F456172

General Info

Members Datasets Scaffolds Average Seq Length
504 242 504 249

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10219077|Ga0075433_102190772
Length 278
Sequence MPTFDIVTIFPAMIEQSLAAGIIGRAVASRLIDVRIRDLRDFTTDRHRVVDDVPYGGGPGMVLKPDPIFRALDAIEAERGAPLTVVLTSPQGRRFTQSEAQRLSGLDHLVLLCGRYEGFDDRVRARVTEELSIGDYVLTGGELPALVILDAVARFVPGVVGDEQSVAEDSFSRGLLDFPQFTRPAEISVRSTSGSEESSGANAKQEAGSAEAFSGRVLKVPDVLLSGNHAEIRRWRKREALSRTLDRRPDLLTGASLDEEERQILRELQDGRTAGKGS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.17
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10001548 3300005290 Bacteria 12566
2 Ga0070690_100065962 3300005330 Bacteria 2342
3 Ga0070690_100145033 3300005330 Bacteria 1614
4 Ga0070690_100356119 3300005330 Bacteria 1064
5 Ga0070690_100433701 3300005330 Bacteria 971
6 Ga0070670_100440621 3300005331 Unclassified 1153
7 Ga0070677_10212121 3300005333 Bacteria 941
8 Ga0068869_100040162 3300005334 Bacteria 3345
9 Ga0068869_100093811 3300005334 Bacteria 2262
10 Ga0070666_10004561 3300005335 Bacteria 8448
11 Ga0070666_10224331 3300005335 Bacteria 1326
12 Ga0070680_100533887 3300005336 Bacteria 1005
13 Ga0068868_100072543 3300005338 Bacteria 2747
14 Ga0068868_100239854 3300005338 Bacteria 1523
15 Ga0068868_100600362 3300005338 Bacteria 975
16 Ga0070660_100010154 3300005339 Bacteria 6644
17 Ga0070689_100046446 3300005340 Bacteria 3347
18 Ga0070689_100362214 3300005340 Bacteria 1218
19 Ga0070691_10001930 3300005341 Bacteria 9116
20 Ga0070687_100214595 3300005343 Bacteria 1175
21 Ga0070661_100018622 3300005344 Bacteria 4940
22 Ga0070661_100463643 3300005344 Bacteria 1009
23 Ga0070668_100043395 3300005347 Bacteria 3448
24 Ga0070669_100002325 3300005353 Bacteria 13747
25 Ga0070669_100030879 3300005353 Bacteria 3868
26 Ga0070675_100000496 3300005354 Bacteria 26949
27 Ga0070675_100281787 3300005354 Bacteria 1461
28 Ga0070675_100468256 3300005354 Bacteria 1132
29 Ga0070674_100002893 3300005356 Bacteria 9505
30 Ga0070674_100092948 3300005356 Bacteria 2182
31 Ga0070673_100080474 3300005364 Bacteria 2639
32 Ga0070673_100082067 3300005364 Bacteria 2616
33 Ga0070673_100238566 3300005364 Bacteria 1580
34 Ga0070673_100425959 3300005364 Bacteria 1190
35 Ga0070688_100043097 3300005365 Bacteria 2779
36 Ga0070688_100051154 3300005365 Bacteria 2577
37 Ga0070688_100145833 3300005365 Bacteria 1613
38 Ga0070688_100152938 3300005365 Bacteria 1579
39 Ga0070688_100195876 3300005365 Bacteria 1411
40 Ga0070659_100087730 3300005366 Bacteria 2491
41 Ga0070659_100375385 3300005366 Bacteria 1197
42 Ga0070667_100006918 3300005367 Bacteria 9422
43 Ga0070713_100027954 3300005436 Bacteria 4448
44 Ga0070713_100243582 3300005436 Unclassified 1638
45 Ga0070701_10006223 3300005438 Bacteria 5005
46 Ga0070701_10304591 3300005438 Bacteria 981
47 Ga0070705_100003585 3300005440 Bacteria 7603
48 Ga0070700_100001354 3300005441 Bacteria 12177
49 Ga0070700_100124821 3300005441 Bacteria 1729
50 Ga0070700_100176322 3300005441 Bacteria 1484
51 Ga0070694_100005646 3300005444 Bacteria 7583
52 Ga0070694_100043330 3300005444 Bacteria 3009
53 Ga0070663_100153003 3300005455 Bacteria 1770
54 Ga0070678_100094599 3300005456 Bacteria 2300
55 Ga0070678_100530402 3300005456 Bacteria 1043
56 Ga0070662_100055306 3300005457 Bacteria 2879
57 Ga0070662_100309853 3300005457 Bacteria 1285
58 Ga0070681_10392850 3300005458 Bacteria 1298
59 Ga0068867_100014014 3300005459 Bacteria 5678
60 Ga0070685_10072672 3300005466 Bacteria 2043
61 Ga0070706_100210660 3300005467 Bacteria 1815
62 Ga0070707_100214643 3300005468 Bacteria 1875
63 Ga0070707_100630115 3300005468 Bacteria 1035
64 Ga0070698_100002146 3300005471 Bacteria 21864
65 Ga0070698_100045279 3300005471 Bacteria 4504
66 Ga0070698_100471999 3300005471 Bacteria 1191
67 Ga0070699_100379678 3300005518 Bacteria 1276
68 Ga0070699_100472289 3300005518 Bacteria 1138
69 Ga0070679_100031825 3300005530 Bacteria 5215
70 Ga0070679_100108212 3300005530 Bacteria 2766
71 Ga0070684_100049945 3300005535 Bacteria 3632
72 Ga0070697_100085923 3300005536 Bacteria 2595
73 Ga0070697_100364874 3300005536 Bacteria 1249
74 Ga0070672_100229417 3300005543 Bacteria 1559
75 Ga0070686_100001752 3300005544 Bacteria 12145
76 Ga0070686_100147392 3300005544 Bacteria 1644
77 Ga0070686_100515971 3300005544 Bacteria 930
78 Ga0070695_100001186 3300005545 Bacteria 14336
79 Ga0070695_100004311 3300005545 Bacteria 8329
80 Ga0070696_100017382 3300005546 Bacteria 4854
81 Ga0070696_100022282 3300005546 Bacteria 4303
82 Ga0070665_100002437 3300005548 Bacteria 20499
83 Ga0070665_100018385 3300005548 Bacteria 7005
84 Ga0070704_100005881 3300005549 Bacteria 7189
85 Ga0070704_100010428 3300005549 Bacteria 5653
86 Ga0070704_100167114 3300005549 Bacteria 1745
87 Ga0068855_100006981 3300005563 Bacteria 13708
88 Ga0070664_100040871 3300005564 Bacteria 3911
89 Ga0068854_100002435 3300005578 Bacteria 11502
90 Ga0068854_100025719 3300005578 Bacteria 4039
91 Ga0068854_100077016 3300005578 Bacteria 2453
92 Ga0070702_100049106 3300005615 Bacteria 2405
93 Ga0068859_100072571 3300005617 Bacteria 3479
94 Ga0068859_100549292 3300005617 Bacteria 1250
95 Ga0068864_100477131 3300005618 Bacteria 1197
96 Ga0068866_10029079 3300005718 Bacteria 2639
97 Ga0068861_100018565 3300005719 Bacteria 4954
98 Ga0068861_100032421 3300005719 Bacteria 3845
99 Ga0068861_100118308 3300005719 Bacteria 2134
100 Ga0068863_100011770 3300005841 Bacteria 8459
101 Ga0068858_100063491 3300005842 Bacteria 3418
102 Ga0068858_100104840 3300005842 Bacteria 2638
103 Ga0068858_100142718 3300005842 Bacteria 2249
104 Ga0068858_100252384 3300005842 Bacteria 1676
105 Ga0068858_100692029 3300005842 Bacteria 992
106 Ga0068860_100201285 3300005843 Bacteria 1930
107 Ga0068860_100283819 3300005843 Bacteria 1619
108 Ga0068860_100338616 3300005843 Bacteria 1479
109 Ga0068862_100013444 3300005844 Bacteria 6775
110 Ga0068862_100126118 3300005844 Bacteria 2260
111 Ga0068862_100628512 3300005844 Bacteria 1034
112 Ga0068862_100731488 3300005844 Bacteria 961
113 Ga0081455_10014844 3300005937 Bacteria 7597
114 Ga0081539_10062389 3300005985 Bacteria 2037
115 Ga0081539_10103103 3300005985 Bacteria 1450
116 Ga0075432_10050030 3300006058 Bacteria 1473
117 Ga0097621_100005574 3300006237 Bacteria 8873
118 Ga0068871_100002524 3300006358 Bacteria 12482
119 Ga0075428_100036786 3300006844 Bacteria 5390
120 Ga0075428_100071590 3300006844 Bacteria 3789
121 Ga0075430_100002396 3300006846 Bacteria 15593
122 Ga0075430_100085236 3300006846 Bacteria 2645
123 Ga0075430_100703775 3300006846 Bacteria 833
124 Ga0075431_100014651 3300006847 Bacteria 7933
125 Ga0075431_100026567 3300006847 Bacteria 5939
126 Ga0075433_10164802 3300006852 Bacteria 1973
127 Ga0075433_10219077 3300006852 Bacteria 1691
128 Ga0075433_10269146 3300006852 Bacteria 1510
129 Ga0075433_10360308 3300006852 Bacteria 1285
130 Ga0075433_10568814 3300006852 Bacteria 996
131 Ga0075434_100005397 3300006871 Bacteria 11632
132 Ga0075434_100006471 3300006871 Bacteria 10736
133 Ga0075434_100036729 3300006871 Bacteria 4846
134 Ga0075434_100065690 3300006871 Bacteria 3613
135 Ga0075434_100143244 3300006871 Bacteria 2410
136 Ga0075434_100220650 3300006871 Bacteria 1916
137 Ga0075429_100091910 3300006880 Bacteria 2647
138 Ga0075429_100102978 3300006880 Bacteria 2493
