_100010154 | 3300005339 | Bacteria | 6644 |
| 17 | Ga0070689_100046446 | 3300005340 | Bacteria | 3347 |
| 18 | Ga0070689_100362214 | 3300005340 | Bacteria | 1218 |
| 19 | Ga0070691_10001930 | 3300005341 | Bacteria | 9116 |
| 20 | Ga0070687_100214595 | 3300005343 | Bacteria | 1175 |
| 21 | Ga0070661_100018622 | 3300005344 | Bacteria | 4940 |
| 22 | Ga0070661_100463643 | 3300005344 | Bacteria | 1009 |
| 23 | Ga0070668_100043395 | 3300005347 | Bacteria | 3448 |
| 24 | Ga0070669_100002325 | 3300005353 | Bacteria | 13747 |
| 25 | Ga0070669_100030879 | 3300005353 | Bacteria | 3868 |
| 26 | Ga0070675_100000496 | 3300005354 | Bacteria | 26949 |
| 27 | Ga0070675_100281787 | 3300005354 | Bacteria | 1461 |
| 28 | Ga0070675_100468256 | 3300005354 | Bacteria | 1132 |
| 29 | Ga0070674_100002893 | 3300005356 | Bacteria | 9505 |
| 30 | Ga0070674_100092948 | 3300005356 | Bacteria | 2182 |
| 31 | Ga0070673_100080474 | 3300005364 | Bacteria | 2639 |
| 32 | Ga0070673_100082067 | 3300005364 | Bacteria | 2616 |
| 33 | Ga0070673_100238566 | 3300005364 | Bacteria | 1580 |
| 34 | Ga0070673_100425959 | 3300005364 | Bacteria | 1190 |
| 35 | Ga0070688_100043097 | 3300005365 | Bacteria | 2779 |
| 36 | Ga0070688_100051154 | 3300005365 | Bacteria | 2577 |
| 37 | Ga0070688_100145833 | 3300005365 | Bacteria | 1613 |
| 38 | Ga0070688_100152938 | 3300005365 | Bacteria | 1579 |
| 39 | Ga0070688_100195876 | 3300005365 | Bacteria | 1411 |
| 40 | Ga0070659_100087730 | 3300005366 | Bacteria | 2491 |
| 41 | Ga0070659_100375385 | 3300005366 | Bacteria | 1197 |
| 42 | Ga0070667_100006918 | 3300005367 | Bacteria | 9422 |
| 43 | Ga0070713_100027954 | 3300005436 | Bacteria | 4448 |
| 44 | Ga0070713_100243582 | 3300005436 | Unclassified | 1638 |
| 45 | Ga0070701_10006223 | 3300005438 | Bacteria | 5005 |
| 46 | Ga0070701_10304591 | 3300005438 | Bacteria | 981 |
| 47 | Ga0070705_100003585 | 3300005440 | Bacteria | 7603 |
| 48 | Ga0070700_100001354 | 3300005441 | Bacteria | 12177 |
| 49 | Ga0070700_100124821 | 3300005441 | Bacteria | 1729 |
| 50 | Ga0070700_100176322 | 3300005441 | Bacteria | 1484 |
| 51 | Ga0070694_100005646 | 3300005444 | Bacteria | 7583 |
| 52 | Ga0070694_100043330 | 3300005444 | Bacteria | 3009 |
| 53 | Ga0070663_100153003 | 3300005455 | Bacteria | 1770 |
| 54 | Ga0070678_100094599 | 3300005456 | Bacteria | 2300 |
| 55 | Ga0070678_100530402 | 3300005456 | Bacteria | 1043 |
| 56 | Ga0070662_100055306 | 3300005457 | Bacteria | 2879 |
| 57 | Ga0070662_100309853 | 3300005457 | Bacteria | 1285 |
| 58 | Ga0070681_10392850 | 3300005458 | Bacteria | 1298 |
| 59 | Ga0068867_100014014 | 3300005459 | Bacteria | 5678 |
| 60 | Ga0070685_10072672 | 3300005466 | Bacteria | 2043 |
| 61 | Ga0070706_100210660 | 3300005467 | Bacteria | 1815 |
| 62 | Ga0070707_100214643 | 3300005468 | Bacteria | 1875 |
| 63 | Ga0070707_100630115 | 3300005468 | Bacteria | 1035 |
| 64 | Ga0070698_100002146 | 3300005471 | Bacteria | 21864 |
| 65 | Ga0070698_100045279 | 3300005471 | Bacteria | 4504 |
| 66 | Ga0070698_100471999 | 3300005471 | Bacteria | 1191 |
| 67 | Ga0070699_100379678 | 3300005518 | Bacteria | 1276 |
| 68 | Ga0070699_100472289 | 3300005518 | Bacteria | 1138 |
| 69 | Ga0070679_100031825 | 3300005530 | Bacteria | 5215 |
| 70 | Ga0070679_100108212 | 3300005530 | Bacteria | 2766 |
| 71 | Ga0070684_100049945 | 3300005535 | Bacteria | 3632 |
| 72 | Ga0070697_100085923 | 3300005536 | Bacteria | 2595 |
| 73 | Ga0070697_100364874 | 3300005536 | Bacteria | 1249 |
| 74 | Ga0070672_100229417 | 3300005543 | Bacteria | 1559 |
| 75 | Ga0070686_100001752 | 3300005544 | Bacteria | 12145 |
| 76 | Ga0070686_100147392 | 3300005544 | Bacteria | 1644 |
| 77 | Ga0070686_100515971 | 3300005544 | Bacteria | 930 |
| 78 | Ga0070695_100001186 | 3300005545 | Bacteria | 14336 |
| 79 | Ga0070695_100004311 | 3300005545 | Bacteria | 8329 |
| 80 | Ga0070696_100017382 | 3300005546 | Bacteria | 4854 |
| 81 | Ga0070696_100022282 | 3300005546 | Bacteria | 4303 |
| 82 | Ga0070665_100002437 | 3300005548 | Bacteria | 20499 |
| 83 | Ga0070665_100018385 | 3300005548 | Bacteria | 7005 |
| 84 | Ga0070704_100005881 | 3300005549 | Bacteria | 7189 |
| 85 | Ga0070704_100010428 | 3300005549 | Bacteria | 5653 |
| 86 | Ga0070704_100167114 | 3300005549 | Bacteria | 1745 |
| 87 | Ga0068855_100006981 | 3300005563 | Bacteria | 13708 |
| 88 | Ga0070664_100040871 | 3300005564 | Bacteria | 3911 |
| 89 | Ga0068854_100002435 | 3300005578 | Bacteria | 11502 |
| 90 | Ga0068854_100025719 | 3300005578 | Bacteria | 4039 |
| 91 | Ga0068854_100077016 | 3300005578 | Bacteria | 2453 |
| 92 | Ga0070702_100049106 | 3300005615 | Bacteria | 2405 |
| 93 | Ga0068859_100072571 | 3300005617 | Bacteria | 3479 |
| 94 | Ga0068859_100549292 | 3300005617 | Bacteria | 1250 |
| 95 | Ga0068864_100477131 | 3300005618 | Bacteria | 1197 |
| 96 | Ga0068866_10029079 | 3300005718 | Bacteria | 2639 |
| 97 | Ga0068861_100018565 | 3300005719 | Bacteria | 4954 |
| 98 | Ga0068861_100032421 | 3300005719 | Bacteria | 3845 |
| 99 | Ga0068861_100118308 | 3300005719 | Bacteria | 2134 |
| 100 | Ga0068863_100011770 | 3300005841 | Bacteria | 8459 |
| 101 | Ga0068858_100063491 | 3300005842 | Bacteria | 3418 |
| 102 | Ga0068858_100104840 | 3300005842 | Bacteria | 2638 |
| 103 | Ga0068858_100142718 | 3300005842 | Bacteria | 2249 |
| 104 | Ga0068858_100252384 | 3300005842 | Bacteria | 1676 |
| 105 | Ga0068858_100692029 | 3300005842 | Bacteria | 992 |
| 106 | Ga0068860_100201285 | 3300005843 | Bacteria | 1930 |
| 107 | Ga0068860_100283819 | 3300005843 | Bacteria | 1619 |
| 108 | Ga0068860_100338616 | 3300005843 | Bacteria | 1479 |
| 109 | Ga0068862_100013444 | 3300005844 | Bacteria | 6775 |
| 110 | Ga0068862_100126118 | 3300005844 | Bacteria | 2260 |
| 111 | Ga0068862_100628512 | 3300005844 | Bacteria | 1034 |
| 112 | Ga0068862_100731488 | 3300005844 | Bacteria | 961 |
| 113 | Ga0081455_10014844 | 3300005937 | Bacteria | 7597 |
| 114 | Ga0081539_10062389 | 3300005985 | Bacteria | 2037 |
| 115 | Ga0081539_10103103 | 3300005985 | Bacteria | 1450 |
| 116 | Ga0075432_10050030 | 3300006058 | Bacteria | 1473 |
| 117 | Ga0097621_100005574 | 3300006237 | Bacteria | 8873 |
| 118 | Ga0068871_100002524 | 3300006358 | Bacteria | 12482 |
| 119 | Ga0075428_100036786 | 3300006844 | Bacteria | 5390 |
| 120 | Ga0075428_100071590 | 3300006844 | Bacteria | 3789 |
| 121 | Ga0075430_100002396 | 3300006846 | Bacteria | 15593 |
| 122 | Ga0075430_100085236 | 3300006846 | Bacteria | 2645 |
| 123 | Ga0075430_100703775 | 3300006846 | Bacteria | 833 |
| 124 | Ga0075431_100014651 | 3300006847 | Bacteria | 7933 |
| 125 | Ga0075431_100026567 | 3300006847 | Bacteria | 5939 |
| 126 | Ga0075433_10164802 | 3300006852 | Bacteria | 1973 |
| 127 | Ga0075433_10219077 | 3300006852 | Bacteria | 1691 |
| 128 | Ga0075433_10269146 | 3300006852 | Bacteria | 1510 |
| 129 | Ga0075433_10360308 | 3300006852 | Bacteria | 1285 |
| 130 | Ga0075433_10568814 | 3300006852 | Bacteria | 996 |
| 131 | Ga0075434_100005397 | 3300006871 | Bacteria | 11632 |
| 132 | Ga0075434_100006471 | 3300006871 | Bacteria | 10736 |
| 133 | Ga0075434_100036729 | 3300006871 | Bacteria | 4846 |
| 134 | Ga0075434_100065690 | 3300006871 | Bacteria | 3613 |
| 135 | Ga0075434_100143244 | 3300006871 | Bacteria | 2410 |
| 136 | Ga0075434_100220650 | 3300006871 | Bacteria | 1916 |
| 137 | Ga0075429_100091910 | 3300006880 | Bacteria | 2647 |
| 138 | Ga0075429_100102978 | 3300006880 | Bacteria | 2493 |
| 139 | Ga0075429_100242214 | 3300006880 | Bacteria | 1580 |
| 140 | Ga0075429_100417723 | 3300006880 | Bacteria | 1175 |
| 141 | Ga0068865_100035864 | 3300006881 | Bacteria | 3339 |
| 142 | Ga0068865_100057769 | 3300006881 | Bacteria | 2708 |
| 143 | Ga0068865_100123456 | 3300006881 | Bacteria | 1929 |
| 144 | Ga0068865_100191852 | 3300006881 | Bacteria | 1581 |
| 145 | Ga0068865_100216570 | 3300006881 | Bacteria | 1495 |
| 146 | Ga0075436_100029225 | 3300006914 | Bacteria | 3790 |
| 147 | Ga0075436_100045487 | 3300006914 | Bacteria | 3028 |
| 148 | Ga0075436_100084673 | 3300006914 | Bacteria | 2200 |
| 149 | Ga0075436_100225021 | 3300006914 | Bacteria | 1332 |
| 150 | Ga0097620_100072571 | 3300006931 | Bacteria | 3479 |
| 151 | Ga0097620_100549326 | 3300006931 | Bacteria | 1250 |
| 152 | Ga0075435_100000498 | 3300007076 | Bacteria | 23940 |
| 153 | Ga0075435_100003662 | 3300007076 | Bacteria | 10464 |
| 154 | Ga0075435_100147815 | 3300007076 | Bacteria | 1974 |
| 155 | Ga0075435_100243635 | 3300007076 | Bacteria | 1529 |
| 156 | Ga0075435_100255739 | 3300007076 | Bacteria | 1491 |
| 157 | Ga0075435_100372125 | 3300007076 | Bacteria | 1227 |