139 Ga0075429_100242214 3300006880 Bacteria 1580
140 Ga0075429_100417723 3300006880 Bacteria 1175
141 Ga0068865_100035864 3300006881 Bacteria 3339
142 Ga0068865_100057769 3300006881 Bacteria 2708
143 Ga0068865_100123456 3300006881 Bacteria 1929
144 Ga0068865_100191852 3300006881 Bacteria 1581
145 Ga0068865_100216570 3300006881 Bacteria 1495
146 Ga0075436_100029225 3300006914 Bacteria 3790
147 Ga0075436_100045487 3300006914 Bacteria 3028
148 Ga0075436_100084673 3300006914 Bacteria 2200
149 Ga0075436_100225021 3300006914 Bacteria 1332
150 Ga0097620_100072571 3300006931 Bacteria 3479
151 Ga0097620_100549326 3300006931 Bacteria 1250
152 Ga0075435_100000498 3300007076 Bacteria 23940
153 Ga0075435_100003662 3300007076 Bacteria 10464
154 Ga0075435_100147815 3300007076 Bacteria 1974
155 Ga0075435_100243635 3300007076 Bacteria 1529
156 Ga0075435_100255739 3300007076 Bacteria 1491
157 Ga0075435_100372125 3300007076 Bacteria 1227
158 Ga0099794_10072234 3300007265 Bacteria 1691
159 Ga0111539_10000556 3300009094 Bacteria 47801
160 Ga0111539_10000850 3300009094 Bacteria 39822
161 Ga0111539_10001538 3300009094 Bacteria 30724
162 Ga0111539_10040689 3300009094 Bacteria 5593
163 Ga0111539_10097733 3300009094 Bacteria 3449
164 Ga0111539_10153002 3300009094 Bacteria 2700
165 Ga0111539_10338843 3300009094 Bacteria 1750
166 Ga0105245_10007966 3300009098 Bacteria 9264
167 Ga0105245_10324655 3300009098 Bacteria 1517
168 Ga0105245_10488636 3300009098 Bacteria 1245
169 Ga0105247_10002063 3300009101 Bacteria 13915
170 Ga0114129_10001609 3300009147 Bacteria 30680
171 Ga0114129_10008383 3300009147 Bacteria 14728
172 Ga0114129_10076271 3300009147 Bacteria 4668
173 Ga0114129_10112038 3300009147 Bacteria 3763
174 Ga0114129_10130688 3300009147 Bacteria 3449
175 Ga0114129_10136975 3300009147 Bacteria 3359
176 Ga0114129_10173964 3300009147 Bacteria 2933
177 Ga0114129_10189609 3300009147 Bacteria 2793
178 Ga0114129_10220269 3300009147 Bacteria 2560
179 Ga0114129_10272385 3300009147 Bacteria 2264
180 Ga0114129_10438593 3300009147 Bacteria 1715
181 Ga0114129_10458246 3300009147 Bacteria 1671
182 Ga0114129_10607010 3300009147 Bacteria 1417
183 Ga0114129_10760161 3300009147 Bacteria 1240
184 Ga0105243_10015866 3300009148 Bacteria 5698
185 Ga0105243_10032809 3300009148 Bacteria 4014
186 Ga0105241_10151718 3300009174 Bacteria 1896
187 Ga0105242_10012837 3300009176 Bacteria 6454
188 Ga0105242_10023293 3300009176 Bacteria 4880
189 Ga0105242_10048267 3300009176 Bacteria 3460
190 Ga0105242_10191974 3300009176 Bacteria 1809
191 Ga0105248_10003193 3300009177 Bacteria 18164
192 Ga0105248_10013113 3300009177 Bacteria 9126
193 Ga0105238_10105959 3300009551 Bacteria 2793
194 Ga0105238_10431292 3300009551 Bacteria 1314
195 Ga0105249_10088310 3300009553 Bacteria 2895
196 Ga0105249_10605909 3300009553 Bacteria 1150
197 Ga0105239_10812195 3300010375 Bacteria 1072
198 Ga0105246_10343029 3300011119 Bacteria 1221
199 Ga0157374_10042978 3300013296 Bacteria 4172
200 Ga0157378_10387503 3300013297 Bacteria 1374
201 Ga0163162_10094080 3300013306 Bacteria 3082
202 Ga0157375_10059354 3300013308 Bacteria 3790
203 Ga0157375_10194988 3300013308 Bacteria 2180
204 Ga0157375_10634209 3300013308 Bacteria 1226
205 Ga0163163_10021899 3300014325 Bacteria 6040
206 Ga0163163_10159243 3300014325 Bacteria 2303
207 Ga0163163_10316507 3300014325 Bacteria 1614
208 Ga0157380_10085625 3300014326 Bacteria 2587
209 Ga0157380_10338320 3300014326 Bacteria 1403
210 Ga0157380_10392440 3300014326 Bacteria 1314
211 Ga0157377_10021813 3300014745 Bacteria 3374
212 Ga0157377_10062943 3300014745 Bacteria 2124
213 Ga0157377_10067855 3300014745 Bacteria 2054
214 Ga0157379_10008180 3300014968 Bacteria 9081
215 Ga0157379_10058612 3300014968 Bacteria 3444
216 Ga0163161_10185710 3300017792 Bacteria 1596
217 Ga0207682_10072839 3300025893 Bacteria 1458
218 Ga0207642_10030863 3300025899 Bacteria 2238
219 Ga0207680_10009647 3300025903 Bacteria 4798
220 Ga0207680_10158790 3300025903 Bacteria 1514
221 Ga0207680_10208141 3300025903 Bacteria 1336
222 Ga0207699_10013130 3300025906 Bacteria 4229
223 Ga0207645_10011140 3300025907 Bacteria 6153
224 Ga0207643_10422824 3300025908 Bacteria 845
225 Ga0207684_10301894 3300025910 Bacteria 1380
226 Ga0207654_10206780 3300025911 Bacteria 1295
227 Ga0207662_10048356 3300025918 Bacteria 2519
228 Ga0207662_10242314 3300025918 Bacteria 1181
229 Ga0207657_10009283 3300025919 Bacteria 9906
230 Ga0207652_10109816 3300025921 Bacteria 2446
231 Ga0207652_10796978 3300025921 Bacteria 839
232 Ga0207646_10358137 3300025922 Bacteria 1318
233 Ga0207681_10046826 3300025923 Bacteria 2909
234 Ga0207681_10066277 3300025923 Bacteria 2499
235 Ga0207694_10400687 3300025924 Bacteria 1141
236 Ga0207659_10000167 3300025926 Bacteria 39314
237 Ga0207659_10102132 3300025926 Bacteria 2164
238 Ga0207659_10701249 3300025926 Bacteria 867
239 Ga0207687_10221888 3300025927 Bacteria 1489
240 Ga0207700_10105329 3300025928 Bacteria 2258
241 Ga0207644_10058497 3300025931 Bacteria 2786
242 Ga0207690_10030660 3300025932 Bacteria 3433
243 Ga0207706_10077455 3300025933 Bacteria 2924
244 Ga0207706_10195601 3300025933 Bacteria 1774
245 Ga0207686_10090878 3300025934 Bacteria 2015
246 Ga0207686_10137805 3300025934 Bacteria 1682
247 Ga0207686_10391463 3300025934 Bacteria 1056
248 Ga0207709_10037621 3300025935 Bacteria 2877
249 Ga0207670_10245353 3300025936 Bacteria 1382
250 Ga0207669_10043854 3300025937 Bacteria 2622
251 Ga0207669_10058031 3300025937 Bacteria 2360
252 Ga0207669_10164162 3300025937 Bacteria 1573
253 Ga0207704_10058853 3300025938 Bacteria 2368
254 Ga0207704_10265186 3300025938 Bacteria 1297
255 Ga0207704_10304996 3300025938 Bacteria 1221
256 Ga0207704_10369400 3300025938 Bacteria 1122
257 Ga0207691_10062879 3300025940 Bacteria 3367
258 Ga0207691_10507751 3300025940 Bacteria 1023
259 Ga0207711_10011317 3300025941 Bacteria 7411
260 Ga0207711_10205021 3300025941 Bacteria 1800
261 Ga0207711_10352630 3300025941 Bacteria 1362
262 Ga0207689_10048606 3300025942 Bacteria 3499
263 Ga0207689_10191727 3300025942 Bacteria 1686
264 Ga0207689_10199805 3300025942 Bacteria 1650
265 Ga0207689_10323996 3300025942 Bacteria 1279
266 Ga0207679_10033079 3300025945 Bacteria 3636
267 Ga0207679_10790683 3300025945 Bacteria 865
268 Ga0207667_10068503 3300025949 Bacteria 3695
269 Ga0207651_10005718 3300025960 Bacteria 6419
270 Ga0207651_10096873 3300025960 Bacteria 2177
271 Ga0207651_10147778 3300025960 Bacteria 1825
272 Ga0207640_10011712 3300025981 Bacteria 4973
273 Ga0207640_10106607 3300025981 Bacteria 1977
274 Ga0207658_10017805 3300025986 Bacteria 4895
275 Ga0207677_10071625 3300026023 Bacteria 2447
276 Ga0207677_10111746 3300026023 Bacteria 2036
277 Ga0207677_10123296 3300026023 Bacteria 1954
278 Ga0207703_10014271 3300026035 Bacteria 6196
279 Ga0207703_10059864 3300026035 Bacteria 3112
280 Ga0207639_10349589 3300026041 Bacteria 1320
281 Ga0207678_10289444 3300026067 Bacteria 1407
282 Ga0207708_10014545 3300026075 Bacteria 5887
283 Ga0207708_10020634 3300026075 Bacteria 4969
284 Ga0207708_10137195 3300026075 Bacteria 1916
285 Ga0207641_10003071 3300026088 Bacteria 15056
286 Ga0207641_10156984 3300026088 Bacteria 2065
287 Ga0207648_10022105 3300026089 Bacteria 5714
288 Ga0207648_10169715 3300026089 Bacteria 1928
289 Ga0207648_10185940 3300026089 Bacteria 1840
290 Ga0207648_10312380 3300026089 Bacteria 1411
291 Ga0207648_10347880 3300026089 Bacteria 1336
292 Ga0207676_10539426 3300026095 Bacteria 1113
293 Ga0207674_10454026 3300026116 Bacteria 1239
294 Ga0207675_100001792 3300026118 Bacteria 21488
295 Ga0207675_100010296 3300026118 Bacteria 8761
296 Ga0207675_100052937 3300026118 Bacteria 3787
297 Ga0207675_100329399 3300026118 Bacteria 1492
298 Ga0207675_100473593 3300026118 Bacteria 1244
299 Ga0207683_10207596 3300026121 Bacteria 1782
300 Ga0209588_1063064 3300027671 Bacteria 1198
301 Ga0209974_10031257 3300027876 Bacteria 1763
302 Ga0207428_10001495 3300027907 Bacteria 24437
303 Ga0207428_10001962 3300027907 Bacteria 20882
304 Ga0207428_10005045 3300027907 Bacteria 12402
305 Ga0207428_10015551 3300027907 Bacteria 6578
306 Ga0207428_10042804 3300027907 Bacteria 3661
307 Ga0207428_10046665 3300027907 Bacteria 3484
308 Ga0268266_10552784 3300028379 Bacteria 1103
309 Ga0268265_10003170 3300028380 Bacteria 11959
310 Ga0268265_10125945 3300028380 Bacteria 2120
311 Ga0268265_10701192 3300028380 Bacteria 978
312 Ga0268264_10079941 3300028381 Bacteria 2791
313 Ga0268264_10168028 3300028381 Bacteria 1982
314 Ga0268264_10269533 3300028381 Bacteria 1590
315 Ga0268264_10444157 3300028381 Bacteria 1255
316 Ga0268264_10452178 3300028381 Bacteria 1244
317 Ga0307408_100346811 3300031548 Bacteria 1259
318 Ga0373948_0001826 3300034817 Bacteria 3038
319 Ga0373948_0034077 3300034817 Bacteria 1039
320 Ga0373950_0043047 3300034818 Bacteria 869
321 Ga0373958_0001072 3300034819 Bacteria 3594
322 Ga0373958_0004779 3300034819 Bacteria 2022
323 Ga0373959_0001715 3300034820 Bacteria 3501
324 Ga0373929_0002316 3300035085 Bacteria 3506
325 Ga0373929_0020329 3300035085 Bacteria 1338
326 Ga0373934_0085794 3300035086 Bacteria 1267
327 Ga0373940_0000157 3300035088 Bacteria 8940
328 Ga0373949_0001672 3300035090 Bacteria 6186
329 Ga0373951_0035479 3300035091 Bacteria 1187
330 Ga0373952_0045418 3300035092 Bacteria 1029
331 Ga0373932_0000337 3300035112 Bacteria 14304
332 Ga0373941_0002940 3300035115 Bacteria 3806
333 Ga0373941_0069667 3300035115 Bacteria 1164
334 Ga0373945_0089583 3300035116 Bacteria 1190
335 Ga0373956_0155292 3300035119 Bacteria 1077
336 Ga0373943_0003762 3300035170 Bacteria 6893
337 Ga0373943_0353290 3300035170 Bacteria 843
338 Ga0373946_0005443 3300035171 Bacteria 4590
339 Ga0373955_0047283 3300035172 Bacteria 2329
340 Ga0373955_0093635 3300035172 Bacteria 1716
341 Ga0373955_0196277 3300035172 Bacteria 1201
342 Ga0373955_0280144 3300035172 Bacteria 1003
343 Ga0373942_0007670 3300035207 Bacteria 2508
344 Ga0373961_0003080 3300035241 Bacteria 4192
345 Ga0373962_0007033 3300035242 Bacteria 2746
346 Ga0373962_0027860 3300035242 Bacteria 1530
347 Ga0373924_0007005 3300035410 Bacteria 4059
348 Ga0373924_0035778 3300035410 Bacteria 2015
349 Ga0373931_0004668 3300035691 Bacteria 6270
350 Ga0373935_0143987 3300035692 Bacteria 1612
351 Ga0373947_0055734 3300035725 Bacteria 2388
352 Ga0373937_0029611 3300036401 Bacteria 4959
353 Ga0373937_0192069 3300036401 Bacteria 1919
354 Ga0373937_0494702 3300036401 Bacteria 1162
355 Ga0373925_0016292 3300037068 Bacteria 5382
356 Ga0373925_0052575 3300037068 Bacteria 3044
357 Ga0466963_0268461 3300044694 Bacteria 1199
358 Ga0451576_0031558 3300045051 Bacteria 5647
359 Ga0451576_0132120 3300045051 Bacteria 2603
360 Ga0451576_0214922 3300045051 Bacteria 2008
361 Ga0466958_0323756 3300045836 Bacteria 991
362 Ga0495629_0027594 3300046459 Bacteria 4032
363 Ga0495629_0108705 3300046459 Bacteria 1934
364 Ga0495629_0208820 3300046459 Bacteria 1349
365 Ga0495584_0061456 3300046491 Bacteria 1888
366 Ga0495608_0002623 3300046511 Bacteria 12910
367 Ga0495628_0042796 3300046516 Bacteria 3610
368 Ga0495630_0021329 3300046517 Bacteria 4783
369 Ga0495643_0013257 3300046522 Bacteria 4940
370 Ga0495642_0026038 3300046528 Bacteria 2321
371 Ga0495652_0168854 3300046529 Bacteria 1690
372 Ga0495640_0115004 3300046533 Bacteria 1754
373 Ga0495598_0037112 3300046537 Bacteria 1404
374 Ga0495609_0005898 3300046538 Bacteria 6333
375 Ga0495621_0009738 3300046539 Bacteria 2928
376 Ga0495621_0012802 3300046539 Bacteria 2621
377 Ga0495621_0018322 3300046539 Bacteria 2273
378 Ga0495645_0001331 3300046543 Bacteria 16747
379 Ga0495645_0299830 3300046543 Bacteria 1050
380 Ga0495667_0008533 3300046559 Bacteria 6956
381 Ga0495656_0100926 3300046615 Bacteria 1335
382 Ga0495635_0094852 3300046663 Bacteria 2040
383 Ga0495635_0337771 3300046663 Bacteria 1006
384 Ga0495659_0011145 3300046664 Bacteria 2896
385 Ga0495659_0083674 3300046664 Bacteria 1215
386 Ga0495659_0100815 3300046664 Bacteria 1118
387 Ga0495657_0047815 3300046675 Bacteria 2890
388 Ga0495647_0019900 3300046681 Bacteria 2405
389 Ga0495658_0045161 3300046683 Bacteria 2472
390 Ga0495658_0095095 3300046683 Bacteria 1770
391 Ga0495658_0154314 3300046683 Bacteria 1412
392 Ga0495658_0282637 3300046683 Bacteria 1047
393 Ga0495669_0035552 3300046684 Bacteria 2200
394 Ga0495669_0099948 3300046684 Bacteria 1347
395 Ga0495613_0006012 3300046689 Bacteria 9081
396 Ga0495670_0045527 3300046691 Bacteria 2191
397 Ga0495636_0025598 3300047318 Bacteria 2396
398 Ga0495674_0164508 3300047319 Bacteria 1855
399 Ga0495685_062534 3300047447 Bacteria 1253
400 Ga0495684_0000430 3300047471 Bacteria 34261
401 Ga0495684_0100121 3300047471 Bacteria 2191
402 Ga0495615_0029127 3300048090 Bacteria 1308
403 Ga0496102_0066968 3300048905 Bacteria 3293
404 Ga0496102_0117685 3300048905 Bacteria 2480
405 Ga0496104_0036425 3300048907 Bacteria 4600
406 Ga0496106_0145065 3300048909 Bacteria 1869
407 Ga0496106_0213600 3300048909 Bacteria 1537
408 Ga0496106_0553483 3300048909 Bacteria 923
409 Ga0496108_0062508 3300048911 Bacteria 3135
410 Ga0496108_0174394 3300048911 Bacteria 1861
411 Ga0496109_0133253 3300048912 Bacteria 2320
412 Ga0496109_0177322 3300048912 Bacteria 2001
413 Ga0496109_0254679 3300048912 Bacteria 1653
414 Ga0496110_0760103 3300048913 Bacteria 873
415 Ga0496111_0212686 3300048914 Bacteria 1436
416 Ga0496112_0088263 3300048915 Bacteria 3069
417 Ga0496112_0527107 3300048915 Bacteria 1116
418 Ga0496112_0540123 3300048915 Bacteria 1100
419 Ga0496112_0559768 3300048915 Bacteria 1077
420 Ga0496113_0165548 3300048916 Bacteria 1749
421 Ga0496114_0016251 3300048917 Bacteria 5994
422 Ga0496114_0131212 3300048917 Bacteria 2164
423 Ga0496114_0256247 3300048917 Bacteria 1540
424 Ga0501036_0173847 3300049572 Bacteria 1814
425 Ga0501038_0202379 3300049574 Bacteria 1593
426 Ga0501039_0114521 3300049575 Bacteria 2110
427 Ga0501041_0007828 3300049577 Bacteria 6278
428 Ga0501046_0353574 3300049580 Bacteria 1066
429 Ga0501048_0079742 3300049582 Bacteria 2310
430 Ga0501067_0150720 3300049583 Bacteria 1296
431 Ga0501071_0045591 3300049587 Bacteria 3148
432 Ga0501072_0014257 3300049588 Bacteria 6090
433 Ga0501075_0019658 3300049591 Bacteria 4902
434 Ga0501075_0063616 3300049591 Bacteria 2782
435 Ga0501076_0092215 3300049592 Bacteria 2437
436 Ga0501076_0402542 3300049592 Bacteria 1125
437 Ga0501249_009824 3300049679 Bacteria 1993
438 Ga0501079_0012833 3300049741 Bacteria 6396
439 Ga0501081_0085912 3300049743 Bacteria 2209
440 Ga0501283_013721 3300049779 Bacteria 1231
441 Ga0501045_0035619 3300049824 Bacteria 3614
442 nmdc:mga05p37_113898_c1 3300050507 Bacteria 3325