| 158 | Ga0099794_10072234 | 3300007265 | Bacteria | 1691 |
| 159 | Ga0111539_10000556 | 3300009094 | Bacteria | 47801 |
| 160 | Ga0111539_10000850 | 3300009094 | Bacteria | 39822 |
| 161 | Ga0111539_10001538 | 3300009094 | Bacteria | 30724 |
| 162 | Ga0111539_10040689 | 3300009094 | Bacteria | 5593 |
| 163 | Ga0111539_10097733 | 3300009094 | Bacteria | 3449 |
| 164 | Ga0111539_10153002 | 3300009094 | Bacteria | 2700 |
| 165 | Ga0111539_10338843 | 3300009094 | Bacteria | 1750 |
| 166 | Ga0105245_10007966 | 3300009098 | Bacteria | 9264 |
| 167 | Ga0105245_10324655 | 3300009098 | Bacteria | 1517 |
| 168 | Ga0105245_10488636 | 3300009098 | Bacteria | 1245 |
| 169 | Ga0105247_10002063 | 3300009101 | Bacteria | 13915 |
| 170 | Ga0114129_10001609 | 3300009147 | Bacteria | 30680 |
| 171 | Ga0114129_10008383 | 3300009147 | Bacteria | 14728 |
| 172 | Ga0114129_10076271 | 3300009147 | Bacteria | 4668 |
| 173 | Ga0114129_10112038 | 3300009147 | Bacteria | 3763 |
| 174 | Ga0114129_10130688 | 3300009147 | Bacteria | 3449 |
| 175 | Ga0114129_10136975 | 3300009147 | Bacteria | 3359 |
| 176 | Ga0114129_10173964 | 3300009147 | Bacteria | 2933 |
| 177 | Ga0114129_10189609 | 3300009147 | Bacteria | 2793 |
| 178 | Ga0114129_10220269 | 3300009147 | Bacteria | 2560 |
| 179 | Ga0114129_10272385 | 3300009147 | Bacteria | 2264 |
| 180 | Ga0114129_10438593 | 3300009147 | Bacteria | 1715 |
| 181 | Ga0114129_10458246 | 3300009147 | Bacteria | 1671 |
| 182 | Ga0114129_10607010 | 3300009147 | Bacteria | 1417 |
| 183 | Ga0114129_10760161 | 3300009147 | Bacteria | 1240 |
| 184 | Ga0105243_10015866 | 3300009148 | Bacteria | 5698 |
| 185 | Ga0105243_10032809 | 3300009148 | Bacteria | 4014 |
| 186 | Ga0105241_10151718 | 3300009174 | Bacteria | 1896 |
| 187 | Ga0105242_10012837 | 3300009176 | Bacteria | 6454 |
| 188 | Ga0105242_10023293 | 3300009176 | Bacteria | 4880 |
| 189 | Ga0105242_10048267 | 3300009176 | Bacteria | 3460 |
| 190 | Ga0105242_10191974 | 3300009176 | Bacteria | 1809 |
| 191 | Ga0105248_10003193 | 3300009177 | Bacteria | 18164 |
| 192 | Ga0105248_10013113 | 3300009177 | Bacteria | 9126 |
| 193 | Ga0105238_10105959 | 3300009551 | Bacteria | 2793 |
| 194 | Ga0105238_10431292 | 3300009551 | Bacteria | 1314 |
| 195 | Ga0105249_10088310 | 3300009553 | Bacteria | 2895 |
| 196 | Ga0105249_10605909 | 3300009553 | Bacteria | 1150 |
| 197 | Ga0105239_10812195 | 3300010375 | Bacteria | 1072 |
| 198 | Ga0105246_10343029 | 3300011119 | Bacteria | 1221 |
| 199 | Ga0157374_10042978 | 3300013296 | Bacteria | 4172 |
| 200 | Ga0157378_10387503 | 3300013297 | Bacteria | 1374 |
| 201 | Ga0163162_10094080 | 3300013306 | Bacteria | 3082 |
| 202 | Ga0157375_10059354 | 3300013308 | Bacteria | 3790 |
| 203 | Ga0157375_10194988 | 3300013308 | Bacteria | 2180 |
| 204 | Ga0157375_10634209 | 3300013308 | Bacteria | 1226 |
| 205 | Ga0163163_10021899 | 3300014325 | Bacteria | 6040 |
| 206 | Ga0163163_10159243 | 3300014325 | Bacteria | 2303 |
| 207 | Ga0163163_10316507 | 3300014325 | Bacteria | 1614 |
| 208 | Ga0157380_10085625 | 3300014326 | Bacteria | 2587 |
| 209 | Ga0157380_10338320 | 3300014326 | Bacteria | 1403 |
| 210 | Ga0157380_10392440 | 3300014326 | Bacteria | 1314 |
| 211 | Ga0157377_10021813 | 3300014745 | Bacteria | 3374 |
| 212 | Ga0157377_10062943 | 3300014745 | Bacteria | 2124 |
| 213 | Ga0157377_10067855 | 3300014745 | Bacteria | 2054 |
| 214 | Ga0157379_10008180 | 3300014968 | Bacteria | 9081 |
| 215 | Ga0157379_10058612 | 3300014968 | Bacteria | 3444 |
| 216 | Ga0163161_10185710 | 3300017792 | Bacteria | 1596 |
| 217 | Ga0207682_10072839 | 3300025893 | Bacteria | 1458 |
| 218 | Ga0207642_10030863 | 3300025899 | Bacteria | 2238 |
| 219 | Ga0207680_10009647 | 3300025903 | Bacteria | 4798 |
| 220 | Ga0207680_10158790 | 3300025903 | Bacteria | 1514 |
| 221 | Ga0207680_10208141 | 3300025903 | Bacteria | 1336 |
| 222 | Ga0207699_10013130 | 3300025906 | Bacteria | 4229 |
| 223 | Ga0207645_10011140 | 3300025907 | Bacteria | 6153 |
| 224 | Ga0207643_10422824 | 3300025908 | Bacteria | 845 |
| 225 | Ga0207684_10301894 | 3300025910 | Bacteria | 1380 |
| 226 | Ga0207654_10206780 | 3300025911 | Bacteria | 1295 |
| 227 | Ga0207662_10048356 | 3300025918 | Bacteria | 2519 |
| 228 | Ga0207662_10242314 | 3300025918 | Bacteria | 1181 |
| 229 | Ga0207657_10009283 | 3300025919 | Bacteria | 9906 |
| 230 | Ga0207652_10109816 | 3300025921 | Bacteria | 2446 |
| 231 | Ga0207652_10796978 | 3300025921 | Bacteria | 839 |
| 232 | Ga0207646_10358137 | 3300025922 | Bacteria | 1318 |
| 233 | Ga0207681_10046826 | 3300025923 | Bacteria | 2909 |
| 234 | Ga0207681_10066277 | 3300025923 | Bacteria | 2499 |
| 235 | Ga0207694_10400687 | 3300025924 | Bacteria | 1141 |
| 236 | Ga0207659_10000167 | 3300025926 | Bacteria | 39314 |
| 237 | Ga0207659_10102132 | 3300025926 | Bacteria | 2164 |
| 238 | Ga0207659_10701249 | 3300025926 | Bacteria | 867 |
| 239 | Ga0207687_10221888 | 3300025927 | Bacteria | 1489 |
| 240 | Ga0207700_10105329 | 3300025928 | Bacteria | 2258 |
| 241 | Ga0207644_10058497 | 3300025931 | Bacteria | 2786 |
| 242 | Ga0207690_10030660 | 3300025932 | Bacteria | 3433 |
| 243 | Ga0207706_10077455 | 3300025933 | Bacteria | 2924 |
| 244 | Ga0207706_10195601 | 3300025933 | Bacteria | 1774 |
| 245 | Ga0207686_10090878 | 3300025934 | Bacteria | 2015 |
| 246 | Ga0207686_10137805 | 3300025934 | Bacteria | 1682 |
| 247 | Ga0207686_10391463 | 3300025934 | Bacteria | 1056 |
| 248 | Ga0207709_10037621 | 3300025935 | Bacteria | 2877 |
| 249 | Ga0207670_10245353 | 3300025936 | Bacteria | 1382 |
| 250 | Ga0207669_10043854 | 3300025937 | Bacteria | 2622 |
| 251 | Ga0207669_10058031 | 3300025937 | Bacteria | 2360 |
| 252 | Ga0207669_10164162 | 3300025937 | Bacteria | 1573 |
| 253 | Ga0207704_10058853 | 3300025938 | Bacteria | 2368 |
| 254 | Ga0207704_10265186 | 3300025938 | Bacteria | 1297 |
| 255 | Ga0207704_10304996 | 3300025938 | Bacteria | 1221 |
| 256 | Ga0207704_10369400 | 3300025938 | Bacteria | 1122 |
| 257 | Ga0207691_10062879 | 3300025940 | Bacteria | 3367 |
| 258 | Ga0207691_10507751 | 3300025940 | Bacteria | 1023 |
| 259 | Ga0207711_10011317 | 3300025941 | Bacteria | 7411 |
| 260 | Ga0207711_10205021 | 3300025941 | Bacteria | 1800 |
| 261 | Ga0207711_10352630 | 3300025941 | Bacteria | 1362 |
| 262 | Ga0207689_10048606 | 3300025942 | Bacteria | 3499 |
| 263 | Ga0207689_10191727 | 3300025942 | Bacteria | 1686 |
| 264 | Ga0207689_10199805 | 3300025942 | Bacteria | 1650 |
| 265 | Ga0207689_10323996 | 3300025942 | Bacteria | 1279 |
| 266 | Ga0207679_10033079 | 3300025945 | Bacteria | 3636 |
| 267 | Ga0207679_10790683 | 3300025945 | Bacteria | 865 |
| 268 | Ga0207667_10068503 | 3300025949 | Bacteria | 3695 |
| 269 | Ga0207651_10005718 | 3300025960 | Bacteria | 6419 |
| 270 | Ga0207651_10096873 | 3300025960 | Bacteria | 2177 |
| 271 | Ga0207651_10147778 | 3300025960 | Bacteria | 1825 |
| 272 | Ga0207640_10011712 | 3300025981 | Bacteria | 4973 |
| 273 | Ga0207640_10106607 | 3300025981 | Bacteria | 1977 |
| 274 | Ga0207658_10017805 | 3300025986 | Bacteria | 4895 |
| 275 | Ga0207677_10071625 | 3300026023 | Bacteria | 2447 |
| 276 | Ga0207677_10111746 | 3300026023 | Bacteria | 2036 |
| 277 | Ga0207677_10123296 | 3300026023 | Bacteria | 1954 |
| 278 | Ga0207703_10014271 | 3300026035 | Bacteria | 6196 |
| 279 | Ga0207703_10059864 | 3300026035 | Bacteria | 3112 |
| 280 | Ga0207639_10349589 | 3300026041 | Bacteria | 1320 |
| 281 | Ga0207678_10289444 | 3300026067 | Bacteria | 1407 |
| 282 | Ga0207708_10014545 | 3300026075 | Bacteria | 5887 |
| 283 | Ga0207708_10020634 | 3300026075 | Bacteria | 4969 |
| 284 | Ga0207708_10137195 | 3300026075 | Bacteria | 1916 |
| 285 | Ga0207641_10003071 | 3300026088 | Bacteria | 15056 |
| 286 | Ga0207641_10156984 | 3300026088 | Bacteria | 2065 |
| 287 | Ga0207648_10022105 | 3300026089 | Bacteria | 5714 |
| 288 | Ga0207648_10169715 | 3300026089 | Bacteria | 1928 |
| 289 | Ga0207648_10185940 | 3300026089 | Bacteria | 1840 |
| 290 | Ga0207648_10312380 | 3300026089 | Bacteria | 1411 |
| 291 | Ga0207648_10347880 | 3300026089 | Bacteria | 1336 |
| 292 | Ga0207676_10539426 | 3300026095 | Bacteria | 1113 |
| 293 | Ga0207674_10454026 | 3300026116 | Bacteria | 1239 |
| 294 | Ga0207675_100001792 | 3300026118 | Bacteria | 21488 |
| 295 | Ga0207675_100010296 | 3300026118 | Bacteria | 8761 |
| 296 | Ga0207675_100052937 | 3300026118 | Bacteria | 3787 |
| 297 | Ga0207675_100329399 | 3300026118 | Bacteria | 1492 |
| 298 | Ga0207675_100473593 | 3300026118 | Bacteria | 1244 |
| 299 | Ga0207683_10207596 | 3300026121 | Bacteria | 1782 |
| 300 | Ga0209588_1063064 | 3300027671 | Bacteria | 1198 |