443 nmdc:mga05p37_11444_c1 3300050507 Bacteria 10565
444 nmdc:mga05p37_1166939_c1 3300050507 Bacteria 799
445 nmdc:mga05p37_12625_c1 3300050507 Bacteria 10088
446 nmdc:mga05p37_13609_c1 3300050507 Bacteria 9749
447 nmdc:mga05p37_13779_c2 3300050507 Bacteria 1350
448 nmdc:mga05p37_33086_c1 3300050507 Bacteria 6332
449 nmdc:mga05p37_399357_c1 3300050507 Bacteria 1605
450 nmdc:mga05p37_456720_c1 3300050507 Bacteria 1477
451 nmdc:mga05p37_62790_c1 3300050507 Bacteria 4572
452 nmdc:mga05p37_65866_c1 3300050507 Bacteria 4457
453 nmdc:mga05p37_76392_c1 3300050507 Bacteria 4124
454 nmdc:mga09592_162500_c1 3300050508 Bacteria 1929
455 nmdc:mga09592_201370_c1 3300050508 Bacteria 1724
456 nmdc:mga09592_29060_c1 3300050508 Bacteria 4598
457 nmdc:mga09592_40389_c1 3300050508 Bacteria 3919
458 nmdc:mga0qj67_20292_c1 3300050509 Bacteria 5086
459 nmdc:mga0qj67_4090_c1 3300050509 Bacteria 10586
460 nmdc:mga06r32_16884_c1 3300050510 Bacteria 6659
461 nmdc:mga06r32_70522_c1 3300050510 Bacteria 3380
462 nmdc:mga08y16_124096_c1 3300050511 Bacteria 2687
463 nmdc:mga08y16_146291_c1 3300050511 Bacteria 2457
464 nmdc:mga08y16_17319_c1 3300050511 Bacteria 7586
465 nmdc:mga08y16_256222_c1 3300050511 Bacteria 1807
466 nmdc:mga08y16_2829_c1 3300050511 Bacteria 17834
467 nmdc:mga08y16_3332_c1 3300050511 Bacteria 16637
468 nmdc:mga08y16_401189_c1 3300050511 Bacteria 1403
469 nmdc:mga08y16_80322_c1 3300050511 Bacteria 3400
470 nmdc:mga08y16_8364_c1 3300050511 Bacteria 10825
471 nmdc:mga0n895_155144_c1 3300050512 Bacteria 2320
472 nmdc:mga0n895_32853_c1 3300050512 Bacteria 4983
473 nmdc:mga0n895_343507_c1 3300050512 Bacteria 1512
474 nmdc:mga0n895_354768_c1 3300050512 Bacteria 1485
475 nmdc:mga0n895_383679_c1 3300050512 Bacteria 1422
476 nmdc:mga0n895_57_c1 3300050512 Bacteria 65730
477 nmdc:mga0n895_6739_c1 3300050512 Bacteria 9797
478 nmdc:mga0n895_743953_c1 3300050512 Bacteria 974
479 nmdc:mga0rr50_11908_c1 3300050513 Bacteria 5592
480 nmdc:mga0rr50_141599_c1 3300050513 Bacteria 1935
481 nmdc:mga0rr50_1568_c1 3300050513 Bacteria 12596
482 nmdc:mga0rr50_24519_c1 3300050513 Bacteria 4178
483 nmdc:mga0rr50_26900_c1 3300050513 Bacteria 4022
484 nmdc:mga0rr50_46727_c1 3300050513 Bacteria 3188
485 nmdc:mga0rr50_468150_c1 3300050513 Bacteria 1070
486 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
487 nmdc:mga0rr50_647_c1 3300050513 Bacteria 18706
488 nmdc:mga08x19_117833_c1 3300050514 Bacteria 1777
489 nmdc:mga08x19_1472_c1 3300050514 Bacteria 14582
490 nmdc:mga08x19_212672_c1 3300050514 Bacteria 1327
491 nmdc:mga08x19_25509_c1 3300050514 Bacteria 3682
492 nmdc:mga08x19_264651_c1 3300050514 Bacteria 1189
493 nmdc:mga0a205_13205_c1 3300050515 Bacteria 7677
494 nmdc:mga0a205_17039_c1 3300050515 Bacteria 6801
495 nmdc:mga0a205_459765_c1 3300050515 Unclassified 1132
496 nmdc:mga0a205_60494_c1 3300050515 Bacteria 3658
497 nmdc:mga0a205_66017_c1 3300050515 Bacteria 3496
498 nmdc:mga0a205_67230_c1 3300050515 Bacteria 3462
499 Ga0495601_0112942 3300053077 Bacteria 1760
500 Ga0495612_0044640 3300053078 Bacteria 1814
501 Ga0495595_0073009 3300053084 Bacteria 1624
502 Ga0495619_0033397 3300053085 Bacteria 3341
503 Ga0495619_0296339 3300053085 Bacteria 1120
504 Ga0501084_0347798 3300054114 Bacteria 1252

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0150720 Ga0501067_0150720_210_959 208
2 3300046539 Ga0495621_0009738 Ga0495621_0009738_1067_1828 209
3 3300026116 Ga0207674_10454026 Ga0207674_104540262 210
4 3300046538 Ga0495609_0005898 Ga0495609_0005898_3769_4506 211
5 3300006871 Ga0075434_100065690 Ga0075434_1000656904 216
6 3300050512 nmdc:mga0n895_343507_c1 nmdc:mga0n895_343507_c1_92_892 216
7 3300050514 nmdc:mga08x19_212672_c1 nmdc:mga08x19_212672_c1_344_1129 216
8 3300049779 Ga0501283_013721 Ga0501283_013721_31_684 217
9 3300050513 nmdc:mga0rr50_11908_c1 nmdc:mga0rr50_11908_c1_881_1681 218
10 3300005985 Ga0081539_10103103 Ga0081539_101031032 221
11 3300005455 Ga0070663_100153003 Ga0070663_1001530032 222
12 3300009147 Ga0114129_10008383 Ga0114129_100083834 222
13 3300026067 Ga0207678_10289444 Ga0207678_102894442 222
14 3300050507 nmdc:mga05p37_113898_c1 nmdc:mga05p37_113898_c1_1069_1830 222
15 3300006358 Ga0068871_100002524 Ga0068871_10000252412 224
16 3300006881 Ga0068865_100035864 Ga0068865_1000358644 224
17 3300009176 Ga0105242_10023293 Ga0105242_100232934 224
18 3300026089 Ga0207648_10169715 Ga0207648_101697153 224
19 3300048917 Ga0496114_0256247 Ga0496114_0256247_400_1170 224
20 3300048913 Ga0496110_0760103 Ga0496110_0760103_10_696 225
21 3300005842 Ga0068858_100252384 Ga0068858_1002523843 227
22 3300009094 Ga0111539_10040689 Ga0111539_100406896 227
23 3300009098 Ga0105245_10324655 Ga0105245_103246552 227
24 3300009147 Ga0114129_10130688 Ga0114129_101306885 227
25 3300025926 Ga0207659_10102132 Ga0207659_101021323 227
26 3300026089 Ga0207648_10185940 Ga0207648_101859402 227
27 3300027876 Ga0209974_10031257 Ga0209974_100312572 227
28 3300027907 Ga0207428_10042804 Ga0207428_100428042 227
29 3300031548 Ga0307408_100346811 Ga0307408_1003468112 227
30 3300046539 Ga0495621_0018322 Ga0495621_0018322_1447_2187 227
31 3300050507 nmdc:mga05p37_76392_c1 nmdc:mga05p37_76392_c1_2485_3225 227
32 3300050508 nmdc:mga09592_40389_c1 nmdc:mga09592_40389_c1_2823_3563 227
33 3300050511 nmdc:mga08y16_124096_c1 nmdc:mga08y16_124096_c1_1337_2077 227
34 3300025910 Ga0207684_10301894 Ga0207684_103018942 228
35 3300026118 Ga0207675_100473593 Ga0207675_1004735932 228
36 3300050507 nmdc:mga05p37_62790_c1 nmdc:mga05p37_62790_c1_2415_3182 228
37 3300005330 Ga0070690_100433701 Ga0070690_1004337011 229
38 3300005441 Ga0070700_100176322 Ga0070700_1001763222 229
39 3300005444 Ga0070694_100005646 Ga0070694_1000056462 229
40 3300005471 Ga0070698_100471999 Ga0070698_1004719991 229
41 3300005518 Ga0070699_100379678 Ga0070699_1003796782 229
42 3300005545 Ga0070695_100004311 Ga0070695_1000043118 229
43 3300006852 Ga0075433_10360308 Ga0075433_103603082 229
44 3300007076 Ga0075435_100147815 Ga0075435_1001478153 229
45 3300009147 Ga0114129_10173964 Ga0114129_101739645 229
46 3300009147 Ga0114129_10189609 Ga0114129_101896093 229
47 3300009147 Ga0114129_10272385 Ga0114129_102723854 229
48 3300050507 nmdc:mga05p37_11444_c1 nmdc:mga05p37_11444_c1_1526_2260 229
49 3300050507 nmdc:mga05p37_33086_c1 nmdc:mga05p37_33086_c1_944_1678 229
50 3300050512 nmdc:mga0n895_32853_c1 nmdc:mga0n895_32853_c1_3326_4060 229
51 3300050513 nmdc:mga0rr50_26900_c1 nmdc:mga0rr50_26900_c1_544_1278 229
52 3300050515 nmdc:mga0a205_60494_c1 nmdc:mga0a205_60494_c1_264_998 229
53 3300005467 Ga0070706_100210660 Ga0070706_1002106603 230
54 3300005985 Ga0081539_10062389 Ga0081539_100623893 230
55 3300006871 Ga0075434_100006471 Ga0075434_1000064716 230
56 3300007076 Ga0075435_100255739 Ga0075435_1002557392 230
57 3300007265 Ga0099794_10072234 Ga0099794_100722342 230
58 3300009094 Ga0111539_10153002 Ga0111539_101530024 230
59 3300009147 Ga0114129_10458246 Ga0114129_104582463 230
60 3300009147 Ga0114129_10760161 Ga0114129_107601612 230
61 3300014326 Ga0157380_10392440 Ga0157380_103924402 230
62 3300027671 Ga0209588_1063064 Ga0209588_10630642 230
63 3300048917 Ga0496114_0016251 Ga0496114_0016251_3852_4625 230
64 3300050511 nmdc:mga08y16_256222_c1 nmdc:mga08y16_256222_c1_524_1267 230