| 301 | Ga0209974_10031257 | 3300027876 | Bacteria | 1763 |
| 302 | Ga0207428_10001495 | 3300027907 | Bacteria | 24437 |
| 303 | Ga0207428_10001962 | 3300027907 | Bacteria | 20882 |
| 304 | Ga0207428_10005045 | 3300027907 | Bacteria | 12402 |
| 305 | Ga0207428_10015551 | 3300027907 | Bacteria | 6578 |
| 306 | Ga0207428_10042804 | 3300027907 | Bacteria | 3661 |
| 307 | Ga0207428_10046665 | 3300027907 | Bacteria | 3484 |
| 308 | Ga0268266_10552784 | 3300028379 | Bacteria | 1103 |
| 309 | Ga0268265_10003170 | 3300028380 | Bacteria | 11959 |
| 310 | Ga0268265_10125945 | 3300028380 | Bacteria | 2120 |
| 311 | Ga0268265_10701192 | 3300028380 | Bacteria | 978 |
| 312 | Ga0268264_10079941 | 3300028381 | Bacteria | 2791 |
| 313 | Ga0268264_10168028 | 3300028381 | Bacteria | 1982 |
| 314 | Ga0268264_10269533 | 3300028381 | Bacteria | 1590 |
| 315 | Ga0268264_10444157 | 3300028381 | Bacteria | 1255 |
| 316 | Ga0268264_10452178 | 3300028381 | Bacteria | 1244 |
| 317 | Ga0307408_100346811 | 3300031548 | Bacteria | 1259 |
| 318 | Ga0373948_0001826 | 3300034817 | Bacteria | 3038 |
| 319 | Ga0373948_0034077 | 3300034817 | Bacteria | 1039 |
| 320 | Ga0373950_0043047 | 3300034818 | Bacteria | 869 |
| 321 | Ga0373958_0001072 | 3300034819 | Bacteria | 3594 |
| 322 | Ga0373958_0004779 | 3300034819 | Bacteria | 2022 |
| 323 | Ga0373959_0001715 | 3300034820 | Bacteria | 3501 |
| 324 | Ga0373929_0002316 | 3300035085 | Bacteria | 3506 |
| 325 | Ga0373929_0020329 | 3300035085 | Bacteria | 1338 |
| 326 | Ga0373934_0085794 | 3300035086 | Bacteria | 1267 |
| 327 | Ga0373940_0000157 | 3300035088 | Bacteria | 8940 |
| 328 | Ga0373949_0001672 | 3300035090 | Bacteria | 6186 |
| 329 | Ga0373951_0035479 | 3300035091 | Bacteria | 1187 |
| 330 | Ga0373952_0045418 | 3300035092 | Bacteria | 1029 |
| 331 | Ga0373932_0000337 | 3300035112 | Bacteria | 14304 |
| 332 | Ga0373941_0002940 | 3300035115 | Bacteria | 3806 |
| 333 | Ga0373941_0069667 | 3300035115 | Bacteria | 1164 |
| 334 | Ga0373945_0089583 | 3300035116 | Bacteria | 1190 |
| 335 | Ga0373956_0155292 | 3300035119 | Bacteria | 1077 |
| 336 | Ga0373943_0003762 | 3300035170 | Bacteria | 6893 |
| 337 | Ga0373943_0353290 | 3300035170 | Bacteria | 843 |
| 338 | Ga0373946_0005443 | 3300035171 | Bacteria | 4590 |
| 339 | Ga0373955_0047283 | 3300035172 | Bacteria | 2329 |
| 340 | Ga0373955_0093635 | 3300035172 | Bacteria | 1716 |
| 341 | Ga0373955_0196277 | 3300035172 | Bacteria | 1201 |
| 342 | Ga0373955_0280144 | 3300035172 | Bacteria | 1003 |
| 343 | Ga0373942_0007670 | 3300035207 | Bacteria | 2508 |
| 344 | Ga0373961_0003080 | 3300035241 | Bacteria | 4192 |
| 345 | Ga0373962_0007033 | 3300035242 | Bacteria | 2746 |
| 346 | Ga0373962_0027860 | 3300035242 | Bacteria | 1530 |
| 347 | Ga0373924_0007005 | 3300035410 | Bacteria | 4059 |
| 348 | Ga0373924_0035778 | 3300035410 | Bacteria | 2015 |
| 349 | Ga0373931_0004668 | 3300035691 | Bacteria | 6270 |
| 350 | Ga0373935_0143987 | 3300035692 | Bacteria | 1612 |
| 351 | Ga0373947_0055734 | 3300035725 | Bacteria | 2388 |
| 352 | Ga0373937_0029611 | 3300036401 | Bacteria | 4959 |
| 353 | Ga0373937_0192069 | 3300036401 | Bacteria | 1919 |
| 354 | Ga0373937_0494702 | 3300036401 | Bacteria | 1162 |
| 355 | Ga0373925_0016292 | 3300037068 | Bacteria | 5382 |
| 356 | Ga0373925_0052575 | 3300037068 | Bacteria | 3044 |
| 357 | Ga0466963_0268461 | 3300044694 | Bacteria | 1199 |
| 358 | Ga0451576_0031558 | 3300045051 | Bacteria | 5647 |
| 359 | Ga0451576_0132120 | 3300045051 | Bacteria | 2603 |
| 360 | Ga0451576_0214922 | 3300045051 | Bacteria | 2008 |
| 361 | Ga0466958_0323756 | 3300045836 | Bacteria | 991 |
| 362 | Ga0495629_0027594 | 3300046459 | Bacteria | 4032 |
| 363 | Ga0495629_0108705 | 3300046459 | Bacteria | 1934 |
| 364 | Ga0495629_0208820 | 3300046459 | Bacteria | 1349 |
| 365 | Ga0495584_0061456 | 3300046491 | Bacteria | 1888 |
| 366 | Ga0495608_0002623 | 3300046511 | Bacteria | 12910 |
| 367 | Ga0495628_0042796 | 3300046516 | Bacteria | 3610 |
| 368 | Ga0495630_0021329 | 3300046517 | Bacteria | 4783 |
| 369 | Ga0495643_0013257 | 3300046522 | Bacteria | 4940 |
| 370 | Ga0495642_0026038 | 3300046528 | Bacteria | 2321 |
| 371 | Ga0495652_0168854 | 3300046529 | Bacteria | 1690 |
| 372 | Ga0495640_0115004 | 3300046533 | Bacteria | 1754 |
| 373 | Ga0495598_0037112 | 3300046537 | Bacteria | 1404 |
| 374 | Ga0495609_0005898 | 3300046538 | Bacteria | 6333 |
| 375 | Ga0495621_0009738 | 3300046539 | Bacteria | 2928 |
| 376 | Ga0495621_0012802 | 3300046539 | Bacteria | 2621 |
| 377 | Ga0495621_0018322 | 3300046539 | Bacteria | 2273 |
| 378 | Ga0495645_0001331 | 3300046543 | Bacteria | 16747 |
| 379 | Ga0495645_0299830 | 3300046543 | Bacteria | 1050 |
| 380 | Ga0495667_0008533 | 3300046559 | Bacteria | 6956 |
| 381 | Ga0495656_0100926 | 3300046615 | Bacteria | 1335 |
| 382 | Ga0495635_0094852 | 3300046663 | Bacteria | 2040 |
| 383 | Ga0495635_0337771 | 3300046663 | Bacteria | 1006 |
| 384 | Ga0495659_0011145 | 3300046664 | Bacteria | 2896 |
| 385 | Ga0495659_0083674 | 3300046664 | Bacteria | 1215 |
| 386 | Ga0495659_0100815 | 3300046664 | Bacteria | 1118 |
| 387 | Ga0495657_0047815 | 3300046675 | Bacteria | 2890 |
| 388 | Ga0495647_0019900 | 3300046681 | Bacteria | 2405 |
| 389 | Ga0495658_0045161 | 3300046683 | Bacteria | 2472 |
| 390 | Ga0495658_0095095 | 3300046683 | Bacteria | 1770 |
| 391 | Ga0495658_0154314 | 3300046683 | Bacteria | 1412 |
| 392 | Ga0495658_0282637 | 3300046683 | Bacteria | 1047 |
| 393 | Ga0495669_0035552 | 3300046684 | Bacteria | 2200 |
| 394 | Ga0495669_0099948 | 3300046684 | Bacteria | 1347 |
| 395 | Ga0495613_0006012 | 3300046689 | Bacteria | 9081 |
| 396 | Ga0495670_0045527 | 3300046691 | Bacteria | 2191 |
| 397 | Ga0495636_0025598 | 3300047318 | Bacteria | 2396 |
| 398 | Ga0495674_0164508 | 3300047319 | Bacteria | 1855 |
| 399 | Ga0495685_062534 | 3300047447 | Bacteria | 1253 |
| 400 | Ga0495684_0000430 | 3300047471 | Bacteria | 34261 |
| 401 | Ga0495684_0100121 | 3300047471 | Bacteria | 2191 |
| 402 | Ga0495615_0029127 | 3300048090 | Bacteria | 1308 |
| 403 | Ga0496102_0066968 | 3300048905 | Bacteria | 3293 |
| 404 | Ga0496102_0117685 | 3300048905 | Bacteria | 2480 |
| 405 | Ga0496104_0036425 | 3300048907 | Bacteria | 4600 |
| 406 | Ga0496106_0145065 | 3300048909 | Bacteria | 1869 |
| 407 | Ga0496106_0213600 | 3300048909 | Bacteria | 1537 |
| 408 | Ga0496106_0553483 | 3300048909 | Bacteria | 923 |
| 409 | Ga0496108_0062508 | 3300048911 | Bacteria | 3135 |
| 410 | Ga0496108_0174394 | 3300048911 | Bacteria | 1861 |
| 411 | Ga0496109_0133253 | 3300048912 | Bacteria | 2320 |
| 412 | Ga0496109_0177322 | 3300048912 | Bacteria | 2001 |
| 413 | Ga0496109_0254679 | 3300048912 | Bacteria | 1653 |
| 414 | Ga0496110_0760103 | 3300048913 | Bacteria | 873 |
| 415 | Ga0496111_0212686 | 3300048914 | Bacteria | 1436 |
| 416 | Ga0496112_0088263 | 3300048915 | Bacteria | 3069 |
| 417 | Ga0496112_0527107 | 3300048915 | Bacteria | 1116 |
| 418 | Ga0496112_0540123 | 3300048915 | Bacteria | 1100 |
| 419 | Ga0496112_0559768 | 3300048915 | Bacteria | 1077 |
| 420 | Ga0496113_0165548 | 3300048916 | Bacteria | 1749 |
| 421 | Ga0496114_0016251 | 3300048917 | Bacteria | 5994 |
| 422 | Ga0496114_0131212 | 3300048917 | Bacteria | 2164 |
| 423 | Ga0496114_0256247 | 3300048917 | Bacteria | 1540 |
| 424 | Ga0501036_0173847 | 3300049572 | Bacteria | 1814 |
| 425 | Ga0501038_0202379 | 3300049574 | Bacteria | 1593 |
| 426 | Ga0501039_0114521 | 3300049575 | Bacteria | 2110 |
| 427 | Ga0501041_0007828 | 3300049577 | Bacteria | 6278 |
| 428 | Ga0501046_0353574 | 3300049580 | Bacteria | 1066 |
| 429 | Ga0501048_0079742 | 3300049582 | Bacteria | 2310 |
| 430 | Ga0501067_0150720 | 3300049583 | Bacteria | 1296 |
| 431 | Ga0501071_0045591 | 3300049587 | Bacteria | 3148 |
| 432 | Ga0501072_0014257 | 3300049588 | Bacteria | 6090 |
| 433 | Ga0501075_0019658 | 3300049591 | Bacteria | 4902 |
| 434 | Ga0501075_0063616 | 3300049591 | Bacteria | 2782 |
| 435 | Ga0501076_0092215 | 3300049592 | Bacteria | 2437 |
| 436 | Ga0501076_0402542 | 3300049592 | Bacteria | 1125 |
| 437 | Ga0501249_009824 | 3300049679 | Bacteria | 1993 |
| 438 | Ga0501079_0012833 | 3300049741 | Bacteria | 6396 |
| 439 | Ga0501081_0085912 | 3300049743 | Bacteria | 2209 |
| 440 | Ga0501283_013721 | 3300049779 | Bacteria | 1231 |
| 441 | Ga0501045_0035619 | 3300049824 | Bacteria | 3614 |
| 442 | nmdc:mga05p37_113898_c1 | 3300050507 | Bacteria | 3325 |
| 443 | nmdc:mga05p37_11444_c1 | 3300050507 | Bacteria | 10565 |
| 444 | nmdc:mga05p37_1166939_c1 | 3300050507 | Bacteria | 799 |
| 445 | nmdc:mga05p37_12625_c1 | 3300050507 | Bacteria | 10088 |
| 446 | nmdc:mga05p37_13609_c1 | 3300050507 | Bacteria | 9749 |
| 447 | nmdc:mga05p37_13779_c2 | 3300050507 | Bacteria | 1350 |
| 448 | nmdc:mga05p37_33086_c1 | 3300050507 | Bacteria | 6332 |
| 449 | nmdc:mga05p37_399357_c1 | 3300050507 | Bacteria | 1605 |
| 450 | nmdc:mga05p37_456720_c1 | 3300050507 | Bacteria | 1477 |
| 451 | nmdc:mga05p37_62790_c1 | 3300050507 | Bacteria | 4572 |
| 452 | nmdc:mga05p37_65866_c1 | 3300050507 | Bacteria | 4457 |
| 453 | nmdc:mga05p37_76392_c1 | 3300050507 | Bacteria | 4124 |
| 454 | nmdc:mga09592_162500_c1 | 3300050508 | Bacteria | 1929 |
| 455 | nmdc:mga09592_201370_c1 | 3300050508 | Bacteria | 1724 |
| 456 | nmdc:mga09592_29060_c1 | 3300050508 | Bacteria | 4598 |
| 457 | nmdc:mga09592_40389_c1 | 3300050508 | Bacteria | 3919 |
| 458 | nmdc:mga0qj67_20292_c1 | 3300050509 | Bacteria | 5086 |
| 459 | nmdc:mga0qj67_4090_c1 | 3300050509 | Bacteria | 10586 |
| 460 | nmdc:mga06r32_16884_c1 | 3300050510 | Bacteria | 6659 |
| 461 | nmdc:mga06r32_70522_c1 | 3300050510 | Bacteria | 3380 |
| 462 | nmdc:mga08y16_124096_c1 | 3300050511 | Bacteria | 2687 |
| 463 | nmdc:mga08y16_146291_c1 | 3300050511 | Bacteria | 2457 |
| 464 | nmdc:mga08y16_17319_c1 | 3300050511 | Bacteria | 7586 |
| 465 | nmdc:mga08y16_256222_c1 | 3300050511 | Bacteria | 1807 |
| 466 | nmdc:mga08y16_2829_c1 | 3300050511 | Bacteria | 17834 |
| 467 | nmdc:mga08y16_3332_c1 | 3300050511 | Bacteria | 16637 |
| 468 | nmdc:mga08y16_401189_c1 | 3300050511 | Bacteria | 1403 |
| 469 | nmdc:mga08y16_80322_c1 | 3300050511 | Bacteria | 3400 |
| 470 | nmdc:mga08y16_8364_c1 | 3300050511 | Bacteria | 10825 |
| 471 | nmdc:mga0n895_155144_c1 | 3300050512 | Bacteria | 2320 |
| 472 | nmdc:mga0n895_32853_c1 | 3300050512 | Bacteria | 4983 |
| 473 | nmdc:mga0n895_343507_c1 | 3300050512 | Bacteria | 1512 |
| 474 | nmdc:mga0n895_354768_c1 | 3300050512 | Bacteria | 1485 |
| 475 | nmdc:mga0n895_383679_c1 | 3300050512 | Bacteria | 1422 |
| 476 | nmdc:mga0n895_57_c1 | 3300050512 | Bacteria | 65730 |
| 477 | nmdc:mga0n895_6739_c1 | 3300050512 | Bacteria | 9797 |
| 478 | nmdc:mga0n895_743953_c1 | 3300050512 | Bacteria | 974 |
| 479 | nmdc:mga0rr50_11908_c1 | 3300050513 | Bacteria | 5592 |
| 480 | nmdc:mga0rr50_141599_c1 | 3300050513 | Bacteria | 1935 |
| 481 | nmdc:mga0rr50_1568_c1 | 3300050513 | Bacteria | 12596 |
| 482 | nmdc:mga0rr50_24519_c1 | 3300050513 | Bacteria | 4178 |
| 483 | nmdc:mga0rr50_26900_c1 | 3300050513 | Bacteria | 4022 |
| 484 | nmdc:mga0rr50_46727_c1 | 3300050513 | Bacteria | 3188 |
| 485 | nmdc:mga0rr50_468150_c1 | 3300050513 | Bacteria | 1070 |
| 486 | nmdc:mga0rr50_5_c1 | 3300050513 | Bacteria | 327169 |
| 487 | nmdc:mga0rr50_647_c1 | 3300050513 | Bacteria | 18706 |
| 488 | nmdc:mga08x19_117833_c1 | 3300050514 | Bacteria | 1777 |
| 489 | nmdc:mga08x19_1472_c1 | 3300050514 | Bacteria | 14582 |
| 490 | nmdc:mga08x19_212672_c1 | 3300050514 | Bacteria | 1327 |
| 491 | nmdc:mga08x19_25509_c1 | 3300050514 | Bacteria | 3682 |
| 492 | nmdc:mga08x19_264651_c1 | 3300050514 | Bacteria | 1189 |
| 493 | nmdc:mga0a205_13205_c1 | 3300050515 | Bacteria | 7677 |
| 494 | nmdc:mga0a205_17039_c1 | 3300050515 | Bacteria | 6801 |
| 495 | nmdc:mga0a205_459765_c1 | 3300050515 | Unclassified | 1132 |
| 496 | nmdc:mga0a205_60494_c1 | 3300050515 | Bacteria | 3658 |
| 497 | nmdc:mga0a205_66017_c1 | 3300050515 | Bacteria | 3496 |
| 498 | nmdc:mga0a205_67230_c1 | 3300050515 | Bacteria | 3462 |
| 499 | Ga0495601_0112942 | 3300053077 | Bacteria | 1760 |
| 500 | Ga0495612_0044640 | 3300053078 | Bacteria | 1814 |
| 501 | Ga0495595_0073009 | 3300053084 | Bacteria | 1624 |
| 502 | Ga0495619_0033397 | 3300053085 | Bacteria | 3341 |
| 503 | Ga0495619_0296339 | 3300053085 | Bacteria | 1120 |
| 504 | Ga0501084_0347798 | 3300054114 | Bacteria | 1252 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0150720 | Ga0501067_0150720_210_959 | 208 |
| 2 | 3300046539 | Ga0495621_0009738 | Ga0495621_0009738_1067_1828 | 209 |
| 3 | 3300026116 | Ga0207674_10454026 | Ga0207674_104540262 | 210 |
| 4 | 3300046538 | Ga0495609_0005898 | Ga0495609_0005898_3769_4506 | 211 |
| 5 | 3300006871 | Ga0075434_100065690 | Ga0075434_1000656904 | 216 |
| 6 | 3300050512 | nmdc:mga0n895_343507_c1 | nmdc:mga0n895_343507_c1_92_892 | 216 |
| 7 | 3300050514 | nmdc:mga08x19_212672_c1 | nmdc:mga08x19_212672_c1_344_1129 | 216 |
| 8 | 3300049779 | Ga0501283_013721 | Ga0501283_013721_31_684 | 217 |
| 9 | 3300050513 | nmdc:mga0rr50_11908_c1 | nmdc:mga0rr50_11908_c1_881_1681 | 218 |
| 10 | 3300005985 | Ga0081539_10103103 | Ga0081539_101031032 | 221 |
| 11 | 3300005455 | Ga0070663_100153003 | Ga0070663_1001530032 | 222 |
| 12 | 3300009147 | Ga0114129_10008383 | Ga0114129_100083834 | 222 |
| 13 | 3300026067 | Ga0207678_10289444 | Ga0207678_102894442 | 222 |
| 14 | 3300050507 | nmdc:mga05p37_113898_c1 | nmdc:mga05p37_113898_c1_1069_1830 | 222 |
| 15 | 3300006358 | Ga0068871_100002524 | Ga0068871_10000252412 | 224 |
| 16 | 3300006881 | Ga0068865_100035864 | Ga0068865_1000358644 | 224 |
| 17 | 3300009176 | Ga0105242_10023293 | Ga0105242_100232934 | 224 |
| 18 | 3300026089 | Ga0207648_10169715 | Ga0207648_101697153 | 224 |
| 19 | 3300048917 | Ga0496114_0256247 | Ga0496114_0256247_400_1170 | 224 |
| 20 | 3300048913 | Ga0496110_0760103 | Ga0496110_0760103_10_696 | 225 |
| 21 | 3300005842 | Ga0068858_100252384 | Ga0068858_1002523843 | 227 |
| 22 | 3300009094 | Ga0111539_10040689 | Ga0111539_100406896 | 227 |
| 23 | 3300009098 | Ga0105245_10324655 | Ga0105245_103246552 | 227 |
| 24 | 3300009147 | Ga0114129_10130688 | Ga0114129_101306885 | 227 |
| 25 | 3300025926 | Ga0207659_10102132 | Ga0207659_101021323 | 227 |
| 26 | 3300026089 | Ga0207648_10185940 | Ga0207648_101859402 | 227 |
| 27 | 3300027876 | Ga0209974_10031257 | Ga0209974_100312572 | 227 |
| 28 | 3300027907 | Ga0207428_10042804 | Ga0207428_100428042 | 227 |
| 29 | 3300031548 | Ga0307408_100346811 | Ga0307408_1003468112 | 227 |
| 30 | 3300046539 | Ga0495621_0018322 | Ga0495621_0018322_1447_2187 | 227 |
| 31 | 3300050507 | nmdc:mga05p37_76392_c1 | nmdc:mga05p37_76392_c1_2485_3225 | 227 |
| 32 | 3300050508 | nmdc:mga09592_40389_c1 | nmdc:mga09592_40389_c1_2823_3563 | 227 |
| 33 | 3300050511 | nmdc:mga08y16_124096_c1 | nmdc:mga08y16_124096_c1_1337_2077 | 227 |
| 34 | 3300025910 | Ga0207684_10301894 | Ga0207684_103018942 | 228 |
| 35 | 3300026118 | Ga0207675_100473593 | Ga0207675_1004735932 | 228 |
| 36 | 3300050507 | nmdc:mga05p37_62790_c1 | nmdc:mga05p37_62790_c1_2415_3182 | 228 |
| 37 | 3300005330 | Ga0070690_100433701 | Ga0070690_1004337011 | 229 |
| 38 | 3300005441 | Ga0070700_100176322 | Ga0070700_1001763222 | 229 |
| 39 | 3300005444 | Ga0070694_100005646 | Ga0070694_1000056462 | 229 |
| 40 | 3300005471 | Ga0070698_100471999 | Ga0070698_1004719991 | 229 |
| 41 | 3300005518 | Ga0070699_100379678 | Ga0070699_1003796782 | 229 |
| 42 | 3300005545 | Ga0070695_100004311 | Ga0070695_1000043118 | 229 |
| 43 | 3300006852 | Ga0075433_10360308 | Ga0075433_103603082 | 229 |
| 44 | 3300007076 | Ga0075435_100147815 | Ga0075435_1001478153 | 229 |
| 45 | 3300009147 | Ga0114129_10173964 | Ga0114129_101739645 | 229 |
| 46 | 3300009147 | Ga0114129_10189609 | Ga0114129_101896093 | 229 |
| 47 | 3300009147 | Ga0114129_10272385 | Ga0114129_102723854 | 229 |
| 48 | 3300050507 | nmdc:mga05p37_11444_c1 | nmdc:mga05p37_11444_c1_1526_2260 | 229 |
| 49 | 3300050507 | nmdc:mga05p37_33086_c1 | nmdc:mga05p37_33086_c1_944_1678 | 229 |
| 50 | 3300050512 | nmdc:mga0n895_32853_c1 | nmdc:mga0n895_32853_c1_3326_4060 | 229 |
| 51 | 3300050513 | nmdc:mga0rr50_26900_c1 | nmdc:mga0rr50_26900_c1_544_1278 | 229 |
| 52 | 3300050515 | nmdc:mga0a205_60494_c1 | nmdc:mga0a205_60494_c1_264_998 | 229 |
| 53 | 3300005467 | Ga0070706_100210660 | Ga0070706_1002106603 | 230 |
| 54 | 3300005985 | Ga0081539_10062389 | Ga0081539_100623893 | 230 |
| 55 | 3300006871 | Ga0075434_100006471 | Ga0075434_1000064716 | 230 |
| 56 | 3300007076 | Ga0075435_100255739 | Ga0075435_1002557392 | 230 |
| 57 | 3300007265 | Ga0099794_10072234 | Ga0099794_100722342 | 230 |
| 58 | 3300009094 | Ga0111539_10153002 | Ga0111539_101530024 | 230 |
| 59 | 3300009147 | Ga0114129_10458246 | Ga0114129_104582463 | 230 |
| 60 | 3300009147 | Ga0114129_10760161 | Ga0114129_107601612 | 230 |
| 61 | 3300014326 | Ga0157380_10392440 | Ga0157380_103924402 | 230 |
| 62 | 3300027671 | Ga0209588_1063064 | Ga0209588_10630642 | 230 |
| 63 | 3300048917 | Ga0496114_0016251 | Ga0496114_0016251_3852_4625 | 230 |
| 64 | 3300050511 | nmdc:mga08y16_256222_c1 | nmdc:mga08y16_256222_c1_524_1267 | 230 |