65 3300050512 nmdc:mga0n895_383679_c1 nmdc:mga0n895_383679_c1_292_1026 230
66 3300050513 nmdc:mga0rr50_1568_c1 nmdc:mga0rr50_1568_c1_10021_10755 230
67 3300050515 nmdc:mga0a205_67230_c1 nmdc:mga0a205_67230_c1_145_879 230
68 3300005330 Ga0070690_100065962 Ga0070690_1000659624 231
69 3300005335 Ga0070666_10004561 Ga0070666_100045614 231
70 3300005338 Ga0068868_100072543 Ga0068868_1000725435 231
71 3300005341 Ga0070691_10001930 Ga0070691_100019308 231
72 3300005343 Ga0070687_100214595 Ga0070687_1002145951 231
73 3300005347 Ga0070668_100043395 Ga0070668_1000433954 231
74 3300005353 Ga0070669_100002325 Ga0070669_1000023256 231
75 3300005356 Ga0070674_100092948 Ga0070674_1000929484 231
76 3300005364 Ga0070673_100425959 Ga0070673_1004259592 231
77 3300005438 Ga0070701_10006223 Ga0070701_100062235 231
78 3300005438 Ga0070701_10304591 Ga0070701_103045912 231
79 3300005440 Ga0070705_100003585 Ga0070705_1000035854 231
80 3300005441 Ga0070700_100001354 Ga0070700_1000013546 231
81 3300005441 Ga0070700_100124821 Ga0070700_1001248213 231
82 3300005444 Ga0070694_100043330 Ga0070694_1000433302 231
83 3300005456 Ga0070678_100530402 Ga0070678_1005304022 231
84 3300005457 Ga0070662_100055306 Ga0070662_1000553063 231
85 3300005459 Ga0068867_100014014 Ga0068867_1000140145 231
86 3300005536 Ga0070697_100085923 Ga0070697_1000859235 231
87 3300005543 Ga0070672_100229417 Ga0070672_1002294172 231
88 3300005544 Ga0070686_100001752 Ga0070686_1000017525 231
89 3300005544 Ga0070686_100515971 Ga0070686_1005159711 231
90 3300005545 Ga0070695_100001186 Ga0070695_1000011865 231
91 3300005546 Ga0070696_100017382 Ga0070696_1000173825 231
92 3300005546 Ga0070696_100022282 Ga0070696_1000222825 231
93 3300005548 Ga0070665_100002437 Ga0070665_1000024374 231
94 3300005549 Ga0070704_100010428 Ga0070704_1000104285 231
95 3300005578 Ga0068854_100002435 Ga0068854_10000243512 231
96 3300005578 Ga0068854_100025719 Ga0068854_1000257193 231
97 3300005615 Ga0070702_100049106 Ga0070702_1000491065 231
98 3300005617 Ga0068859_100549292 Ga0068859_1005492922 231
99 3300005718 Ga0068866_10029079 Ga0068866_100290793 231
100 3300005719 Ga0068861_100018565 Ga0068861_1000185655 231
101 3300005719 Ga0068861_100032421 Ga0068861_1000324215 231
102 3300005842 Ga0068858_100692029 Ga0068858_1006920292 231
103 3300005843 Ga0068860_100201285 Ga0068860_1002012852 231
104 3300006852 Ga0075433_10164802 Ga0075433_101648023 231
105 3300006871 Ga0075434_100220650 Ga0075434_1002206503 231
106 3300006880 Ga0075429_100091910 Ga0075429_1000919102 231
107 3300006881 Ga0068865_100057769 Ga0068865_1000577694 231
108 3300006881 Ga0068865_100191852 Ga0068865_1001918522 231
109 3300006881 Ga0068865_100216570 Ga0068865_1002165702 231
110 3300006914 Ga0075436_100225021 Ga0075436_1002250212 231
111 3300006931 Ga0097620_100549326 Ga0097620_1005493262 231
112 3300007076 Ga0075435_100003662 Ga0075435_10000366214 231
113 3300009094 Ga0111539_10001538 Ga0111539_1000153818 231
114 3300009098 Ga0105245_10488636 Ga0105245_104886361 231
115 3300009148 Ga0105243_10015866 Ga0105243_100158665 231
116 3300009148 Ga0105243_10032809 Ga0105243_100328094 231
117 3300009174 Ga0105241_10151718 Ga0105241_101517183 231
118 3300009176 Ga0105242_10012837 Ga0105242_100128373 231
119 3300009176 Ga0105242_10048267 Ga0105242_100482674 231
120 3300009553 Ga0105249_10088310 Ga0105249_100883101 231
121 3300009553 Ga0105249_10605909 Ga0105249_106059092 231
122 3300013296 Ga0157374_10042978 Ga0157374_100429784 231
123 3300014326 Ga0157380_10085625 Ga0157380_100856254 231
124 3300025899 Ga0207642_10030863 Ga0207642_100308632 231
125 3300025903 Ga0207680_10009647 Ga0207680_100096475 231
126 3300025907 Ga0207645_10011140 Ga0207645_100111402 231
127 3300025911 Ga0207654_10206780 Ga0207654_102067802 231
128 3300025918 Ga0207662_10048356 Ga0207662_100483565 231
129 3300025923 Ga0207681_10066277 Ga0207681_100662774 231
130 3300025933 Ga0207706_10077455 Ga0207706_100774553 231
131 3300025934 Ga0207686_10090878 Ga0207686_100908783 231
132 3300025934 Ga0207686_10137805 Ga0207686_101378052 231
133 3300025935 Ga0207709_10037621 Ga0207709_100376215 231
134 3300025937 Ga0207669_10043854 Ga0207669_100438543 231
135 3300025938 Ga0207704_10058853 Ga0207704_100588533 231
136 3300025938 Ga0207704_10304996 Ga0207704_103049962 231
137 3300025938 Ga0207704_10369400 Ga0207704_103694002 231
138 3300025940 Ga0207691_10507751 Ga0207691_105077512 231
139 3300025941 Ga0207711_10205021 Ga0207711_102050213 231
140 3300025960 Ga0207651_10147778 Ga0207651_101477784 231
141 3300025981 Ga0207640_10011712 Ga0207640_100117125 231
142 3300025981 Ga0207640_10106607 Ga0207640_101066073 231
143 3300026023 Ga0207677_10071625 Ga0207677_100716252 231
144 3300026075 Ga0207708_10014545 Ga0207708_100145455 231
145 3300026075 Ga0207708_10020634 Ga0207708_100206344 231
146 3300026075 Ga0207708_10137195 Ga0207708_101371951 231
147 3300026088 Ga0207641_10156984 Ga0207641_101569842 231
148 3300026089 Ga0207648_10022105 Ga0207648_100221055 231
149 3300026118 Ga0207675_100001792 Ga0207675_1000017925 231
150 3300026118 Ga0207675_100010296 Ga0207675_1000102969 231
151 3300027907 Ga0207428_10005045 Ga0207428_1000504515 231
152 3300028381 Ga0268264_10168028 Ga0268264_101680282 231
153 3300034817 Ga0373948_0001826 Ga0373948_0001826_1302_2045 231
154 3300034818 Ga0373950_0043047 Ga0373950_0043047_80_823 231
155 3300034819 Ga0373958_0001072 Ga0373958_0001072_347_1090 231
156 3300034820 Ga0373959_0001715 Ga0373959_0001715_332_1075 231
157 3300035085 Ga0373929_0002316 Ga0373929_0002316_2522_3265 231
158 3300035088 Ga0373940_0000157 Ga0373940_0000157_6940_7683 231
159 3300035090 Ga0373949_0001672 Ga0373949_0001672_4429_5172 231
160 3300035091 Ga0373951_0035479 Ga0373951_0035479_80_823 231
161 3300035092 Ga0373952_0045418 Ga0373952_0045418_80_823 231
162 3300035112 Ga0373932_0000337 Ga0373932_0000337_11041_11784 231
163 3300035115 Ga0373941_0069667 Ga0373941_0069667_342_1085 231
164 3300035207 Ga0373942_0007670 Ga0373942_0007670_80_823 231
165 3300035241 Ga0373961_0003080 Ga0373961_0003080_494_1237 231
166 3300035242 Ga0373962_0007033 Ga0373962_0007033_191_934 231
167 3300035691 Ga0373931_0004668 Ga0373931_0004668_4692_5435 231
168 3300044694 Ga0466963_0268461 Ga0466963_0268461_65_826 231
169 3300045051 Ga0451576_0031558 Ga0451576_0031558_73_816 231
170 3300046615 Ga0495656_0100926 Ga0495656_0100926_404_1204 231
171 3300048905 Ga0496102_0117685 Ga0496102_0117685_1199_1942 231
172 3300048909 Ga0496106_0145065 Ga0496106_0145065_598_1341 231
173 3300049591 Ga0501075_0063616 Ga0501075_0063616_871_1623 231
174 3300049743 Ga0501081_0085912 Ga0501081_0085912_906_1649 231
175 3300050507 nmdc:mga05p37_1166939_c1 nmdc:mga05p37_1166939_c1_21_764 231
176 3300050507 nmdc:mga05p37_399357_c1 nmdc:mga05p37_399357_c1_474_1238 231
177 3300050511 nmdc:mga08y16_146291_c1 nmdc:mga08y16_146291_c1_484_1248 231
178 3300050511 nmdc:mga08y16_2829_c1 nmdc:mga08y16_2829_c1_11016_11759 231
179 3300050512 nmdc:mga0n895_155144_c1 nmdc:mga0n895_155144_c1_323_1066 231
180 3300050512 nmdc:mga0n895_354768_c1 nmdc:mga0n895_354768_c1_211_954 231
181 3300050513 nmdc:mga0rr50_24519_c1 nmdc:mga0rr50_24519_c1_47_790 231
182 3300050513 nmdc:mga0rr50_647_c1 nmdc:mga0rr50_647_c1_9479_10222 231
183 3300050514 nmdc:mga08x19_264651_c1 nmdc:mga08x19_264651_c1_65_808 231