| 65 | 3300050512 | nmdc:mga0n895_383679_c1 | nmdc:mga0n895_383679_c1_292_1026 | 230 |
| 66 | 3300050513 | nmdc:mga0rr50_1568_c1 | nmdc:mga0rr50_1568_c1_10021_10755 | 230 |
| 67 | 3300050515 | nmdc:mga0a205_67230_c1 | nmdc:mga0a205_67230_c1_145_879 | 230 |
| 68 | 3300005330 | Ga0070690_100065962 | Ga0070690_1000659624 | 231 |
| 69 | 3300005335 | Ga0070666_10004561 | Ga0070666_100045614 | 231 |
| 70 | 3300005338 | Ga0068868_100072543 | Ga0068868_1000725435 | 231 |
| 71 | 3300005341 | Ga0070691_10001930 | Ga0070691_100019308 | 231 |
| 72 | 3300005343 | Ga0070687_100214595 | Ga0070687_1002145951 | 231 |
| 73 | 3300005347 | Ga0070668_100043395 | Ga0070668_1000433954 | 231 |
| 74 | 3300005353 | Ga0070669_100002325 | Ga0070669_1000023256 | 231 |
| 75 | 3300005356 | Ga0070674_100092948 | Ga0070674_1000929484 | 231 |
| 76 | 3300005364 | Ga0070673_100425959 | Ga0070673_1004259592 | 231 |
| 77 | 3300005438 | Ga0070701_10006223 | Ga0070701_100062235 | 231 |
| 78 | 3300005438 | Ga0070701_10304591 | Ga0070701_103045912 | 231 |
| 79 | 3300005440 | Ga0070705_100003585 | Ga0070705_1000035854 | 231 |
| 80 | 3300005441 | Ga0070700_100001354 | Ga0070700_1000013546 | 231 |
| 81 | 3300005441 | Ga0070700_100124821 | Ga0070700_1001248213 | 231 |
| 82 | 3300005444 | Ga0070694_100043330 | Ga0070694_1000433302 | 231 |
| 83 | 3300005456 | Ga0070678_100530402 | Ga0070678_1005304022 | 231 |
| 84 | 3300005457 | Ga0070662_100055306 | Ga0070662_1000553063 | 231 |
| 85 | 3300005459 | Ga0068867_100014014 | Ga0068867_1000140145 | 231 |
| 86 | 3300005536 | Ga0070697_100085923 | Ga0070697_1000859235 | 231 |
| 87 | 3300005543 | Ga0070672_100229417 | Ga0070672_1002294172 | 231 |
| 88 | 3300005544 | Ga0070686_100001752 | Ga0070686_1000017525 | 231 |
| 89 | 3300005544 | Ga0070686_100515971 | Ga0070686_1005159711 | 231 |
| 90 | 3300005545 | Ga0070695_100001186 | Ga0070695_1000011865 | 231 |
| 91 | 3300005546 | Ga0070696_100017382 | Ga0070696_1000173825 | 231 |
| 92 | 3300005546 | Ga0070696_100022282 | Ga0070696_1000222825 | 231 |
| 93 | 3300005548 | Ga0070665_100002437 | Ga0070665_1000024374 | 231 |
| 94 | 3300005549 | Ga0070704_100010428 | Ga0070704_1000104285 | 231 |
| 95 | 3300005578 | Ga0068854_100002435 | Ga0068854_10000243512 | 231 |
| 96 | 3300005578 | Ga0068854_100025719 | Ga0068854_1000257193 | 231 |
| 97 | 3300005615 | Ga0070702_100049106 | Ga0070702_1000491065 | 231 |
| 98 | 3300005617 | Ga0068859_100549292 | Ga0068859_1005492922 | 231 |
| 99 | 3300005718 | Ga0068866_10029079 | Ga0068866_100290793 | 231 |
| 100 | 3300005719 | Ga0068861_100018565 | Ga0068861_1000185655 | 231 |
| 101 | 3300005719 | Ga0068861_100032421 | Ga0068861_1000324215 | 231 |
| 102 | 3300005842 | Ga0068858_100692029 | Ga0068858_1006920292 | 231 |
| 103 | 3300005843 | Ga0068860_100201285 | Ga0068860_1002012852 | 231 |
| 104 | 3300006852 | Ga0075433_10164802 | Ga0075433_101648023 | 231 |
| 105 | 3300006871 | Ga0075434_100220650 | Ga0075434_1002206503 | 231 |
| 106 | 3300006880 | Ga0075429_100091910 | Ga0075429_1000919102 | 231 |
| 107 | 3300006881 | Ga0068865_100057769 | Ga0068865_1000577694 | 231 |
| 108 | 3300006881 | Ga0068865_100191852 | Ga0068865_1001918522 | 231 |
| 109 | 3300006881 | Ga0068865_100216570 | Ga0068865_1002165702 | 231 |
| 110 | 3300006914 | Ga0075436_100225021 | Ga0075436_1002250212 | 231 |
| 111 | 3300006931 | Ga0097620_100549326 | Ga0097620_1005493262 | 231 |
| 112 | 3300007076 | Ga0075435_100003662 | Ga0075435_10000366214 | 231 |
| 113 | 3300009094 | Ga0111539_10001538 | Ga0111539_1000153818 | 231 |
| 114 | 3300009098 | Ga0105245_10488636 | Ga0105245_104886361 | 231 |
| 115 | 3300009148 | Ga0105243_10015866 | Ga0105243_100158665 | 231 |
| 116 | 3300009148 | Ga0105243_10032809 | Ga0105243_100328094 | 231 |
| 117 | 3300009174 | Ga0105241_10151718 | Ga0105241_101517183 | 231 |
| 118 | 3300009176 | Ga0105242_10012837 | Ga0105242_100128373 | 231 |
| 119 | 3300009176 | Ga0105242_10048267 | Ga0105242_100482674 | 231 |
| 120 | 3300009553 | Ga0105249_10088310 | Ga0105249_100883101 | 231 |
| 121 | 3300009553 | Ga0105249_10605909 | Ga0105249_106059092 | 231 |
| 122 | 3300013296 | Ga0157374_10042978 | Ga0157374_100429784 | 231 |
| 123 | 3300014326 | Ga0157380_10085625 | Ga0157380_100856254 | 231 |
| 124 | 3300025899 | Ga0207642_10030863 | Ga0207642_100308632 | 231 |
| 125 | 3300025903 | Ga0207680_10009647 | Ga0207680_100096475 | 231 |
| 126 | 3300025907 | Ga0207645_10011140 | Ga0207645_100111402 | 231 |
| 127 | 3300025911 | Ga0207654_10206780 | Ga0207654_102067802 | 231 |
| 128 | 3300025918 | Ga0207662_10048356 | Ga0207662_100483565 | 231 |
| 129 | 3300025923 | Ga0207681_10066277 | Ga0207681_100662774 | 231 |
| 130 | 3300025933 | Ga0207706_10077455 | Ga0207706_100774553 | 231 |
| 131 | 3300025934 | Ga0207686_10090878 | Ga0207686_100908783 | 231 |
| 132 | 3300025934 | Ga0207686_10137805 | Ga0207686_101378052 | 231 |
| 133 | 3300025935 | Ga0207709_10037621 | Ga0207709_100376215 | 231 |
| 134 | 3300025937 | Ga0207669_10043854 | Ga0207669_100438543 | 231 |
| 135 | 3300025938 | Ga0207704_10058853 | Ga0207704_100588533 | 231 |
| 136 | 3300025938 | Ga0207704_10304996 | Ga0207704_103049962 | 231 |
| 137 | 3300025938 | Ga0207704_10369400 | Ga0207704_103694002 | 231 |
| 138 | 3300025940 | Ga0207691_10507751 | Ga0207691_105077512 | 231 |
| 139 | 3300025941 | Ga0207711_10205021 | Ga0207711_102050213 | 231 |
| 140 | 3300025960 | Ga0207651_10147778 | Ga0207651_101477784 | 231 |
| 141 | 3300025981 | Ga0207640_10011712 | Ga0207640_100117125 | 231 |
| 142 | 3300025981 | Ga0207640_10106607 | Ga0207640_101066073 | 231 |
| 143 | 3300026023 | Ga0207677_10071625 | Ga0207677_100716252 | 231 |
| 144 | 3300026075 | Ga0207708_10014545 | Ga0207708_100145455 | 231 |
| 145 | 3300026075 | Ga0207708_10020634 | Ga0207708_100206344 | 231 |
| 146 | 3300026075 | Ga0207708_10137195 | Ga0207708_101371951 | 231 |
| 147 | 3300026088 | Ga0207641_10156984 | Ga0207641_101569842 | 231 |
| 148 | 3300026089 | Ga0207648_10022105 | Ga0207648_100221055 | 231 |
| 149 | 3300026118 | Ga0207675_100001792 | Ga0207675_1000017925 | 231 |
| 150 | 3300026118 | Ga0207675_100010296 | Ga0207675_1000102969 | 231 |
| 151 | 3300027907 | Ga0207428_10005045 | Ga0207428_1000504515 | 231 |
| 152 | 3300028381 | Ga0268264_10168028 | Ga0268264_101680282 | 231 |
| 153 | 3300034817 | Ga0373948_0001826 | Ga0373948_0001826_1302_2045 | 231 |
| 154 | 3300034818 | Ga0373950_0043047 | Ga0373950_0043047_80_823 | 231 |
| 155 | 3300034819 | Ga0373958_0001072 | Ga0373958_0001072_347_1090 | 231 |
| 156 | 3300034820 | Ga0373959_0001715 | Ga0373959_0001715_332_1075 | 231 |
| 157 | 3300035085 | Ga0373929_0002316 | Ga0373929_0002316_2522_3265 | 231 |
| 158 | 3300035088 | Ga0373940_0000157 | Ga0373940_0000157_6940_7683 | 231 |
| 159 | 3300035090 | Ga0373949_0001672 | Ga0373949_0001672_4429_5172 | 231 |
| 160 | 3300035091 | Ga0373951_0035479 | Ga0373951_0035479_80_823 | 231 |
| 161 | 3300035092 | Ga0373952_0045418 | Ga0373952_0045418_80_823 | 231 |
| 162 | 3300035112 | Ga0373932_0000337 | Ga0373932_0000337_11041_11784 | 231 |
| 163 | 3300035115 | Ga0373941_0069667 | Ga0373941_0069667_342_1085 | 231 |
| 164 | 3300035207 | Ga0373942_0007670 | Ga0373942_0007670_80_823 | 231 |
| 165 | 3300035241 | Ga0373961_0003080 | Ga0373961_0003080_494_1237 | 231 |
| 166 | 3300035242 | Ga0373962_0007033 | Ga0373962_0007033_191_934 | 231 |
| 167 | 3300035691 | Ga0373931_0004668 | Ga0373931_0004668_4692_5435 | 231 |
| 168 | 3300044694 | Ga0466963_0268461 | Ga0466963_0268461_65_826 | 231 |
| 169 | 3300045051 | Ga0451576_0031558 | Ga0451576_0031558_73_816 | 231 |
| 170 | 3300046615 | Ga0495656_0100926 | Ga0495656_0100926_404_1204 | 231 |
| 171 | 3300048905 | Ga0496102_0117685 | Ga0496102_0117685_1199_1942 | 231 |
| 172 | 3300048909 | Ga0496106_0145065 | Ga0496106_0145065_598_1341 | 231 |
| 173 | 3300049591 | Ga0501075_0063616 | Ga0501075_0063616_871_1623 | 231 |
| 174 | 3300049743 | Ga0501081_0085912 | Ga0501081_0085912_906_1649 | 231 |
| 175 | 3300050507 | nmdc:mga05p37_1166939_c1 | nmdc:mga05p37_1166939_c1_21_764 | 231 |
| 176 | 3300050507 | nmdc:mga05p37_399357_c1 | nmdc:mga05p37_399357_c1_474_1238 | 231 |
| 177 | 3300050511 | nmdc:mga08y16_146291_c1 | nmdc:mga08y16_146291_c1_484_1248 | 231 |
| 178 | 3300050511 | nmdc:mga08y16_2829_c1 | nmdc:mga08y16_2829_c1_11016_11759 | 231 |
| 179 | 3300050512 | nmdc:mga0n895_155144_c1 | nmdc:mga0n895_155144_c1_323_1066 | 231 |
| 180 | 3300050512 | nmdc:mga0n895_354768_c1 | nmdc:mga0n895_354768_c1_211_954 | 231 |
| 181 | 3300050513 | nmdc:mga0rr50_24519_c1 | nmdc:mga0rr50_24519_c1_47_790 | 231 |