184 3300005330 Ga0070690_100145033 Ga0070690_1001450331 232
185 3300005339 Ga0070660_100010154 Ga0070660_1000101548 232
186 3300005353 Ga0070669_100030879 Ga0070669_1000308794 232
187 3300005365 Ga0070688_100145833 Ga0070688_1001458332 232
188 3300005366 Ga0070659_100087730 Ga0070659_1000877304 232
189 3300005367 Ga0070667_100006918 Ga0070667_1000069188 232
190 3300005518 Ga0070699_100472289 Ga0070699_1004722891 232
191 3300005530 Ga0070679_100031825 Ga0070679_1000318255 232
192 3300005536 Ga0070697_100364874 Ga0070697_1003648742 232
193 3300005563 Ga0068855_100006981 Ga0068855_1000069814 232
194 3300005719 Ga0068861_100118308 Ga0068861_1001183082 232
195 3300005841 Ga0068863_100011770 Ga0068863_1000117707 232
196 3300005844 Ga0068862_100013444 Ga0068862_1000134449 232
197 3300005844 Ga0068862_100628512 Ga0068862_1006285122 232
198 3300005937 Ga0081455_10014844 Ga0081455_100148445 232
199 3300006844 Ga0075428_100071590 Ga0075428_1000715906 232
200 3300006871 Ga0075434_100005397 Ga0075434_1000053973 232
201 3300006871 Ga0075434_100036729 Ga0075434_1000367295 232
202 3300006871 Ga0075434_100143244 Ga0075434_1001432442 232
203 3300006914 Ga0075436_100045487 Ga0075436_1000454875 232
204 3300006914 Ga0075436_100084673 Ga0075436_1000846732 232
205 3300007076 Ga0075435_100000498 Ga0075435_1000004984 232
206 3300007076 Ga0075435_100243635 Ga0075435_1002436352 232
207 3300009094 Ga0111539_10097733 Ga0111539_100977334 232
208 3300009147 Ga0114129_10112038 Ga0114129_101120382 232
209 3300009177 Ga0105248_10013113 Ga0105248_100131137 232
210 3300010375 Ga0105239_10812195 Ga0105239_108121952 232
211 3300013306 Ga0163162_10094080 Ga0163162_100940802 232
212 3300013308 Ga0157375_10059354 Ga0157375_100593544 232
213 3300014968 Ga0157379_10008180 Ga0157379_100081807 232
214 3300025918 Ga0207662_10242314 Ga0207662_102423142 232
215 3300025919 Ga0207657_10009283 Ga0207657_100092839 232
216 3300025921 Ga0207652_10796978 Ga0207652_107969781 232
217 3300025923 Ga0207681_10046826 Ga0207681_100468264 232
218 3300025924 Ga0207694_10400687 Ga0207694_104006872 232
219 3300025926 Ga0207659_10701249 Ga0207659_107012491 232
220 3300025931 Ga0207644_10058497 Ga0207644_100584975 232
221 3300025932 Ga0207690_10030660 Ga0207690_100306604 232
222 3300025937 Ga0207669_10164162 Ga0207669_101641621 232
223 3300025940 Ga0207691_10062879 Ga0207691_100628795 232
224 3300025941 Ga0207711_10011317 Ga0207711_100113175 232
225 3300025949 Ga0207667_10068503 Ga0207667_100685034 232
226 3300025986 Ga0207658_10017805 Ga0207658_100178055 232
227 3300026088 Ga0207641_10003071 Ga0207641_100030714 232
228 3300026089 Ga0207648_10312380 Ga0207648_103123801 232
229 3300026118 Ga0207675_100052937 Ga0207675_1000529374 232
230 3300027907 Ga0207428_10015551 Ga0207428_100155513 232
231 3300028380 Ga0268265_10003170 Ga0268265_100031707 232
232 3300028381 Ga0268264_10079941 Ga0268264_100799411 232
233 3300034819 Ga0373958_0004779 Ga0373958_0004779_126_863 232
234 3300035085 Ga0373929_0020329 Ga0373929_0020329_504_1241 232
235 3300035242 Ga0373962_0027860 Ga0373962_0027860_693_1430 232
236 3300046684 Ga0495669_0035552 Ga0495669_0035552_75_812 232
237 3300046691 Ga0495670_0045527 Ga0495670_0045527_762_1499 232
238 3300048905 Ga0496102_0066968 Ga0496102_0066968_2220_3038 232
239 3300048909 Ga0496106_0213600 Ga0496106_0213600_503_1315 232
240 3300048909 Ga0496106_0553483 Ga0496106_0553483_39_794 232
241 3300048915 Ga0496112_0088263 Ga0496112_0088263_969_1781 232
242 3300048915 Ga0496112_0540123 Ga0496112_0540123_159_893 232
243 3300048915 Ga0496112_0559768 Ga0496112_0559768_171_926 232
244 3300050507 nmdc:mga05p37_65866_c1 nmdc:mga05p37_65866_c1_1203_1940 232
245 3300050511 nmdc:mga08y16_8364_c1 nmdc:mga08y16_8364_c1_3895_4632 232
246 3300050512 nmdc:mga0n895_57_c1 nmdc:mga0n895_57_c1_54163_54921 232
247 3300050512 nmdc:mga0n895_6739_c1 nmdc:mga0n895_6739_c1_3545_4306 232
248 3300050513 nmdc:mga0rr50_468150_c1 nmdc:mga0rr50_468150_c1_219_980 232
249 3300050513 nmdc:mga0rr50_5_c1 nmdc:mga0rr50_5_c1_269185_269943 232
250 3300050514 nmdc:mga08x19_1472_c1 nmdc:mga08x19_1472_c1_6822_7580 232
251 3300050514 nmdc:mga08x19_25509_c1 nmdc:mga08x19_25509_c1_2768_3562 232
252 3300050515 nmdc:mga0a205_13205_c1 nmdc:mga0a205_13205_c1_338_1075 232
253 3300005331 Ga0070670_100440621 Ga0070670_1004406212 233
254 3300005333 Ga0070677_10212121 Ga0070677_102121212 233
255 3300005334 Ga0068869_100093811 Ga0068869_1000938113 233
256 3300005335 Ga0070666_10224331 Ga0070666_102243312 233
257 3300005340 Ga0070689_100046446 Ga0070689_1000464462 233
258 3300005344 Ga0070661_100463643 Ga0070661_1004636431 233
259 3300005354 Ga0070675_100000496 Ga0070675_10000049613 233
260 3300005354 Ga0070675_100281787 Ga0070675_1002817872 233
261 3300005356 Ga0070674_100002893 Ga0070674_10000289311 233
262 3300005364 Ga0070673_100082067 Ga0070673_1000820675 233
263 3300005365 Ga0070688_100043097 Ga0070688_1000430975 233
264 3300005366 Ga0070659_100375385 Ga0070659_1003753852 233
265 3300005436 Ga0070713_100027954 Ga0070713_1000279542 233
266 3300005456 Ga0070678_100094599 Ga0070678_1000945994 233
267 3300005466 Ga0070685_10072672 Ga0070685_100726722 233
268 3300005468 Ga0070707_100214643 Ga0070707_1002146434 233
269 3300005468 Ga0070707_100630115 Ga0070707_1006301151 233
270 3300005530 Ga0070679_100108212 Ga0070679_1001082125 233
271 3300005578 Ga0068854_100077016 Ga0068854_1000770164 233
272 3300005617 Ga0068859_100072571 Ga0068859_1000725714 233
273 3300005618 Ga0068864_100477131 Ga0068864_1004771311 233
274 3300005842 Ga0068858_100104840 Ga0068858_1001048402 233
275 3300005842 Ga0068858_100142718 Ga0068858_1001427185 233
276 3300005844 Ga0068862_100126118 Ga0068862_1001261183 233
277 3300005844 Ga0068862_100731488 Ga0068862_1007314882 233
278 3300006852 Ga0075433_10269146 Ga0075433_102691462 233
279 3300006914 Ga0075436_100029225 Ga0075436_1000292252 233
280 3300006931 Ga0097620_100072571 Ga0097620_1000725714 233
281 3300009101 Ga0105247_10002063 Ga0105247_1000206312 233
282 3300009147 Ga0114129_10076271 Ga0114129_100762715 233
283 3300009147 Ga0114129_10438593 Ga0114129_104385931 233
284 3300009177 Ga0105248_10003193 Ga0105248_100031935 233
285 3300013308 Ga0157375_10634209 Ga0157375_106342092 233
286 3300014325 Ga0163163_10021899 Ga0163163_100218995 233
287 3300014325 Ga0163163_10159243 Ga0163163_101592434 233
288 3300014325 Ga0163163_10316507 Ga0163163_103165072 233
289 3300014745 Ga0157377_10021813 Ga0157377_100218133 233
290 3300014745 Ga0157377_10062943 Ga0157377_100629433 233
291 3300014968 Ga0157379_10058612 Ga0157379_100586124 233
292 3300025893 Ga0207682_10072839 Ga0207682_100728393 233
293 3300025903 Ga0207680_10208141 Ga0207680_102081412 233
294 3300025906 Ga0207699_10013130 Ga0207699_100131305 233
295 3300025921 Ga0207652_10109816 Ga0207652_101098162 233
296 3300025922 Ga0207646_10358137 Ga0207646_103581372 233
297 3300025926 Ga0207659_10000167 Ga0207659_1000016714 233
298 3300025937 Ga0207669_10058031 Ga0207669_100580312 233
299 3300025941 Ga0207711_10352630 Ga0207711_103526303 233
300 3300025942 Ga0207689_10048606 Ga0207689_100486065 233
301 3300025945 Ga0207679_10790683 Ga0207679_107906832 233
302 3300026035 Ga0207703_10014271 Ga0207703_100142715 233