| 182 | 3300050513 | nmdc:mga0rr50_647_c1 | nmdc:mga0rr50_647_c1_9479_10222 | 231 |
| 183 | 3300050514 | nmdc:mga08x19_264651_c1 | nmdc:mga08x19_264651_c1_65_808 | 231 |
| 184 | 3300005330 | Ga0070690_100145033 | Ga0070690_1001450331 | 232 |
| 185 | 3300005339 | Ga0070660_100010154 | Ga0070660_1000101548 | 232 |
| 186 | 3300005353 | Ga0070669_100030879 | Ga0070669_1000308794 | 232 |
| 187 | 3300005365 | Ga0070688_100145833 | Ga0070688_1001458332 | 232 |
| 188 | 3300005366 | Ga0070659_100087730 | Ga0070659_1000877304 | 232 |
| 189 | 3300005367 | Ga0070667_100006918 | Ga0070667_1000069188 | 232 |
| 190 | 3300005518 | Ga0070699_100472289 | Ga0070699_1004722891 | 232 |
| 191 | 3300005530 | Ga0070679_100031825 | Ga0070679_1000318255 | 232 |
| 192 | 3300005536 | Ga0070697_100364874 | Ga0070697_1003648742 | 232 |
| 193 | 3300005563 | Ga0068855_100006981 | Ga0068855_1000069814 | 232 |
| 194 | 3300005719 | Ga0068861_100118308 | Ga0068861_1001183082 | 232 |
| 195 | 3300005841 | Ga0068863_100011770 | Ga0068863_1000117707 | 232 |
| 196 | 3300005844 | Ga0068862_100013444 | Ga0068862_1000134449 | 232 |
| 197 | 3300005844 | Ga0068862_100628512 | Ga0068862_1006285122 | 232 |
| 198 | 3300005937 | Ga0081455_10014844 | Ga0081455_100148445 | 232 |
| 199 | 3300006844 | Ga0075428_100071590 | Ga0075428_1000715906 | 232 |
| 200 | 3300006871 | Ga0075434_100005397 | Ga0075434_1000053973 | 232 |
| 201 | 3300006871 | Ga0075434_100036729 | Ga0075434_1000367295 | 232 |
| 202 | 3300006871 | Ga0075434_100143244 | Ga0075434_1001432442 | 232 |
| 203 | 3300006914 | Ga0075436_100045487 | Ga0075436_1000454875 | 232 |
| 204 | 3300006914 | Ga0075436_100084673 | Ga0075436_1000846732 | 232 |
| 205 | 3300007076 | Ga0075435_100000498 | Ga0075435_1000004984 | 232 |
| 206 | 3300007076 | Ga0075435_100243635 | Ga0075435_1002436352 | 232 |
| 207 | 3300009094 | Ga0111539_10097733 | Ga0111539_100977334 | 232 |
| 208 | 3300009147 | Ga0114129_10112038 | Ga0114129_101120382 | 232 |
| 209 | 3300009177 | Ga0105248_10013113 | Ga0105248_100131137 | 232 |
| 210 | 3300010375 | Ga0105239_10812195 | Ga0105239_108121952 | 232 |
| 211 | 3300013306 | Ga0163162_10094080 | Ga0163162_100940802 | 232 |
| 212 | 3300013308 | Ga0157375_10059354 | Ga0157375_100593544 | 232 |
| 213 | 3300014968 | Ga0157379_10008180 | Ga0157379_100081807 | 232 |
| 214 | 3300025918 | Ga0207662_10242314 | Ga0207662_102423142 | 232 |
| 215 | 3300025919 | Ga0207657_10009283 | Ga0207657_100092839 | 232 |
| 216 | 3300025921 | Ga0207652_10796978 | Ga0207652_107969781 | 232 |
| 217 | 3300025923 | Ga0207681_10046826 | Ga0207681_100468264 | 232 |
| 218 | 3300025924 | Ga0207694_10400687 | Ga0207694_104006872 | 232 |
| 219 | 3300025926 | Ga0207659_10701249 | Ga0207659_107012491 | 232 |
| 220 | 3300025931 | Ga0207644_10058497 | Ga0207644_100584975 | 232 |
| 221 | 3300025932 | Ga0207690_10030660 | Ga0207690_100306604 | 232 |
| 222 | 3300025937 | Ga0207669_10164162 | Ga0207669_101641621 | 232 |
| 223 | 3300025940 | Ga0207691_10062879 | Ga0207691_100628795 | 232 |
| 224 | 3300025941 | Ga0207711_10011317 | Ga0207711_100113175 | 232 |
| 225 | 3300025949 | Ga0207667_10068503 | Ga0207667_100685034 | 232 |
| 226 | 3300025986 | Ga0207658_10017805 | Ga0207658_100178055 | 232 |
| 227 | 3300026088 | Ga0207641_10003071 | Ga0207641_100030714 | 232 |
| 228 | 3300026089 | Ga0207648_10312380 | Ga0207648_103123801 | 232 |
| 229 | 3300026118 | Ga0207675_100052937 | Ga0207675_1000529374 | 232 |
| 230 | 3300027907 | Ga0207428_10015551 | Ga0207428_100155513 | 232 |
| 231 | 3300028380 | Ga0268265_10003170 | Ga0268265_100031707 | 232 |
| 232 | 3300028381 | Ga0268264_10079941 | Ga0268264_100799411 | 232 |
| 233 | 3300034819 | Ga0373958_0004779 | Ga0373958_0004779_126_863 | 232 |
| 234 | 3300035085 | Ga0373929_0020329 | Ga0373929_0020329_504_1241 | 232 |
| 235 | 3300035242 | Ga0373962_0027860 | Ga0373962_0027860_693_1430 | 232 |
| 236 | 3300046684 | Ga0495669_0035552 | Ga0495669_0035552_75_812 | 232 |
| 237 | 3300046691 | Ga0495670_0045527 | Ga0495670_0045527_762_1499 | 232 |
| 238 | 3300048905 | Ga0496102_0066968 | Ga0496102_0066968_2220_3038 | 232 |
| 239 | 3300048909 | Ga0496106_0213600 | Ga0496106_0213600_503_1315 | 232 |
| 240 | 3300048909 | Ga0496106_0553483 | Ga0496106_0553483_39_794 | 232 |
| 241 | 3300048915 | Ga0496112_0088263 | Ga0496112_0088263_969_1781 | 232 |
| 242 | 3300048915 | Ga0496112_0540123 | Ga0496112_0540123_159_893 | 232 |
| 243 | 3300048915 | Ga0496112_0559768 | Ga0496112_0559768_171_926 | 232 |
| 244 | 3300050507 | nmdc:mga05p37_65866_c1 | nmdc:mga05p37_65866_c1_1203_1940 | 232 |
| 245 | 3300050511 | nmdc:mga08y16_8364_c1 | nmdc:mga08y16_8364_c1_3895_4632 | 232 |
| 246 | 3300050512 | nmdc:mga0n895_57_c1 | nmdc:mga0n895_57_c1_54163_54921 | 232 |
| 247 | 3300050512 | nmdc:mga0n895_6739_c1 | nmdc:mga0n895_6739_c1_3545_4306 | 232 |
| 248 | 3300050513 | nmdc:mga0rr50_468150_c1 | nmdc:mga0rr50_468150_c1_219_980 | 232 |
| 249 | 3300050513 | nmdc:mga0rr50_5_c1 | nmdc:mga0rr50_5_c1_269185_269943 | 232 |
| 250 | 3300050514 | nmdc:mga08x19_1472_c1 | nmdc:mga08x19_1472_c1_6822_7580 | 232 |
| 251 | 3300050514 | nmdc:mga08x19_25509_c1 | nmdc:mga08x19_25509_c1_2768_3562 | 232 |
| 252 | 3300050515 | nmdc:mga0a205_13205_c1 | nmdc:mga0a205_13205_c1_338_1075 | 232 |
| 253 | 3300005331 | Ga0070670_100440621 | Ga0070670_1004406212 | 233 |
| 254 | 3300005333 | Ga0070677_10212121 | Ga0070677_102121212 | 233 |
| 255 | 3300005334 | Ga0068869_100093811 | Ga0068869_1000938113 | 233 |
| 256 | 3300005335 | Ga0070666_10224331 | Ga0070666_102243312 | 233 |
| 257 | 3300005340 | Ga0070689_100046446 | Ga0070689_1000464462 | 233 |
| 258 | 3300005344 | Ga0070661_100463643 | Ga0070661_1004636431 | 233 |
| 259 | 3300005354 | Ga0070675_100000496 | Ga0070675_10000049613 | 233 |
| 260 | 3300005354 | Ga0070675_100281787 | Ga0070675_1002817872 | 233 |
| 261 | 3300005356 | Ga0070674_100002893 | Ga0070674_10000289311 | 233 |
| 262 | 3300005364 | Ga0070673_100082067 | Ga0070673_1000820675 | 233 |
| 263 | 3300005365 | Ga0070688_100043097 | Ga0070688_1000430975 | 233 |
| 264 | 3300005366 | Ga0070659_100375385 | Ga0070659_1003753852 | 233 |
| 265 | 3300005436 | Ga0070713_100027954 | Ga0070713_1000279542 | 233 |
| 266 | 3300005456 | Ga0070678_100094599 | Ga0070678_1000945994 | 233 |
| 267 | 3300005466 | Ga0070685_10072672 | Ga0070685_100726722 | 233 |
| 268 | 3300005468 | Ga0070707_100214643 | Ga0070707_1002146434 | 233 |
| 269 | 3300005468 | Ga0070707_100630115 | Ga0070707_1006301151 | 233 |
| 270 | 3300005530 | Ga0070679_100108212 | Ga0070679_1001082125 | 233 |
| 271 | 3300005578 | Ga0068854_100077016 | Ga0068854_1000770164 | 233 |
| 272 | 3300005617 | Ga0068859_100072571 | Ga0068859_1000725714 | 233 |
| 273 | 3300005618 | Ga0068864_100477131 | Ga0068864_1004771311 | 233 |
| 274 | 3300005842 | Ga0068858_100104840 | Ga0068858_1001048402 | 233 |
| 275 | 3300005842 | Ga0068858_100142718 | Ga0068858_1001427185 | 233 |
| 276 | 3300005844 | Ga0068862_100126118 | Ga0068862_1001261183 | 233 |
| 277 | 3300005844 | Ga0068862_100731488 | Ga0068862_1007314882 | 233 |
| 278 | 3300006852 | Ga0075433_10269146 | Ga0075433_102691462 | 233 |
| 279 | 3300006914 | Ga0075436_100029225 | Ga0075436_1000292252 | 233 |
| 280 | 3300006931 | Ga0097620_100072571 | Ga0097620_1000725714 | 233 |
| 281 | 3300009101 | Ga0105247_10002063 | Ga0105247_1000206312 | 233 |
| 282 | 3300009147 | Ga0114129_10076271 | Ga0114129_100762715 | 233 |
| 283 | 3300009147 | Ga0114129_10438593 | Ga0114129_104385931 | 233 |
| 284 | 3300009177 | Ga0105248_10003193 | Ga0105248_100031935 | 233 |
| 285 | 3300013308 | Ga0157375_10634209 | Ga0157375_106342092 | 233 |
| 286 | 3300014325 | Ga0163163_10021899 | Ga0163163_100218995 | 233 |
| 287 | 3300014325 | Ga0163163_10159243 | Ga0163163_101592434 | 233 |
| 288 | 3300014325 | Ga0163163_10316507 | Ga0163163_103165072 | 233 |
| 289 | 3300014745 | Ga0157377_10021813 | Ga0157377_100218133 | 233 |
| 290 | 3300014745 | Ga0157377_10062943 | Ga0157377_100629433 | 233 |
| 291 | 3300014968 | Ga0157379_10058612 | Ga0157379_100586124 | 233 |
| 292 | 3300025893 | Ga0207682_10072839 | Ga0207682_100728393 | 233 |
| 293 | 3300025903 | Ga0207680_10208141 | Ga0207680_102081412 | 233 |
| 294 | 3300025906 | Ga0207699_10013130 | Ga0207699_100131305 | 233 |
| 295 | 3300025921 | Ga0207652_10109816 | Ga0207652_101098162 | 233 |
| 296 | 3300025922 | Ga0207646_10358137 | Ga0207646_103581372 | 233 |
| 297 | 3300025926 | Ga0207659_10000167 | Ga0207659_1000016714 | 233 |
| 298 | 3300025937 | Ga0207669_10058031 | Ga0207669_100580312 | 233 |
| 299 | 3300025941 | Ga0207711_10352630 | Ga0207711_103526303 | 233 |