303 3300026035 Ga0207703_10059864 Ga0207703_100598642 233
304 3300026089 Ga0207648_10347880 Ga0207648_103478802 233
305 3300026095 Ga0207676_10539426 Ga0207676_105394262 233
306 3300026121 Ga0207683_10207596 Ga0207683_102075962 233
307 3300028379 Ga0268266_10552784 Ga0268266_105527842 233
308 3300028380 Ga0268265_10125945 Ga0268265_101259454 233
309 3300028380 Ga0268265_10701192 Ga0268265_107011921 233
310 3300028381 Ga0268264_10452178 Ga0268264_104521781 233
311 3300034817 Ga0373948_0034077 Ga0373948_0034077_212_991 233
312 3300035086 Ga0373934_0085794 Ga0373934_0085794_356_1126 233
313 3300035115 Ga0373941_0002940 Ga0373941_0002940_2869_3645 233
314 3300035116 Ga0373945_0089583 Ga0373945_0089583_143_913 233
315 3300035119 Ga0373956_0155292 Ga0373956_0155292_13_750 233
316 3300035170 Ga0373943_0353290 Ga0373943_0353290_15_764 233
317 3300035172 Ga0373955_0093635 Ga0373955_0093635_425_1195 233
318 3300035172 Ga0373955_0196277 Ga0373955_0196277_45_815 233
319 3300035410 Ga0373924_0035778 Ga0373924_0035778_398_1168 233
320 3300035692 Ga0373935_0143987 Ga0373935_0143987_417_1187 233
321 3300035725 Ga0373947_0055734 Ga0373947_0055734_647_1417 233
322 3300036401 Ga0373937_0192069 Ga0373937_0192069_291_1061 233
323 3300036401 Ga0373937_0494702 Ga0373937_0494702_241_1023 233
324 3300037068 Ga0373925_0052575 Ga0373925_0052575_1080_1850 233
325 3300046459 Ga0495629_0208820 Ga0495629_0208820_442_1212 233
326 3300046537 Ga0495598_0037112 Ga0495598_0037112_93_860 233
327 3300046543 Ga0495645_0001331 Ga0495645_0001331_1066_1836 233
328 3300046663 Ga0495635_0094852 Ga0495635_0094852_528_1298 233
329 3300046664 Ga0495659_0083674 Ga0495659_0083674_391_1164 233
330 3300046681 Ga0495647_0019900 Ga0495647_0019900_642_1412 233
331 3300046683 Ga0495658_0095095 Ga0495658_0095095_643_1413 233
332 3300046683 Ga0495658_0154314 Ga0495658_0154314_30_782 233
333 3300046683 Ga0495658_0282637 Ga0495658_0282637_55_825 233
334 3300047319 Ga0495674_0164508 Ga0495674_0164508_982_1752 233
335 3300047471 Ga0495684_0100121 Ga0495684_0100121_1095_1865 233
336 3300048907 Ga0496104_0036425 Ga0496104_0036425_1386_2159 233
337 3300048911 Ga0496108_0062508 Ga0496108_0062508_299_1072 233
338 3300048912 Ga0496109_0133253 Ga0496109_0133253_44_817 233
339 3300048914 Ga0496111_0212686 Ga0496111_0212686_379_1152 233
340 3300048915 Ga0496112_0527107 Ga0496112_0527107_221_988 233
341 3300048916 Ga0496113_0165548 Ga0496113_0165548_674_1447 233
342 3300048917 Ga0496114_0131212 Ga0496114_0131212_647_1417 233
343 3300049592 Ga0501076_0402542 Ga0501076_0402542_100_846 233
344 3300050507 nmdc:mga05p37_12625_c1 nmdc:mga05p37_12625_c1_8847_9623 233
345 3300050507 nmdc:mga05p37_13609_c1 nmdc:mga05p37_13609_c1_7073_7873 233
346 3300050512 nmdc:mga0n895_743953_c1 nmdc:mga0n895_743953_c1_130_930 233
347 3300050513 nmdc:mga0rr50_141599_c1 nmdc:mga0rr50_141599_c1_883_1638 233
348 3300050514 nmdc:mga08x19_117833_c1 nmdc:mga08x19_117833_c1_185_919 233
349 3300050515 nmdc:mga0a205_17039_c1 nmdc:mga0a205_17039_c1_5579_6379 233
350 3300050515 nmdc:mga0a205_459765_c1 nmdc:mga0a205_459765_c1_271_1083 233
351 3300053084 Ga0495595_0073009 Ga0495595_0073009_454_1224 233
352 3300053085 Ga0495619_0296339 Ga0495619_0296339_287_1057 233
353 3300005334 Ga0068869_100040162 Ga0068869_1000401624 234
354 3300005338 Ga0068868_100239854 Ga0068868_1002398542 234
355 3300005354 Ga0070675_100468256 Ga0070675_1004682562 234
356 3300005458 Ga0070681_10392850 Ga0070681_103928502 234
357 3300005471 Ga0070698_100045279 Ga0070698_1000452792 234
358 3300005544 Ga0070686_100147392 Ga0070686_1001473921 234
359 3300005548 Ga0070665_100018385 Ga0070665_1000183859 234
360 3300005842 Ga0068858_100063491 Ga0068858_1000634912 234
361 3300005843 Ga0068860_100283819 Ga0068860_1002838192 234
362 3300005843 Ga0068860_100338616 Ga0068860_1003386162 234
363 3300006237 Ga0097621_100005574 Ga0097621_10000557411 234
364 3300006852 Ga0075433_10219077 Ga0075433_102190772 234
365 3300006881 Ga0068865_100123456 Ga0068865_1001234563 234
366 3300007076 Ga0075435_100372125 Ga0075435_1003721252 234
367 3300009094 Ga0111539_10338843 Ga0111539_103388432 234
368 3300009098 Ga0105245_10007966 Ga0105245_1000796610 234
369 3300009147 Ga0114129_10001609 Ga0114129_100016098 234
370 3300009176 Ga0105242_10191974 Ga0105242_101919743 234
371 3300009551 Ga0105238_10105959 Ga0105238_101059592 234
372 3300009551 Ga0105238_10431292 Ga0105238_104312922 234
373 3300013297 Ga0157378_10387503 Ga0157378_103875032 234
374 3300014326 Ga0157380_10338320 Ga0157380_103383202 234
375 3300017792 Ga0163161_10185710 Ga0163161_101857102 234
376 3300025903 Ga0207680_10158790 Ga0207680_101587902 234
377 3300025927 Ga0207687_10221888 Ga0207687_102218882 234
378 3300025934 Ga0207686_10391463 Ga0207686_103914631 234
379 3300025938 Ga0207704_10265186 Ga0207704_102651862 234
380 3300025942 Ga0207689_10199805 Ga0207689_101998053 234
381 3300026023 Ga0207677_10111746 Ga0207677_101117463 234
382 3300026041 Ga0207639_10349589 Ga0207639_103495892 234
383 3300028381 Ga0268264_10269533 Ga0268264_102695332 234
384 3300028381 Ga0268264_10444157 Ga0268264_104441572 234
385 3300035170 Ga0373943_0003762 Ga0373943_0003762_3981_4742 234
386 3300035171 Ga0373946_0005443 Ga0373946_0005443_3413_4174 234
387 3300035172 Ga0373955_0047283 Ga0373955_0047283_1101_1862 234
388 3300035410 Ga0373924_0007005 Ga0373924_0007005_2312_3073 234
389 3300037068 Ga0373925_0016292 Ga0373925_0016292_413_1174 234
390 3300045051 Ga0451576_0214922 Ga0451576_0214922_748_1557 234
391 3300045836 Ga0466958_0323756 Ga0466958_0323756_69_836 234
392 3300046459 Ga0495629_0108705 Ga0495629_0108705_107_868 234
393 3300046511 Ga0495608_0002623 Ga0495608_0002623_3400_4164 234
394 3300046516 Ga0495628_0042796 Ga0495628_0042796_2336_3100 234
395 3300046517 Ga0495630_0021329 Ga0495630_0021329_3571_4335 234
396 3300046529 Ga0495652_0168854 Ga0495652_0168854_638_1402 234
397 3300046533 Ga0495640_0115004 Ga0495640_0115004_904_1668 234
398 3300046559 Ga0495667_0008533 Ga0495667_0008533_2252_3016 234
399 3300046663 Ga0495635_0337771 Ga0495635_0337771_85_849 234
400 3300046675 Ga0495657_0047815 Ga0495657_0047815_737_1501 234
401 3300046683 Ga0495658_0045161 Ga0495658_0045161_1395_2141 234
402 3300046689 Ga0495613_0006012 Ga0495613_0006012_5709_6473 234
403 3300047471 Ga0495684_0000430 Ga0495684_0000430_17463_18227 234
404 3300048912 Ga0496109_0177322 Ga0496109_0177322_229_975 234
405 3300050507 nmdc:mga05p37_13779_c2 nmdc:mga05p37_13779_c2_68_925 234
406 3300050511 nmdc:mga08y16_401189_c1 nmdc:mga08y16_401189_c1_343_1116 234
407 3300050513 nmdc:mga0rr50_46727_c1 nmdc:mga0rr50_46727_c1_315_1124 234
408 3300053077 Ga0495601_0112942 Ga0495601_0112942_867_1631 234
409 3300053078 Ga0495612_0044640 Ga0495612_0044640_481_1239 234
410 3300053085 Ga0495619_0033397 Ga0495619_0033397_753_1517 234
411 3300005290 Ga0065712_10001548 Ga0065712_100015486 235
412 3300005330 Ga0070690_100356119 Ga0070690_1003561191 235
413 3300005336 Ga0070680_100533887 Ga0070680_1005338872 235
414 3300005338 Ga0068868_100600362 Ga0068868_1006003621 235
415 3300005340 Ga0070689_100362214 Ga0070689_1003622141 235
416 3300005344 Ga0070661_100018622 Ga0070661_1000186222 235
417 3300005364 Ga0070673_100080474 Ga0070673_1000804742 235
418 3300005364 Ga0070673_100238566 Ga0070673_1002385662 235
419 3300005365 Ga0070688_100051154 Ga0070688_1000511543 235
420 3300005365 Ga0070688_100152938 Ga0070688_1001529381 235
421 3300005365 Ga0070688_100195876 Ga0070688_1001958762 235
422 3300005436 Ga0070713_100243582 Ga0070713_1002435823 235
423 3300005457 Ga0070662_100309853 Ga0070662_1003098532 235
424 3300005471 Ga0070698_100002146 Ga0070698_1000021469 235
425 3300005535 Ga0070684_100049945 Ga0070684_1000499452 235
426 3300005549 Ga0070704_100005881 Ga0070704_1000058819 235
427 3300005549 Ga0070704_100167114 Ga0070704_1001671142 235
428 3300005564 Ga0070664_100040871 Ga0070664_1000408714 235
429 3300006058 Ga0075432_10050030 Ga0075432_100500302 235
430 3300006844 Ga0075428_100036786 Ga0075428_1000367865 235
431 3300006846 Ga0075430_100002396 Ga0075430_1000023963 235
432 3300006846 Ga0075430_100085236 Ga0075430_1000852362 235
433 3300006846 Ga0075430_100703775 Ga0075430_1007037751 235
434 3300006847 Ga0075431_100014651 Ga0075431_1000146517 235
435 3300006847 Ga0075431_100026567 Ga0075431_1000265675 235
436 3300006852 Ga0075433_10568814 Ga0075433_105688142 235
437 3300006880 Ga0075429_100102978 Ga0075429_1001029782 235
438 3300006880 Ga0075429_100242214 Ga0075429_1002422142 235
439 3300006880 Ga0075429_100417723 Ga0075429_1004177232 235
440 3300009094 Ga0111539_10000556 Ga0111539_100005569 235
441 3300009094 Ga0111539_10000850 Ga0111539_1000085030 235
442 3300009147 Ga0114129_10136975 Ga0114129_101369754 235
443 3300009147 Ga0114129_10220269 Ga0114129_102202694 235
444 3300009147 Ga0114129_10607010 Ga0114129_106070102 235
445 3300011119 Ga0105246_10343029 Ga0105246_103430292 235
446 3300013308 Ga0157375_10194988 Ga0157375_101949881 235
447 3300014745 Ga0157377_10067855 Ga0157377_100678552 235
448 3300025908 Ga0207643_10422824 Ga0207643_104228241 235
449 3300025928 Ga0207700_10105329 Ga0207700_101053293 235
450 3300025933 Ga0207706_10195601 Ga0207706_101956012 235
451 3300025936 Ga0207670_10245353 Ga0207670_102453532 235
452 3300025942 Ga0207689_10191727 Ga0207689_101917272 235
453 3300025942 Ga0207689_10323996 Ga0207689_103239962 235
454 3300025945 Ga0207679_10033079 Ga0207679_100330794 235
455 3300025960 Ga0207651_10005718 Ga0207651_100057189 235
456 3300025960 Ga0207651_10096873 Ga0207651_100968733 235
457 3300026023 Ga0207677_10123296 Ga0207677_101232962 235
458 3300026118 Ga0207675_100329399 Ga0207675_1003293992 235
459 3300027907 Ga0207428_10001495 Ga0207428_1000149527 235
460 3300027907 Ga0207428_10001962 Ga0207428_1000196218 235
461 3300027907 Ga0207428_10046665 Ga0207428_100466653 235
462 3300035172 Ga0373955_0280144 Ga0373955_0280144_85_846 235
463 3300036401 Ga0373937_0029611 Ga0373937_0029611_2288_3049 235
464 3300045051 Ga0451576_0132120 Ga0451576_0132120_1082_1846 235
465 3300046459 Ga0495629_0027594 Ga0495629_0027594_747_1508 235
466 3300046491 Ga0495584_0061456 Ga0495584_0061456_829_1596 235
467 3300046522 Ga0495643_0013257 Ga0495643_0013257_1058_1801 235
468 3300046528 Ga0495642_0026038 Ga0495642_0026038_277_1044 235
469 3300046539 Ga0495621_0012802 Ga0495621_0012802_1721_2500 235
470 3300046543 Ga0495645_0299830 Ga0495645_0299830_257_1018 235
471 3300046664 Ga0495659_0011145 Ga0495659_0011145_499_1266 235
472 3300046664 Ga0495659_0100815 Ga0495659_0100815_112_852 235
473 3300046684 Ga0495669_0099948 Ga0495669_0099948_291_1070 235
474 3300047318 Ga0495636_0025598 Ga0495636_0025598_1488_2255 235
475 3300047447 Ga0495685_062534 Ga0495685_062534_143_910 235
476 3300048090 Ga0495615_0029127 Ga0495615_0029127_515_1255 235
477 3300048911 Ga0496108_0174394 Ga0496108_0174394_881_1621 235
478 3300048912 Ga0496109_0254679 Ga0496109_0254679_381_1088 235
479 3300049572 Ga0501036_0173847 Ga0501036_0173847_960_1700 235
480 3300049574 Ga0501038_0202379 Ga0501038_0202379_216_956 235
481 3300049575 Ga0501039_0114521 Ga0501039_0114521_1282_2022 235
482 3300049577 Ga0501041_0007828 Ga0501041_0007828_2559_3299 235
483 3300049580 Ga0501046_0353574 Ga0501046_0353574_88_828 235
484 3300049582 Ga0501048_0079742 Ga0501048_0079742_1103_1843 235
485 3300049587 Ga0501071_0045591 Ga0501071_0045591_1893_2633 235
486 3300049588 Ga0501072_0014257 Ga0501072_0014257_2236_2976 235
487 3300049591 Ga0501075_0019658 Ga0501075_0019658_2649_3389 235
488 3300049592 Ga0501076_0092215 Ga0501076_0092215_485_1225 235
489 3300049679 Ga0501249_009824 Ga0501249_009824_412_1152 235
490 3300049741 Ga0501079_0012833 Ga0501079_0012833_2539_3279 235
491 3300049824 Ga0501045_0035619 Ga0501045_0035619_1186_1926 235
492 3300050507 nmdc:mga05p37_456720_c1 nmdc:mga05p37_456720_c1_532_1272 235
493 3300050508 nmdc:mga09592_162500_c1 nmdc:mga09592_162500_c1_874_1581 235
494 3300050508 nmdc:mga09592_201370_c1 nmdc:mga09592_201370_c1_140_880 235
495 3300050508 nmdc:mga09592_29060_c1 nmdc:mga09592_29060_c1_2315_3055 235
496 3300050509 nmdc:mga0qj67_20292_c1 nmdc:mga0qj67_20292_c1_3429_4169 235
497 3300050509 nmdc:mga0qj67_4090_c1 nmdc:mga0qj67_4090_c1_4840_5580 235
498 3300050510 nmdc:mga06r32_16884_c1 nmdc:mga06r32_16884_c1_1032_1772 235
499 3300050510 nmdc:mga06r32_70522_c1 nmdc:mga06r32_70522_c1_2582_3322 235
500 3300050511 nmdc:mga08y16_17319_c1 nmdc:mga08y16_17319_c1_5667_6407 235
501 3300050511 nmdc:mga08y16_3332_c1 nmdc:mga08y16_3332_c1_9418_10158 235
502 3300050511 nmdc:mga08y16_80322_c1 nmdc:mga08y16_80322_c1_1403_2110 235
503 3300050515 nmdc:mga0a205_66017_c1 nmdc:mga0a205_66017_c1_109_816 235
504 3300054114 Ga0501084_0347798 Ga0501084_0347798_132_872 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

23

192

0.95

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

196

249

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rxt-assembly1.cif.gz_CO cryo-em structure of the 90s pre-ribosome (kre33-noc4) from chaetomium thermophilum, state a 0.7488 72 144
3knu-assembly1.cif.gz_B crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.7317 6 200
1vh0-assembly1.cif.gz_A crystal structure of a hypothetical protein 0.7313 72 144
3knu-assembly2.cif.gz_C crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.728 6 200
3knu-assembly1.cif.gz_A crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.7263 6 201
ID Description Score Start End Superfamily
1oy5C01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9114 2 151 3.40.1280.10
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9062 3 151 3.40.1280.10
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8956 6 147 3.40.1280.10
1uajA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.8874 168 235 1.10.1270.20
4yq2A02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.8838 168 232 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A383ABE9-F1-model_v4 tRNA methyltransferase TRMD/TRM10-type domain-containing protein 0.9321 1 130 GO:0002939
GO:0005829
GO:0052906
AF-A0A7X8QN22-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9275 1 154 GO:0002939
GO:0005829
GO:0052906
AF-A0A2V6H9D2-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.922 2 147 GO:0002939
GO:0005829
GO:0052906
AF-A0A351EEN1-F1-model_v4 deleted 0.9177 2 147
AF-A0A0G1WK85-F1-model_v4 tRNA (Guanine-N(1)-)-methyltransferase 0.9132 2 150 GO:0002939
GO:0005829
GO:0052906

Feature Viewer

pLDDT pTM Quality
80.57 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map