| 300 | 3300025942 | Ga0207689_10048606 | Ga0207689_100486065 | 233 |
| 301 | 3300025945 | Ga0207679_10790683 | Ga0207679_107906832 | 233 |
| 302 | 3300026035 | Ga0207703_10014271 | Ga0207703_100142715 | 233 |
| 303 | 3300026035 | Ga0207703_10059864 | Ga0207703_100598642 | 233 |
| 304 | 3300026089 | Ga0207648_10347880 | Ga0207648_103478802 | 233 |
| 305 | 3300026095 | Ga0207676_10539426 | Ga0207676_105394262 | 233 |
| 306 | 3300026121 | Ga0207683_10207596 | Ga0207683_102075962 | 233 |
| 307 | 3300028379 | Ga0268266_10552784 | Ga0268266_105527842 | 233 |
| 308 | 3300028380 | Ga0268265_10125945 | Ga0268265_101259454 | 233 |
| 309 | 3300028380 | Ga0268265_10701192 | Ga0268265_107011921 | 233 |
| 310 | 3300028381 | Ga0268264_10452178 | Ga0268264_104521781 | 233 |
| 311 | 3300034817 | Ga0373948_0034077 | Ga0373948_0034077_212_991 | 233 |
| 312 | 3300035086 | Ga0373934_0085794 | Ga0373934_0085794_356_1126 | 233 |
| 313 | 3300035115 | Ga0373941_0002940 | Ga0373941_0002940_2869_3645 | 233 |
| 314 | 3300035116 | Ga0373945_0089583 | Ga0373945_0089583_143_913 | 233 |
| 315 | 3300035119 | Ga0373956_0155292 | Ga0373956_0155292_13_750 | 233 |
| 316 | 3300035170 | Ga0373943_0353290 | Ga0373943_0353290_15_764 | 233 |
| 317 | 3300035172 | Ga0373955_0093635 | Ga0373955_0093635_425_1195 | 233 |
| 318 | 3300035172 | Ga0373955_0196277 | Ga0373955_0196277_45_815 | 233 |
| 319 | 3300035410 | Ga0373924_0035778 | Ga0373924_0035778_398_1168 | 233 |
| 320 | 3300035692 | Ga0373935_0143987 | Ga0373935_0143987_417_1187 | 233 |
| 321 | 3300035725 | Ga0373947_0055734 | Ga0373947_0055734_647_1417 | 233 |
| 322 | 3300036401 | Ga0373937_0192069 | Ga0373937_0192069_291_1061 | 233 |
| 323 | 3300036401 | Ga0373937_0494702 | Ga0373937_0494702_241_1023 | 233 |
| 324 | 3300037068 | Ga0373925_0052575 | Ga0373925_0052575_1080_1850 | 233 |
| 325 | 3300046459 | Ga0495629_0208820 | Ga0495629_0208820_442_1212 | 233 |
| 326 | 3300046537 | Ga0495598_0037112 | Ga0495598_0037112_93_860 | 233 |
| 327 | 3300046543 | Ga0495645_0001331 | Ga0495645_0001331_1066_1836 | 233 |
| 328 | 3300046663 | Ga0495635_0094852 | Ga0495635_0094852_528_1298 | 233 |
| 329 | 3300046664 | Ga0495659_0083674 | Ga0495659_0083674_391_1164 | 233 |
| 330 | 3300046681 | Ga0495647_0019900 | Ga0495647_0019900_642_1412 | 233 |
| 331 | 3300046683 | Ga0495658_0095095 | Ga0495658_0095095_643_1413 | 233 |
| 332 | 3300046683 | Ga0495658_0154314 | Ga0495658_0154314_30_782 | 233 |
| 333 | 3300046683 | Ga0495658_0282637 | Ga0495658_0282637_55_825 | 233 |
| 334 | 3300047319 | Ga0495674_0164508 | Ga0495674_0164508_982_1752 | 233 |
| 335 | 3300047471 | Ga0495684_0100121 | Ga0495684_0100121_1095_1865 | 233 |
| 336 | 3300048907 | Ga0496104_0036425 | Ga0496104_0036425_1386_2159 | 233 |
| 337 | 3300048911 | Ga0496108_0062508 | Ga0496108_0062508_299_1072 | 233 |
| 338 | 3300048912 | Ga0496109_0133253 | Ga0496109_0133253_44_817 | 233 |
| 339 | 3300048914 | Ga0496111_0212686 | Ga0496111_0212686_379_1152 | 233 |
| 340 | 3300048915 | Ga0496112_0527107 | Ga0496112_0527107_221_988 | 233 |
| 341 | 3300048916 | Ga0496113_0165548 | Ga0496113_0165548_674_1447 | 233 |
| 342 | 3300048917 | Ga0496114_0131212 | Ga0496114_0131212_647_1417 | 233 |
| 343 | 3300049592 | Ga0501076_0402542 | Ga0501076_0402542_100_846 | 233 |
| 344 | 3300050507 | nmdc:mga05p37_12625_c1 | nmdc:mga05p37_12625_c1_8847_9623 | 233 |
| 345 | 3300050507 | nmdc:mga05p37_13609_c1 | nmdc:mga05p37_13609_c1_7073_7873 | 233 |
| 346 | 3300050512 | nmdc:mga0n895_743953_c1 | nmdc:mga0n895_743953_c1_130_930 | 233 |
| 347 | 3300050513 | nmdc:mga0rr50_141599_c1 | nmdc:mga0rr50_141599_c1_883_1638 | 233 |
| 348 | 3300050514 | nmdc:mga08x19_117833_c1 | nmdc:mga08x19_117833_c1_185_919 | 233 |
| 349 | 3300050515 | nmdc:mga0a205_17039_c1 | nmdc:mga0a205_17039_c1_5579_6379 | 233 |
| 350 | 3300050515 | nmdc:mga0a205_459765_c1 | nmdc:mga0a205_459765_c1_271_1083 | 233 |
| 351 | 3300053084 | Ga0495595_0073009 | Ga0495595_0073009_454_1224 | 233 |
| 352 | 3300053085 | Ga0495619_0296339 | Ga0495619_0296339_287_1057 | 233 |
| 353 | 3300005334 | Ga0068869_100040162 | Ga0068869_1000401624 | 234 |
| 354 | 3300005338 | Ga0068868_100239854 | Ga0068868_1002398542 | 234 |
| 355 | 3300005354 | Ga0070675_100468256 | Ga0070675_1004682562 | 234 |
| 356 | 3300005458 | Ga0070681_10392850 | Ga0070681_103928502 | 234 |
| 357 | 3300005471 | Ga0070698_100045279 | Ga0070698_1000452792 | 234 |
| 358 | 3300005544 | Ga0070686_100147392 | Ga0070686_1001473921 | 234 |
| 359 | 3300005548 | Ga0070665_100018385 | Ga0070665_1000183859 | 234 |
| 360 | 3300005842 | Ga0068858_100063491 | Ga0068858_1000634912 | 234 |
| 361 | 3300005843 | Ga0068860_100283819 | Ga0068860_1002838192 | 234 |
| 362 | 3300005843 | Ga0068860_100338616 | Ga0068860_1003386162 | 234 |
| 363 | 3300006237 | Ga0097621_100005574 | Ga0097621_10000557411 | 234 |
| 364 | 3300006852 | Ga0075433_10219077 | Ga0075433_102190772 | 234 |
| 365 | 3300006881 | Ga0068865_100123456 | Ga0068865_1001234563 | 234 |
| 366 | 3300007076 | Ga0075435_100372125 | Ga0075435_1003721252 | 234 |
| 367 | 3300009094 | Ga0111539_10338843 | Ga0111539_103388432 | 234 |
| 368 | 3300009098 | Ga0105245_10007966 | Ga0105245_1000796610 | 234 |
| 369 | 3300009147 | Ga0114129_10001609 | Ga0114129_100016098 | 234 |
| 370 | 3300009176 | Ga0105242_10191974 | Ga0105242_101919743 | 234 |
| 371 | 3300009551 | Ga0105238_10105959 | Ga0105238_101059592 | 234 |
| 372 | 3300009551 | Ga0105238_10431292 | Ga0105238_104312922 | 234 |
| 373 | 3300013297 | Ga0157378_10387503 | Ga0157378_103875032 | 234 |
| 374 | 3300014326 | Ga0157380_10338320 | Ga0157380_103383202 | 234 |
| 375 | 3300017792 | Ga0163161_10185710 | Ga0163161_101857102 | 234 |
| 376 | 3300025903 | Ga0207680_10158790 | Ga0207680_101587902 | 234 |
| 377 | 3300025927 | Ga0207687_10221888 | Ga0207687_102218882 | 234 |
| 378 | 3300025934 | Ga0207686_10391463 | Ga0207686_103914631 | 234 |
| 379 | 3300025938 | Ga0207704_10265186 | Ga0207704_102651862 | 234 |
| 380 | 3300025942 | Ga0207689_10199805 | Ga0207689_101998053 | 234 |
| 381 | 3300026023 | Ga0207677_10111746 | Ga0207677_101117463 | 234 |
| 382 | 3300026041 | Ga0207639_10349589 | Ga0207639_103495892 | 234 |
| 383 | 3300028381 | Ga0268264_10269533 | Ga0268264_102695332 | 234 |
| 384 | 3300028381 | Ga0268264_10444157 | Ga0268264_104441572 | 234 |
| 385 | 3300035170 | Ga0373943_0003762 | Ga0373943_0003762_3981_4742 | 234 |
| 386 | 3300035171 | Ga0373946_0005443 | Ga0373946_0005443_3413_4174 | 234 |
| 387 | 3300035172 | Ga0373955_0047283 | Ga0373955_0047283_1101_1862 | 234 |
| 388 | 3300035410 | Ga0373924_0007005 | Ga0373924_0007005_2312_3073 | 234 |
| 389 | 3300037068 | Ga0373925_0016292 | Ga0373925_0016292_413_1174 | 234 |
| 390 | 3300045051 | Ga0451576_0214922 | Ga0451576_0214922_748_1557 | 234 |
| 391 | 3300045836 | Ga0466958_0323756 | Ga0466958_0323756_69_836 | 234 |
| 392 | 3300046459 | Ga0495629_0108705 | Ga0495629_0108705_107_868 | 234 |
| 393 | 3300046511 | Ga0495608_0002623 | Ga0495608_0002623_3400_4164 | 234 |
| 394 | 3300046516 | Ga0495628_0042796 | Ga0495628_0042796_2336_3100 | 234 |
| 395 | 3300046517 | Ga0495630_0021329 | Ga0495630_0021329_3571_4335 | 234 |
| 396 | 3300046529 | Ga0495652_0168854 | Ga0495652_0168854_638_1402 | 234 |
| 397 | 3300046533 | Ga0495640_0115004 | Ga0495640_0115004_904_1668 | 234 |
| 398 | 3300046559 | Ga0495667_0008533 | Ga0495667_0008533_2252_3016 | 234 |
| 399 | 3300046663 | Ga0495635_0337771 | Ga0495635_0337771_85_849 | 234 |
| 400 | 3300046675 | Ga0495657_0047815 | Ga0495657_0047815_737_1501 | 234 |
| 401 | 3300046683 | Ga0495658_0045161 | Ga0495658_0045161_1395_2141 | 234 |
| 402 | 3300046689 | Ga0495613_0006012 | Ga0495613_0006012_5709_6473 | 234 |
| 403 | 3300047471 | Ga0495684_0000430 | Ga0495684_0000430_17463_18227 | 234 |
| 404 | 3300048912 | Ga0496109_0177322 | Ga0496109_0177322_229_975 | 234 |
| 405 | 3300050507 | nmdc:mga05p37_13779_c2 | nmdc:mga05p37_13779_c2_68_925 | 234 |
| 406 | 3300050511 | nmdc:mga08y16_401189_c1 | nmdc:mga08y16_401189_c1_343_1116 | 234 |
| 407 | 3300050513 | nmdc:mga0rr50_46727_c1 | nmdc:mga0rr50_46727_c1_315_1124 | 234 |
| 408 | 3300053077 | Ga0495601_0112942 | Ga0495601_0112942_867_1631 | 234 |
| 409 | 3300053078 | Ga0495612_0044640 | Ga0495612_0044640_481_1239 | 234 |
| 410 | 3300053085 | Ga0495619_0033397 | Ga0495619_0033397_753_1517 | 234 |
| 411 | 3300005290 | Ga0065712_10001548 | Ga0065712_100015486 | 235 |
| 412 | 3300005330 | Ga0070690_100356119 | Ga0070690_1003561191 | 235 |
| 413 | 3300005336 | Ga0070680_100533887 | Ga0070680_1005338872 | 235 |
| 414 | 3300005338 | Ga0068868_100600362 | Ga0068868_1006003621 | 235 |
| 415 | 3300005340 | Ga0070689_100362214 | Ga0070689_1003622141 | 235 |
| 416 | 3300005344 | Ga0070661_100018622 | Ga0070661_1000186222 | 235 |
| 417 | 3300005364 | Ga0070673_100080474 | Ga0070673_1000804742 | 235 |
| 418 | 3300005364 | Ga0070673_100238566 | Ga0070673_1002385662 | 235 |
| 419 | 3300005365 | Ga0070688_100051154 | Ga0070688_1000511543 | 235 |
| 420 | 3300005365 | Ga0070688_100152938 | Ga0070688_1001529381 | 235 |
| 421 | 3300005365 | Ga0070688_100195876 | Ga0070688_1001958762 | 235 |
| 422 | 3300005436 | Ga0070713_100243582 | Ga0070713_1002435823 | 235 |
| 423 | 3300005457 | Ga0070662_100309853 | Ga0070662_1003098532 | 235 |
| 424 | 3300005471 | Ga0070698_100002146 | Ga0070698_1000021469 | 235 |
| 425 | 3300005535 | Ga0070684_100049945 | Ga0070684_1000499452 | 235 |
| 426 | 3300005549 | Ga0070704_100005881 | Ga0070704_1000058819 | 235 |
| 427 | 3300005549 | Ga0070704_100167114 | Ga0070704_1001671142 | 235 |
| 428 | 3300005564 | Ga0070664_100040871 | Ga0070664_1000408714 | 235 |
| 429 | 3300006058 | Ga0075432_10050030 | Ga0075432_100500302 | 235 |
| 430 | 3300006844 | Ga0075428_100036786 | Ga0075428_1000367865 | 235 |
| 431 | 3300006846 | Ga0075430_100002396 | Ga0075430_1000023963 | 235 |
| 432 | 3300006846 | Ga0075430_100085236 | Ga0075430_1000852362 | 235 |
| 433 | 3300006846 | Ga0075430_100703775 | Ga0075430_1007037751 | 235 |
| 434 | 3300006847 | Ga0075431_100014651 | Ga0075431_1000146517 | 235 |
| 435 | 3300006847 | Ga0075431_100026567 | Ga0075431_1000265675 | 235 |
| 436 | 3300006852 | Ga0075433_10568814 | Ga0075433_105688142 | 235 |
| 437 | 3300006880 | Ga0075429_100102978 | Ga0075429_1001029782 | 235 |
| 438 | 3300006880 | Ga0075429_100242214 | Ga0075429_1002422142 | 235 |
| 439 | 3300006880 | Ga0075429_100417723 | Ga0075429_1004177232 | 235 |
| 440 | 3300009094 | Ga0111539_10000556 | Ga0111539_100005569 | 235 |
| 441 | 3300009094 | Ga0111539_10000850 | Ga0111539_1000085030 | 235 |
| 442 | 3300009147 | Ga0114129_10136975 | Ga0114129_101369754 | 235 |
| 443 | 3300009147 | Ga0114129_10220269 | Ga0114129_102202694 | 235 |
| 444 | 3300009147 | Ga0114129_10607010 | Ga0114129_106070102 | 235 |
| 445 | 3300011119 | Ga0105246_10343029 | Ga0105246_103430292 | 235 |
| 446 | 3300013308 | Ga0157375_10194988 | Ga0157375_101949881 | 235 |
| 447 | 3300014745 | Ga0157377_10067855 | Ga0157377_100678552 | 235 |
| 448 | 3300025908 | Ga0207643_10422824 | Ga0207643_104228241 | 235 |
| 449 | 3300025928 | Ga0207700_10105329 | Ga0207700_101053293 | 235 |
| 450 | 3300025933 | Ga0207706_10195601 | Ga0207706_101956012 | 235 |
| 451 | 3300025936 | Ga0207670_10245353 | Ga0207670_102453532 | 235 |
| 452 | 3300025942 | Ga0207689_10191727 | Ga0207689_101917272 | 235 |
| 453 | 3300025942 | Ga0207689_10323996 | Ga0207689_103239962 | 235 |
| 454 | 3300025945 | Ga0207679_10033079 | Ga0207679_100330794 | 235 |
| 455 | 3300025960 | Ga0207651_10005718 | Ga0207651_100057189 | 235 |
| 456 | 3300025960 | Ga0207651_10096873 | Ga0207651_100968733 | 235 |
| 457 | 3300026023 | Ga0207677_10123296 | Ga0207677_101232962 | 235 |
| 458 | 3300026118 | Ga0207675_100329399 | Ga0207675_1003293992 | 235 |
| 459 | 3300027907 | Ga0207428_10001495 | Ga0207428_1000149527 | 235 |
| 460 | 3300027907 | Ga0207428_10001962 | Ga0207428_1000196218 | 235 |
| 461 | 3300027907 | Ga0207428_10046665 | Ga0207428_100466653 | 235 |
| 462 | 3300035172 | Ga0373955_0280144 | Ga0373955_0280144_85_846 | 235 |
| 463 | 3300036401 | Ga0373937_0029611 | Ga0373937_0029611_2288_3049 | 235 |
| 464 | 3300045051 | Ga0451576_0132120 | Ga0451576_0132120_1082_1846 | 235 |
| 465 | 3300046459 | Ga0495629_0027594 | Ga0495629_0027594_747_1508 | 235 |
| 466 | 3300046491 | Ga0495584_0061456 | Ga0495584_0061456_829_1596 | 235 |
| 467 | 3300046522 | Ga0495643_0013257 | Ga0495643_0013257_1058_1801 | 235 |
| 468 | 3300046528 | Ga0495642_0026038 | Ga0495642_0026038_277_1044 | 235 |
| 469 | 3300046539 | Ga0495621_0012802 | Ga0495621_0012802_1721_2500 | 235 |
| 470 | 3300046543 | Ga0495645_0299830 | Ga0495645_0299830_257_1018 | 235 |
| 471 | 3300046664 | Ga0495659_0011145 | Ga0495659_0011145_499_1266 | 235 |
| 472 | 3300046664 | Ga0495659_0100815 | Ga0495659_0100815_112_852 | 235 |
| 473 | 3300046684 | Ga0495669_0099948 | Ga0495669_0099948_291_1070 | 235 |
| 474 | 3300047318 | Ga0495636_0025598 | Ga0495636_0025598_1488_2255 | 235 |
| 475 | 3300047447 | Ga0495685_062534 | Ga0495685_062534_143_910 | 235 |
| 476 | 3300048090 | Ga0495615_0029127 | Ga0495615_0029127_515_1255 | 235 |
| 477 | 3300048911 | Ga0496108_0174394 | Ga0496108_0174394_881_1621 | 235 |
| 478 | 3300048912 | Ga0496109_0254679 | Ga0496109_0254679_381_1088 | 235 |
| 479 | 3300049572 | Ga0501036_0173847 | Ga0501036_0173847_960_1700 | 235 |
| 480 | 3300049574 | Ga0501038_0202379 | Ga0501038_0202379_216_956 | 235 |
| 481 | 3300049575 | Ga0501039_0114521 | Ga0501039_0114521_1282_2022 | 235 |
| 482 | 3300049577 | Ga0501041_0007828 | Ga0501041_0007828_2559_3299 | 235 |
| 483 | 3300049580 | Ga0501046_0353574 | Ga0501046_0353574_88_828 | 235 |
| 484 | 3300049582 | Ga0501048_0079742 | Ga0501048_0079742_1103_1843 | 235 |
| 485 | 3300049587 | Ga0501071_0045591 | Ga0501071_0045591_1893_2633 | 235 |
| 486 | 3300049588 | Ga0501072_0014257 | Ga0501072_0014257_2236_2976 | 235 |
| 487 | 3300049591 | Ga0501075_0019658 | Ga0501075_0019658_2649_3389 | 235 |
| 488 | 3300049592 | Ga0501076_0092215 | Ga0501076_0092215_485_1225 | 235 |
| 489 | 3300049679 | Ga0501249_009824 | Ga0501249_009824_412_1152 | 235 |
| 490 | 3300049741 | Ga0501079_0012833 | Ga0501079_0012833_2539_3279 | 235 |
| 491 | 3300049824 | Ga0501045_0035619 | Ga0501045_0035619_1186_1926 | 235 |
| 492 | 3300050507 | nmdc:mga05p37_456720_c1 | nmdc:mga05p37_456720_c1_532_1272 | 235 |
| 493 | 3300050508 | nmdc:mga09592_162500_c1 | nmdc:mga09592_162500_c1_874_1581 | 235 |
| 494 | 3300050508 | nmdc:mga09592_201370_c1 | nmdc:mga09592_201370_c1_140_880 | 235 |
| 495 | 3300050508 | nmdc:mga09592_29060_c1 | nmdc:mga09592_29060_c1_2315_3055 | 235 |
| 496 | 3300050509 | nmdc:mga0qj67_20292_c1 | nmdc:mga0qj67_20292_c1_3429_4169 | 235 |
| 497 | 3300050509 | nmdc:mga0qj67_4090_c1 | nmdc:mga0qj67_4090_c1_4840_5580 | 235 |
| 498 | 3300050510 | nmdc:mga06r32_16884_c1 | nmdc:mga06r32_16884_c1_1032_1772 | 235 |
| 499 | 3300050510 | nmdc:mga06r32_70522_c1 | nmdc:mga06r32_70522_c1_2582_3322 | 235 |
| 500 | 3300050511 | nmdc:mga08y16_17319_c1 | nmdc:mga08y16_17319_c1_5667_6407 | 235 |
| 501 | 3300050511 | nmdc:mga08y16_3332_c1 | nmdc:mga08y16_3332_c1_9418_10158 | 235 |
| 502 | 3300050511 | nmdc:mga08y16_80322_c1 | nmdc:mga08y16_80322_c1_1403_2110 | 235 |
| 503 | 3300050515 | nmdc:mga0a205_66017_c1 | nmdc:mga0a205_66017_c1_109_816 | 235 |
| 504 | 3300054114 | Ga0501084_0347798 | Ga0501084_0347798_132_872 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rxt-assembly1.cif.gz_CO | cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state a | 0.7488 | 72 | 144 |
| 3knu-assembly1.cif.gz_B | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.7317 | 6 | 200 |
| 1vh0-assembly1.cif.gz_A | crystal structure of a hypothetical protein | 0.7313 | 72 | 144 |
| 3knu-assembly2.cif.gz_C | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.728 | 6 | 200 |
| 3knu-assembly1.cif.gz_A | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.7263 | 6 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1oy5C01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9114 | 2 | 151 | 3.40.1280.10 |
| 5wyrA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9062 | 3 | 151 | 3.40.1280.10 |
| 3iefB01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8956 | 6 | 147 | 3.40.1280.10 |
| 1uajA02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.8874 | 168 | 235 | 1.10.1270.20 |
| 4yq2A02 | Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 | 0.8838 | 168 | 232 | 1.10.1270.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383ABE9-F1-model_v4 | tRNA methyltransferase TRMD/TRM10-type domain-containing protein | 0.9321 | 1 | 130 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A7X8QN22-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) | 0.9275 | 1 | 154 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A2V6H9D2-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) | 0.922 | 2 | 147 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A351EEN1-F1-model_v4 | deleted | 0.9177 | 2 | 147 |
|
| AF-A0A0G1WK85-F1-model_v4 | tRNA (Guanine-N(1)-)-methyltransferase | 0.9132 | 2 | 150 |
GO:0002939
GO:0005829 GO:0052906 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar